NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F094326

Metagenome / Metatranscriptome Family F094326

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F094326
Family Type Metagenome / Metatranscriptome
Number of Sequences 106
Average Sequence Length 135 residues
Representative Sequence MTSQPGTTDRSGTPEDTGRPRRGGPRWASDLSWPLVLPLTLLIILGLAGLRGAVTGPRWNGPLRHDEVVIGLALEVILGVLLALTIRRRSRASRAAALSGAPPNDVPAKLRGVLIFVLGAGMIAVAVGIVVGLHLR
Number of Associated Samples 91
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 94.17 %
% of genes near scaffold ends (potentially truncated) 97.17 %
% of genes from short scaffolds (< 2000 bps) 93.40 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (85.849 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(45.283 % of family members)
Environment Ontology (ENVO) Unclassified
(48.113 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.170 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 54.88%    β-sheet: 0.00%    Coil/Unstructured: 45.12%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF06736TMEM175 16.04
PF13302Acetyltransf_3 15.09
PF00962A_deaminase 5.66
PF00730HhH-GPD 0.94
PF13523Acetyltransf_8 0.94
PF11139SfLAP 0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG3548Uncharacterized membrane proteinFunction unknown [S] 16.04
COG1816Adenosine/6-amino-6-deoxyfutalosine deaminaseNucleotide transport and metabolism [F] 5.66
COG01223-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 0.94
COG0177Endonuclease IIIReplication, recombination and repair [L] 0.94
COG1059Thermostable 8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 0.94
COG1194Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairsReplication, recombination and repair [L] 0.94
COG22313-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamilyReplication, recombination and repair [L] 0.94


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.85 %
UnclassifiedrootN/A14.15 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005437|Ga0070710_11451439Not Available514Open in IMG/M
3300005537|Ga0070730_10867792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii566Open in IMG/M
3300005541|Ga0070733_10156943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1478Open in IMG/M
3300005610|Ga0070763_10109184All Organisms → cellular organisms → Bacteria1404Open in IMG/M
3300006172|Ga0075018_10641817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → unclassified Rhodococcus → Rhodococcus sp. P14568Open in IMG/M
3300009698|Ga0116216_10066371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2221Open in IMG/M
3300009698|Ga0116216_10084040All Organisms → cellular organisms → Bacteria1959Open in IMG/M
3300012971|Ga0126369_13052372Not Available548Open in IMG/M
3300016270|Ga0182036_10411337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1056Open in IMG/M
3300016319|Ga0182033_12197704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii503Open in IMG/M
3300016341|Ga0182035_12008538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii525Open in IMG/M
3300016371|Ga0182034_11604507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii571Open in IMG/M
3300016387|Ga0182040_10857415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii751Open in IMG/M
3300016422|Ga0182039_10495835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1054Open in IMG/M
3300016445|Ga0182038_11228883All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia668Open in IMG/M
3300017821|Ga0187812_1063185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineosporia → Kineosporia babensis1235Open in IMG/M
3300017924|Ga0187820_1032617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineosporia → Kineosporia babensis1356Open in IMG/M
3300017926|Ga0187807_1051717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1274Open in IMG/M
3300017926|Ga0187807_1146865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineosporia → Kineosporia babensis753Open in IMG/M
3300017928|Ga0187806_1251006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii612Open in IMG/M
3300017937|Ga0187809_10440690Not Available502Open in IMG/M
3300017942|Ga0187808_10301614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia722Open in IMG/M
3300017943|Ga0187819_10556404All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii652Open in IMG/M
3300017955|Ga0187817_10713922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii639Open in IMG/M
3300017959|Ga0187779_10166413All Organisms → cellular organisms → Bacteria1366Open in IMG/M
3300017970|Ga0187783_10199039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineosporia → Kineosporia babensis1471Open in IMG/M
3300017972|Ga0187781_11296378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii537Open in IMG/M
3300017973|Ga0187780_10120501All Organisms → cellular organisms → Bacteria1813Open in IMG/M
3300017974|Ga0187777_10765596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineosporia → Kineosporia babensis688Open in IMG/M
3300018007|Ga0187805_10087510All Organisms → cellular organisms → Bacteria1406Open in IMG/M
3300018085|Ga0187772_11436593Not Available513Open in IMG/M
3300020580|Ga0210403_10911079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia693Open in IMG/M
3300020583|Ga0210401_10380128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1274Open in IMG/M
3300021171|Ga0210405_10714097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii773Open in IMG/M
3300021171|Ga0210405_11301070Not Available534Open in IMG/M
3300021180|Ga0210396_11747169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii504Open in IMG/M
3300021401|Ga0210393_10142375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1925Open in IMG/M
3300021407|Ga0210383_11301627Not Available608Open in IMG/M
3300021407|Ga0210383_11349619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii595Open in IMG/M
3300021433|Ga0210391_10060579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3002Open in IMG/M
3300021474|Ga0210390_10343156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1264Open in IMG/M
3300021477|Ga0210398_11174000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii607Open in IMG/M
3300021479|Ga0210410_11217928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → unclassified Nakamurella → Nakamurella sp. YIM 132087644Open in IMG/M
3300027076|Ga0208860_1039254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii509Open in IMG/M
3300027528|Ga0208985_1044195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia867Open in IMG/M
3300027703|Ga0207862_1213277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii571Open in IMG/M
3300027783|Ga0209448_10070042Not Available1179Open in IMG/M
3300027855|Ga0209693_10520088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii568Open in IMG/M
3300027986|Ga0209168_10397252All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii671Open in IMG/M
3300028047|Ga0209526_10647965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii671Open in IMG/M
3300029636|Ga0222749_10327531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. CBMA29797Open in IMG/M
3300030730|Ga0307482_1187704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii622Open in IMG/M
3300031544|Ga0318534_10823159Not Available521Open in IMG/M
3300031545|Ga0318541_10123056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1410Open in IMG/M
3300031549|Ga0318571_10351216Not Available566Open in IMG/M
3300031549|Ga0318571_10410412All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii530Open in IMG/M
3300031564|Ga0318573_10161525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1178Open in IMG/M
3300031680|Ga0318574_10390144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii813Open in IMG/M
3300031680|Ga0318574_10641704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii622Open in IMG/M
3300031682|Ga0318560_10066546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae1809Open in IMG/M
3300031682|Ga0318560_10497732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii660Open in IMG/M
3300031708|Ga0310686_101907385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii726Open in IMG/M
3300031708|Ga0310686_115535807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii589Open in IMG/M
3300031713|Ga0318496_10115468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1450Open in IMG/M
3300031713|Ga0318496_10608816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii603Open in IMG/M
3300031715|Ga0307476_10210886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1412Open in IMG/M
3300031718|Ga0307474_10180566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1601Open in IMG/M
3300031718|Ga0307474_10309471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1218Open in IMG/M
3300031719|Ga0306917_10482402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia973Open in IMG/M
3300031744|Ga0306918_10195555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1522Open in IMG/M
3300031751|Ga0318494_10147760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1322Open in IMG/M
3300031753|Ga0307477_10567923All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii767Open in IMG/M
3300031765|Ga0318554_10039492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2559Open in IMG/M
3300031768|Ga0318509_10352294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii824Open in IMG/M
3300031769|Ga0318526_10144269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii967Open in IMG/M
3300031777|Ga0318543_10400203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii615Open in IMG/M
3300031779|Ga0318566_10657156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii509Open in IMG/M
3300031781|Ga0318547_10198172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1198Open in IMG/M
3300031793|Ga0318548_10134086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1202Open in IMG/M
3300031798|Ga0318523_10330277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii760Open in IMG/M
3300031821|Ga0318567_10670837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii588Open in IMG/M
3300031823|Ga0307478_10113406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2115Open in IMG/M
3300031846|Ga0318512_10084220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1475Open in IMG/M
3300031859|Ga0318527_10402985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii583Open in IMG/M
3300031860|Ga0318495_10089062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1384Open in IMG/M
3300031879|Ga0306919_10817998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii716Open in IMG/M
3300031912|Ga0306921_11997981Not Available618Open in IMG/M
3300031942|Ga0310916_11265525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii608Open in IMG/M
3300031946|Ga0310910_10349688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1168Open in IMG/M
3300031947|Ga0310909_11028587All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii672Open in IMG/M
3300031959|Ga0318530_10358966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii604Open in IMG/M
3300031981|Ga0318531_10278279Not Available756Open in IMG/M
3300032001|Ga0306922_10713761All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1054Open in IMG/M
3300032001|Ga0306922_11080044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii824Open in IMG/M
3300032039|Ga0318559_10088191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1361Open in IMG/M
3300032066|Ga0318514_10593866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii589Open in IMG/M
3300032066|Ga0318514_10714843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii533Open in IMG/M
3300032076|Ga0306924_12161434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii569Open in IMG/M
3300032089|Ga0318525_10132967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1274Open in IMG/M
3300032089|Ga0318525_10739442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii500Open in IMG/M
3300032261|Ga0306920_102623360All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii690Open in IMG/M
3300032896|Ga0335075_10893452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineosporia → Kineosporia babensis815Open in IMG/M
3300033134|Ga0335073_12053517Not Available520Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil45.28%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.09%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment10.38%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.66%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland5.66%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.83%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.89%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.89%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.89%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.94%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.94%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.94%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.94%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300027076Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF012 (SPAdes)EnvironmentalOpen in IMG/M
3300027528Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027703Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030730Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070710_1145143913300005437Corn, Switchgrass And Miscanthus RhizosphereMEDTGTPDGEPRARSAPSWPLVLPLTLLVILGLAGLRGAVTRPRWDGPLRHDSLVIGLVLEVILGILLVLTYRRRSRALHAVAHEQAPANDVAAKLRGVLLLVLGAGMIAVAVAIVVSLHLHLGNGRP
Ga0070730_1086779213300005537Surface SoilMEDTGTPDGEPRARSAPSWPLVLPVLVILGLAGLRGAVTRPRWDGPLRHDSLVIGLALEVILGILLVLTYRRRSRAMRAVAHEQAPADDVAAKLRGVLLLVLGAGMVAV
Ga0070733_1015694313300005541Surface SoilMEDTGTPDGGTRARSAPSWPLVLPLTMLVILGLAGLRGVVTRPRWNGPLRHDSLVIGLALEVILGILLVLTYRRRSRAVRGEAPVNDVAAKLRGVLLLVLGVGMIAVAIVVVVSLHLHLGSGRPVTLPSASAPP
Ga0070763_1010918433300005610SoilMGDGQTPDAGPSAGPGPSWPLVLPLTLLVILGLAGLRGAVTVPRWNGPLRHDGVAIGLALEVILGVLLVLTIRRRSRAMGGSVPVNDVAAKLRGVLTVVLGAGMIAVAVA
Ga0075018_1064181713300006172WatershedsMSSQPGTTGRAETPEGTGGPHDGRTPEGAPRRAFDQAWPLVLPLALLIILGLAGLRGTVAAPKWSGSVRHDGVAIGLALEVILGVLLLLTYRRRSRATRAAMLSGVPVNDVAAKLRGVLIFVLVSGMIAVAVAIVESLHLRVQVPKVR
Ga0116216_1006637113300009698Peatlands SoilMTSRQPGRTAPDTGTPGAGPGQAWALVVPLTLLILLGLAGLRGVVSAPHWNGPLRHDGVVIGLVLEVILGVLLVITVRRRSAAANAAQTHGAPLNDVAAKLRGVLI
Ga0116216_1008404013300009698Peatlands SoilMTSRQPGTTPPGTARNTGTPGAGPRTAPGQAWTLVVPLTLLILLGLAGLRGVVSAPHWNGPLRHDGVVIGLVLEVILGVLLVITVRRRSAAANAAQTHGAPLNDVAAKLRGVLI
Ga0126369_1305237213300012971Tropical Forest SoilTMTSQPGTTGRTGTAGDTGQPRRGGPRRAADLSWPLVLPLTLLIILGLAGLRGTVTGPRWNGPLQHDGAVIGIALEVILGVLLALTIRRRAKALRAATVSGGPTNDVPAKLRGVLIFVLVAGMVAVAVGIIVSLHLRVPPPPLPTTSSSAKPRPVLSVRPRPGSRGLATFHVPVTAILYALL
Ga0182036_1041133713300016270SoilMTSQPGTTDRSGTPEDTGRPRRGGPRWASDLSWPLVLPLTLLIILGMAGLRGAVTGPGWNGPLRHDSVVIGLVLEVILGVLLALTIRRRSRASRAATLSGALPDDVPAKL
Ga0182033_1219770413300016319SoilVSTLPFRQVTKREAMTSQPGTTGRTGDPEDAGHPRRGEPRLASDLSWPLVLPLTLLIILGLAGLRGTVIAPRWNGPLRHDGVVIGLALEVILVILLAVTIRRRSRALRATLPTGAPANDVPAKLRGV
Ga0182035_1200853813300016341SoilMTSQPGTTGRTGTARDTGQPRRGGPRRAADLSWPLVLPLTLLIILGLAGLRGTVTGPRWNGPLRHDGAVIGIALEVILGVLLALTIRRRAKALRAATVSGGPTNDVPAKLRGVLIFVLVAGMVAVAVGIIVSLHLRVPPPPLPTTSSSAKPR
Ga0182034_1160450713300016371SoilMTSQPGTTGRPGTPEDTGYPRRRGPSPASDLSWPLVLPLTLLIILGLAGLRGTVIAPRWNGPLRHDGVVIGLALEVILVILLAVTIRRRSRALRATVPTGAPADDVPAKLRGVLILVLGTGMIAVAVGIIVSLHLRLPSAPPTVPGSSARP
Ga0182040_1085741523300016387SoilMTSQPGTTGRPGTPEDTGYPRRRGPGPASDLSWPLVLPLTLLIILGLAGLRGTVIAPRWNGPLRHDGVVIGLALEVILVILLAVTIRRRSRALRATLPTGAPANDVPAKLRGVLILVLGAGMIAVAVG
Ga0182039_1049583513300016422SoilMTSQPGTTGRTGTAGDTGQPRRGGPRRAADLSWLLVLPLTLLIILGLAGLRGTVTGPRWNGPLQHDGAVIGIALEVILGVLLALTVRRRSKALRAAMVSGGPTNDVPAKLRGVLIFVL
Ga0182038_1122888323300016445SoilMTSQPGTTGRPGTPEDTGYPRRRGPGPASDLSWPLVLPLTLLIILGLAGLRGTVIAPRWNGPLRHDGVVIGLALEVILVILLAVTIRRRSRALRATLPTGAPANDVPAKLRGVLI
Ga0187812_106318513300017821Freshwater SedimentMTSQPGTTGRPGTPEDTGHPRRGGPRLASDLSWPLVLPLTLLIILGLAGLRGAVTVPRWNGPLRHDGVVVGLALEVILGVLLAATIRRRSRALRAAPLSGAPANDVPAKLRGVLIFVLGA
Ga0187820_103261713300017924Freshwater SedimentMTSRQPGTTAPGTARDTGTPGAGPRAAAGQSWTLVLPLTLLILLGLAGLRGTVTAPHWNGPLRHDGVVVGLALEVVLGTLLVITVRRRSAAANAAMGGTPPNDVAAKLRGVLILVLGAGMVAVAAAILIGLHLH
Ga0187807_105171713300017926Freshwater SedimentMTSRQPGATAPGTAPNTGTPGAGPRAAPGQAWALVVPLTLLILLGLAGLRGVVSAPHWNGPLRHDGVVIGLVLEVILGVLLVITVRRGSAAVNAAQAHGAPLNDEAAKLRGVLILVLGAGMVAV
Ga0187807_114686523300017926Freshwater SedimentMTSRQPGTTAPGTARNTGTPGAGPRTAPGEAWTLVVPLTLLILLGLAGLRGVVSAPHWNGPLRHDGVVIGLVLEVILGVLLVITVRRRSAAVNAAQAHGAP
Ga0187806_125100613300017928Freshwater SedimentMTSQPGTTGRPGTPEDTGYPRRRGPRLASDLSWPLVLPLTLLIILGLAGLRGAVTGPRWNGPLRHDAVIIGLVLEVILGVLLGLTVRRRSRALRAPTLSGGPASDVPAKLRGVLIFVLGAGMIAAAVGIIASLRLRLPSTASPVPGSRAEPRA
Ga0187809_1044069013300017937Freshwater SedimentMTSRQPGTTAPGTARDTGTPGAGPRAAPGQSWTLVLPLTLLILLGLAGLRGTVTAPHWNGPLRHDGVVVGLALEVVLGTLLVITVRRRSAAANAAMGGTPPNDVAAKLRGVLILVLGAGMVAVAAAILI
Ga0187808_1030161413300017942Freshwater SedimentVPLTLLILLGLAGLRGVVSAPHWNGPLRHDGVVIGLVLEVILGVLLVITVRRRSAAVNAAQAHGAPLNDVAAKLRGVLILVLGAGMVAVAA
Ga0187819_1055640423300017943Freshwater SedimentMTSKPGTTGRAGTPEDTGHARRGRTPGPGPRLAPDQPWPLVLPLALLIILGLAGLRGAVTAPRWNGPLRHDGVVIGLALEAILGILLVLAVRRRAKAERAGEAGGVPVSDVVAKLRG
Ga0187817_1071392213300017955Freshwater SedimentMTSRQPGTTAPGTTGEVGTPDAGPRAAPGQPWTQVVPLALLILLGLAGLRGAVTAPRWNGPLRHDGVVIGLALEVILGLLLAATLRRRSKASRAALLGGAPPGDVVAKLRGVLIFVLGAGMIAVAVGIVVSLHLRVSAVPRPASSFSARPRPSLSLGPRPGS
Ga0187779_1016641333300017959Tropical PeatlandMTSEPGTTGPGTGSDTGTPEVAPRAGAGSSWPLVLPLALLIILGLAGLRGVVAAPRWNQSLRHDGLAIGLALEVVLGVLLVVTARRRSRASRAAALGQVPLNEVAAKLRQMLLFVLGAGMIGVAVA
Ga0187783_1019903933300017970Tropical PeatlandMTSREPETTAPGTTGDTGTPDGRPRPAPGQTWPLVLPLALLIILGLAGLRGAVASPRWSGSARHDGVVIGLVLEVILGVLLALTVRRRSRAMRAAAAGGAPVNDVAAKLRGVLLVVLGAGMIAVAVAIIVSLHLHLPAPAPGKLSRSAK
Ga0187781_1129637813300017972Tropical PeatlandMTSRQPGTADRAGTPGSGQRPASGQRPASGQPWPLVLPLILLIILGLAGLRGAVTAPRWNGPLRHDGPAIGIALEVILGVLLALTIRRRSGASGAALLGGVPVSDVAAKLRGVLVLVLGAGMVAVAVGIVISLHL
Ga0187780_1012050133300017973Tropical PeatlandMTSQPGTTGRAGTPEATGQPRRDRTPGARPRLATDKSWPLVLPLALLIILGLAGLRGAVAAPRWNGPLRHDGVAIGLALEATLGVLLILTARRRFRAARAAPLSDAPINDVPAKLRGVLIFVLGAGMIAVAVATVVSLHLRMPSVARPPVSGSRIRSSVKPPFKLAPGGPGASLNVPLSA
Ga0187777_1076559613300017974Tropical PeatlandMTSEPGTTGPGTGSDTGTPEVAPRAGAGSSWPLVLPLALLIILGLAGLRGVVAAPRWNQSLRHDGLAIGLALEVVLGVLLVVTARRRSRASRAAALGQVPLNEVAAKL
Ga0187815_1020191013300018001Freshwater SedimentMTSRQPGTTAPGTARDTGTPGAGPRAAAGQSWTLVLPLTLLILLGLAGLRGTVTAPHWNGPLRHDGVVVGLALEVVLGTLLVITVRRRSAAAKFSNPSRTIAFSMLLRV
Ga0187805_1008751013300018007Freshwater SedimentMTSRQPGTTAPGTARNTGTPGAGPRTAPGQAWTLVVPLTLLILLGLAGLRGVVSAPHWNGPLRHDGVVIGLVLEVILGVLLVITVRRRSAAVNAAQAHGAPVNDVPAKLRGVLILVLGAGMVAVAAAILIGLHLH
Ga0187772_1143659313300018085Tropical PeatlandMTGRATLRVGKREAMTSEPGTTGPGTASDTGTPEVAPRAGAGSSWPLVLPLALLIILGLAGLRGAVAAPRWNESLRHDGLAIGLALEVVLGVLLAVTARRRSRASRAAALAQVPLNEVAAKLR
Ga0210403_1091107923300020580SoilMTSQPGTTGPGTTGEVGIPDPGSSAGPGPSWPLVLPLTLLVILGLAGLRGVVTAPRWNGPLRHDGLVIGLALEVILAVLLVLTIRRRSRAMRAPLLGGVPVNDVAAKLRGALTVVLGAGMIAVAV
Ga0210401_1038012833300020583SoilMASQPGTTGPGTTGDTGTPEAGPRSGPGPSWPLVLPLTLLVILGLAGLRGAVTAPRWNGPLRHDGLAIGLALEVILGILLVLTTRRRSRAMRAAPVGGVPVNDVAAKLRGVLTVVLGAGMIAVAVAIFLHLHLHL
Ga0210405_1071409723300021171SoilMTSQPGTTGPGTTGEVGIPDPGPSAGPGPSWPLVLPLTLLVILGLAGLRGVVTAPRWNGPLRHDGLVIGLVLEVILAVLLVLTIRRRSRAMRAPLLGGVPVNDVAAKLRGALTVVLGAGMIAVAVAIFLTLHLRLGERFQ
Ga0210405_1130107013300021171SoilMSSQPGTTGRAEAPEDTGGPRDGRTPEGAPRRTFDQAWPLVLPLALLIILGLAGLRGTVAAPRWSGSLRHDGVAIGLALEVILGVLLLLTYRRRSRATRAAMLSGVPVNDVAAKLRGVLLFAL
Ga0210396_1174716913300021180SoilSVRVRKREDMASQPGTTGPGTTGDTGTPEAGPRSGPGPSWPLVLPLTLLVILGLAGLRGAVTAPRWNGPLRHDGLAIGLALEVILGILLVLTTRRRSRAMRAAPVGGVPVNDVAAKLRGVLTVVLGAGMIAVAVAIFLSLHLHLGGGVPAQPSVSAKPIPRRTLPPQ
Ga0210393_1014237513300021401SoilMASQPGTTGPGTTGDTGTPDAGPRAGSGLSWPLVLPLTLLVILGLAGLRGAVTAPRWNGPLRHDGPAIGIALEVILVVLLVLTIRRRSRAMRAALLGGVPVNDVAAKLRGVLTVVLGAGMIAVAVAIFVS
Ga0210383_1130162713300021407SoilMSSQPGTTGRAGTPEDTGGPHDGRTPEGAPRRAFDQAWPLVLPLALLIILGLAGLRGTVAAPRWSGSVRHDGVAIGLVLEVILGVLLLLTRRRRSRATRAAMLSGVPVNDVAAKLRTVLIFVLAGGMIAVAVAIVESLHL
Ga0210383_1134961913300021407SoilMVFSVQCGPRLGVGFCPGRSGRGPSVRVRKREGMTSQPGTTGPGTTGDTGTPDPGPSVGSGPSWPLVLPLTLLVILGLAGLRGAVIAPRWNGPLRHDGLVIGLVLEVILAVLLVLTIRRRSRARRTAPLGGVPVNDVAAKLRGGLVVVLGAGMIAVAVAIFVTLHLHLG
Ga0210391_1006057913300021433SoilMTSQPGTTGPGTTGEVGIPDPGPSAGPGPSWPLVLPLTLLVILGLAGLRGVVTAPRWNGPLRHDGLVIGLVLEVILAVLLVLTIRRRSRAMRAPLLGGVPVNDV
Ga0210390_1034315623300021474SoilMASQPGTTGPGTTGDTGTPDAGPRAGSGLSWPLVLPLTLLVILGLAGLRGAVTAPRWNGPLRHDGPAIGIALEVILVVLLVLTTRRRSRAMRAALLGGVPVNDVAAKLRGVLTVVLGAGMIAVAVAIFVSLHLHLAG
Ga0210398_1117400013300021477SoilMGDTGTPDAGPRAGPGSSWPLVLPLTLLVILGLAGLRGTVTAPRWNGPLRHDGPVIGLVLEVILGILLVLTIRRRSRALRAASLDGVPVNDVAAKLRAGLLVVLGAGMIAVAVAIFISLHLHLGGSLQPAPTFSVKPLPKRQPRPQAPQPG
Ga0210410_1121792823300021479SoilMASQPGTTGPGTTGDTGTPDAGPRAGSGLSWPLVLPLTLLVILGLAGLRGAVTAPRWNGPLRHDGPAIGIALEVILVVLLVLTTRRRSRAMRAALLGGVPVNDVA
Ga0208860_103925423300027076Forest SoilMASQPGTTGPGTTGDTGTPEAGPRSGPGPSWPLVLPLTLLVILGLAGLRGAVTAPRWNGPLRHDGLAIGLALEVILGILLVLTTRRRSRAMRAAPVGGVPVNDVAAKLRGVLTVVLGAGM
Ga0208985_104419523300027528Forest SoilMDDARAPDPGPSAGLGPSWPLVLPLTLLVILGLAGLRGAVTRPRWNGPLRHDGLVIGLALEVILGALLLLTYRRRARAMRGGVPVNDVAAKLRGFLVLVLGAGMIAVAIGIAVVFFLFPKHDREIA
Ga0207862_121327713300027703Tropical Forest SoilMTSQPGTTGRGGTSEDTGRPRRDRTPGARPRLAADRSWPLVLPLALLIILGLAGLRGAVAAPRWNGPLRHDGVAIGLALEVILGVLLILTARRRFRATRAAPLSDAPINDVPAKLRGVLIVVLGAGMIAVAVATIISLHLRMPSVVPPPVSGSSTRSSVKPAFKLAPGRPGASFYVPLSAVL
Ga0209448_1007004233300027783Bog Forest SoilMSSQPGATGRAGTPEDTGGPHDGRTPDGAPRRAFDQAWPLVLPLALLIILGLAGLRGTVAAPRWSGSVRHDGVAVGLALEVILGILLLLTYRRRSRAARAAMLSGVPVNDVAAKLRGVLIFVLG
Ga0209693_1052008813300027855SoilMGDGQTPDAGPRAGSGRSWPLVLPLTLLVILGLAGLRGAVTAPRWNGPLRHDGPALGLALEVILVLLLVLTTRRRSRAMRAALVGGVPVNDVAAKLRGVLTVVLGAGMIAVAVAIFLSLHLHL
Ga0209168_1039725213300027986Surface SoilMDDTRAPDPGPSAGPGPSWHLVLPLTLLVILGLAGLRGAVTRPRWNGPLRHDGLVIGLALEVILGVLLLLTYRRRARAMRGGVPANDVAAKLRGFLVLVLGAGMIAVAVAIFLSLHLHLGGGVQPAPTFSVKPSPKRTP
Ga0209526_1064796523300028047Forest SoilMGAAQTPDSGPRAGSGSPWPLVLPLALLVILGLAGLRGAVTAPRWNGPLRHDGLVIGLALEVILGVLLMLTERRSRAARATALSEVPVNDVPAKLRAVLLVVFGAGMIAVAVAIFFSLH
Ga0222749_1032753113300029636SoilMRARSGRATGKGQKREGMTSQPGTTGPGTTGDTGTPDAGPRAGSGLSWPLVLPLTLLVILGLAGLRGAVTAPRWNGPLRHDGPAIGIALEVILVVLLVLTIRRRSRAMRAALLGGVPVNDVAAKLRG
Ga0307482_118770423300030730Hardwood Forest SoilMGDGQTPDAGPRAGPGPSWPVVLPLTLLVILGLAGLRGAVTVPRWTGPLRHDGPAIGLALEVILGWLLVLTYRRRSRATGGGVPVNDVAAKLRGVLTVVLGAGMIA
Ga0318534_1082315913300031544SoilMSSQPGTTGRAGTPGDTGGPHDGRTPEGAPRRAFDPAWPLVLPLALLIVLGLAGLRGTVAAPRWSGSVRHDGVAVGLALEVILGVLLLLTYRRRSRAMRAAMLDGVPVNDVAAKLRGVLIFVLGGGMIAVAVAIIESLH
Ga0318541_1012305633300031545SoilMTSQPGTTGRTGEPEGTGRPRRAGPRPASGLSWPLVLPLTLLIILGLAGLRGTVTGPRWNGPLRHDATVIGIALEVILGVLLALTVRRRSKASRAAMVSGGPTNDVPAKLRGVLIVVLGAAMIAVAVG
Ga0318571_1035121613300031549SoilMSSQPGTTGRAGTPGDTGGPHDGRTPEGAPRRAFDPAWPLVLPLALLIVLGLAGLRGTVAAPRWSGSVRHDGVAVGLALEVILGVLLLLTYRRRSRAMRAAMLDGVPVNDVAAKLRGVLIFVLGGGMIAVAVAIIESLHLRV
Ga0318571_1041041213300031549SoilMTSQPGTTGRPGTPEDTGYPRRRGPGPASDLSWPLVLPLTLLIILGLAGLRGTVIAPRWNGPLRHDGVVIGLALEVILVILLAVTIRRRSRALRATPLTGAPTNDVPAKLRGVLI
Ga0318573_1016152533300031564SoilMTSQPGMTGRTGTGGDTDTGHSRHGGPRRAADLSWPLVLPLALLIILGLAGLRGTVTGPRWNGPLRHDATVIGIALEVILGVLLALTVRRRSKASRAAMVSGGPTNDVPAKLRGVLIFVL
Ga0318574_1039014413300031680SoilMTSQPGTTDRSGTPEDTGRPRRGGPRWASDLSWPLVLPLTLLIILGLAGLRGAVTGPRWNGPLRHDEVVIGLALEVILGVLLALTIRRRSRASRAAALSGAPPNDVPAKLRGVLIFVLGAGMIAVAVGIVVGLHLRVSAVAPPLPGHSIKPRVQPTIRRAHLAPE
Ga0318574_1040636723300031680SoilMTSQPGTTGRTGTARDTGQPRRGGPRRAADLSWPLVLPLTLLIILGLAGLRGTVTGPRWNGPLRHDGAVFGIALEVILGVLLALTIRRRAKALRATMISGGPTNDVPAKL
Ga0318574_1064170413300031680SoilMTSQPGTTGRPGTPEDTGYPRRRGPGPASDLSWPLVLPLTLLIILGLAGLRGTVIAPRWNGPLRHDGVVIGLALEVILVILLAVTIRRRSRALRATLPTGAPANDVPAKLRGVLILVL
Ga0318560_1006654613300031682SoilMTSQPGMTGRTGTGGDTDTGHSRHGGPRRAADLSWPLVLPLALLIILGLAGLRGTVTGPRWNGPLRHDATVIGIALEVILGVLLALTVRRRSKASRAAMVSGGPTNDVPAKLRGVLIFVLVAGMVAVAVGIIVSLHLRVPP
Ga0318560_1049773223300031682SoilMTSQPGTTGRPGTPEDTGYPRRRGPGPASDLSWPLVLPLTLLIILGLAGLRGTVIAPRWNGPLRHDGVVIGLALEVILVILLAVTIRRRSRALRATPLTGAPANDVPAKLRGVLILVLGAGMIAVAVGIIVS
Ga0310686_10190738513300031708SoilMTSQPGTTGPGTTGDTGTPDAGPSAGSGPSWPLVLPLTLLVILGLAGLRGAVTTPRWNGPLRHDGLVIGLALEVILGILLVLTHRRRSRAARAALLSGVPVSEAAAKLRGVLTLVLGAGMIAVAVAILVALHLHAFSAPHAPTGVHAK
Ga0310686_11553580713300031708SoilMTSQPGTTGPGTTDGTGTPDAGPRAGSGPSWPLVLPLTLLVILGLAGLRGTVTAPRWNGPLRHDGLVIGLVLEVILGVLLVLTTWRRSRAMRGGVPVNDVAAKLRGGLVVVLG
Ga0318496_1011546833300031713SoilMTSQPGTTGRTGTPEDTGRPRRGEPWRAADLSWPLVLPLTLLIILGMAGLRGAVTGPRWNGPLRHDSVVIGLVLEVILGVLLALTIRRRSRASRAATLSGALPDDVPAKLRGVLIVALGAGLIAVAVGIVIGLHLRVSAVTPPLPAHSTKPAVAPTIRRESL
Ga0318496_1060881613300031713SoilMTSQPGTTGRPGTPEDTGYPRRRGPSPASDLSWPLVLPLTLLIILGLAGLRGTVIAPRWNGPLRHDGVVIGLALEVILVILLAVTIRRRSRALRATPLTGAPANDVPAKLRGVLILVLGAGMIAVAVGIIVS
Ga0307476_1021088633300031715Hardwood Forest SoilMASQPGTTGPGTTGDTGTPDAGPRAGSGLSWPLVLPLTLLVILGLAGLRGAVTAPRWNGPLRHDGPAIGIALEVILVVLLVLTTRRRSRAMRAALLGGVPVNDVAAKLRGVLTVVLGAGMIAVA
Ga0307474_1018056633300031718Hardwood Forest SoilMASQPGTTGPGTTGDTGTPEAGPRAGSGLSWPLVLPLTLLVILGLAGLRGAVTAPRWNGPLRHDALAIGLALEVILGLLLVLTYRRRSQAMRTALLGNVPDNDVAAKLRGVLTVVLGAGMIAVAVAIFVSLHLHLGGRVQ
Ga0307474_1030947133300031718Hardwood Forest SoilMGDGQTPDAGPSAGPGPSWPVVLPLTLLVILGLAGLRGAVTVPRWNGPLRHDGLAIGLALEVILGVLLVLTIRRRSRAMVGGVPVNDVAAKLRGVLTVVLGAGMIAVAVAIFLTLHLHLGGRVQPAPTIS
Ga0306917_1048240223300031719SoilMTSQPGTTGRPGTPEDTGYPRRRGPSPASDLSWPLVLPLTLLIILGLAGLRGTVIAPRWNGPLRHDGVVIGLALEVILVILLAVTIRRRSRALRATPLTGAPTNDVPAKLRGVLILVL
Ga0306917_1132747623300031719SoilMTSQPGTTGRTGTARDTGQPRRGGPRRAADLSWPLVLPLTLLIILGLAGLRGTVTGPRWNGPLRHDGAVIGIALEVILGVLLALTIRRRAKALRATMISGGPTNDVP
Ga0306918_1019555513300031744SoilMTSQPGTTGRPGTPEDTGYPRRRGPGPASDLSWPLVLPLTLLIILGLAGLRGTVIAPRWNGPLRHDGVVIGLALEVILVILLAVTIRRRSRALRATPLTGAPTNDVPAKLRGVLILVLGAGMIAVAVGIIVSLHLRLPSAPPTV
Ga0318494_1014776013300031751SoilMTSQPGTTGRTGTPEDTGRPRRGEPWRAADLSWPLVLPLTLLIILGMAGLRGAVTGPRWNGPLRHDSVVIGLVLEVILGVLLALTIRRRSRASRAATLSGALPDDVPAKLRGVLIVALGAGLIAVAVGIVIGLHLR
Ga0307477_1056792313300031753Hardwood Forest SoilMGDTGTPGAGPRAGPGPSWPLVLPLTLLVILGLAGLRGAVTAPRWNGPLRHDGLVIGLVLEAILAVLLVLTARRRSRAMRADPLGGVPVNDVAAKLRGVLTVVLGAGMIAVAVAIFVSLHLHLGGRVQPAPTVSAKPIPTRTL
Ga0318554_1003949243300031765SoilMTSQPGTTDRSGTPEDTGRPRRGGPRWASDLSWPLVLPLTLLIILGLAGLRGAVTGPRWNGPLRHDEVVIGLALEVILGVLLALTIRRRSRASRAAALSGAPPNDVPAKLRGVLIFVLGAGMIAVAVGIVVGLHLR
Ga0318509_1035229413300031768SoilMTSQPGTTGRPGTPEDTGYPRRRGPGPASDLSWPLVLPLTLLIILGLAGLRGTVIAPRWNGPLRHDGVVIGLALEVILVILLAVTIRRRSRALRATLPTGAPANDVPAKLRGVLILVLGAGMIAVAVGIIVSLHLRLPSAPPTVPGSGARPRVAPKLPH
Ga0318526_1014426923300031769SoilMTSQPGTGRTGEPEGTGRPRRAGPRPASGLSWPLVLPLTLLIILGLAGLRGAVTAPRWNGPLRHDSVVIGLALEVILGVLLAAAIRRRSRALRATVLGGAPESDVPAKLRGLLMFALVVGMIAVAVAIFVSLHLRVGSVAPPVASFSAKPTVKPALKRAPSQP
Ga0318543_1040020323300031777SoilMTSQPGTTGRTGEPEGTGRPRRAGPRPASGLSWPLVLPLTLLIILGLAGLRGAVTAPRWNGPLRHDSVVIGLALEVILGVLLAAAIRRRSRALRATVLGGAPESDVPAKLRGLLI
Ga0318566_1065715613300031779SoilVSTLPFRQVTKREAMTSQPGTTGRTGAPADTGHPGRGGPRLASDLSWPLVLPLTLLIILGLAGLRGAVTAPRWNGPLRHDGAVIGLALEVILGVLLAATVRRRSRALRETTLGDAAANDGPAKLRGVLIFVLGVGMIAVAVAIVISLHLRVASVAPPVPSFSAKPTVKP
Ga0318547_1019817213300031781SoilMTSQPGTTDRSGTPEDTGRPRRGGPRWASDLSWPLVLPLTLLIILGLAGLRGAVTGPRWNGPLRHDEVVIGLALEVILGVLLALTIRRRSRASRAAALSGAPPNDVPAKLRGVLIFVLGAGMIAVAVGIVVGLHLRVS
Ga0318548_1013408613300031793SoilMTSQPGTTGRPGTPEDTGYPRRRGPSPASDLSWPLVLPLTLLIILGLAGLRGTVIAPRWNGPLRHDGVVIGLALEVILVILLAVTIRRRSRALRATLPTGAPANDVPAKLRGVLILVLGAGMIAVAVGIIVSLHLRLPSAPPTVPGSGARPRVAPKLPHPPS
Ga0318523_1033027723300031798SoilMTSQPGTGRTGEPEGTGRPRRAGPRPASGLSWPLVLPLTLLIILGLAGLRGAVTAPRWNGPLRHDSVVIGLALEVILGVLLAAAIRRRSRALRATVLGGAPESDVPAKLRGLLMFALVVGMIAVAVAIFVSLHLRVGSVAPPVASFSAKPTVKPALKRAP
Ga0318567_1067083713300031821SoilMTSQPGTTDRTGTPEDTGRPGRGGPGRAADLSWPLVLPLTLLIILGLAGLRGAVTGPRWNGPLRHDSVVIGLALEVILGVLLALTIRRRSRASRAATLSGAPPNDVPAKLRGVLIVVLGAAMIAVAVGIVIGLHLRVSAVTPPLPVHSTKPAVAPTIRRAS
Ga0307478_1011340643300031823Hardwood Forest SoilMASQPGTTGPGTTGDTGTPDAGPRAGSGLSWPLVLPLTLLVILGLAGLRGAVTAPRWNGPLRHDGPAIGIALELILVVLLVLTIRRRSRAMRAALLGGVPVNDVAAKLRGVLTVVLGAGMIAVAVAIFVSLHLNLAVKLPPQPSGSVKAIPKYKT
Ga0318512_1008422013300031846SoilMTSQPGTTGRPGTPEDTGYPRRRGPSPASDLSWPLVLPLTLLIILGLAGLRGTVIAPRWNGPLRHDGVVIGLALEVILVILLAVTIRRRSRALRANLPTGAPANDVPAKLRGVLILVLGTGM
Ga0318527_1040298513300031859SoilMTSQPGTTGRTGEPEDAEHPRRGEPRLASDLSWPLVLPLTLLIILGLAGLRGTVIAPRWNGPLRHDGVVIGLALEVILGVLLAATIRRRSRASRAAVLSGAPANDVPAKLRGVLIFVLGVGMIAVAVAIFVSLHLRVATLAPPVPSFRARPSVKPTLKRAPSQAGWNLGVPL
Ga0318495_1008906213300031860SoilMTSQPGTTDRTGTPEDTGRPGRGGPGRAADLSWPLVLPLTLLIILGLAGLRGAVTGPRWNGPLRHDEVVIGLALEVILGVLLALTIRRRSRASRAAALSGAPPNDVPAKLRGVLIFVLGAGMIAVAVGIVVGC
Ga0306919_1081799823300031879SoilMTSQPGTTDRTGTPEDTGRPGRGGPGRAADLSWPLVLPLTLLIILGLAGLRGAVTGPRWNGPLRHDSVVIGLALEVILGVLLALTIRRRSRASRAATLSGAPPNDVPAKLRGVLIVVLGAAMIAVAVGIVIGLHLRVSAVTPPLPVHSTKPAVA
Ga0306921_1199798113300031912SoilMSSQPGTTGRAGTPGDTGGPHNDRTPEGAPRRAFDQAWPLVLPLALLIILGLAGLRGTVAAPKWSGSVRHDGVAVGLALEVILGVLLLLTYRRRSRAVRATMLSDVPVNDVAAKLRGVLIFVLGGGMIAVAVAIIESLHLRVHVAN
Ga0310916_1126552513300031942SoilMTSQPGTTGRTGTARDTGQPRRGGPRRAADLSWPLVLPLTLLIILGLAGLRGTVTGPRWNGPLRHDGAVIGIALEVILGVLLALTIRRRAKALRATMISGGPTNDVPAKLRGVLIFVLVAGMVAVAVGIIVSLHLRVPPPPLPTTSSSAKP
Ga0310910_1034968823300031946SoilMTSQPGTTGRTGTARDTGQPRRGGPRRAADLSWPLVLPLTLLIILGLAGLRGTVTGPRWNGPLRHDGAVIGIALEVILGVLLALTIRRRAKALRATMISGGPTNDVPAKLRGVLIFVLVAGMVAVAVGIIVSLHLRVPPPPLPTTSSSAKPRPA
Ga0310909_1102858713300031947SoilMTSQPGTGRTGEPEGTGRPRRAGPRPASGLSWPLVLPLTLLMILGLAGLRGAVTAPRWNGPLRHDSVVIGLALEVILGVLLAAAIRRRSRALRATVLGGAPESDVPAKLRGLLMFALVVGMIAVAVAIFVSLHLRVGSVAPPVASFSAKPTVK
Ga0318530_1035896623300031959SoilMSTGRAIRQVGKHEAMTSQPGTTGRTGEPEGTGRPRRAGPRPASGLSWPLVLPLTLLIILGLAGLRGAVTGPRWNGPLRHDSVVIGLVLEVILGVLLALTIRRRSRASRAATLSGAPPNDVPAKLRGVLIVV
Ga0318531_1027827923300031981SoilMTSQPGMTGRTGTGGDTDTGHSRHGGPRRAADLSWPLVLPLALLIILGLAGLRGTVTGPRWNGPLRHDATVIGIALEVILGVLLALTVRRRSKASRAAMVSGGPTNDVPAKLRGVLIFVLGAGMIAVAVGIIVSLHLRVPPPPLPTTSSSAKPRPT
Ga0306922_1071376123300032001SoilMTSQPGTTGRTGTARDTGQPRRGGPRRAADLSWPLVLPLTLLIILGLAGLRGTVTGPRWNGPLRHDGAVIGIALEVILGVLLALTIRRRAKALRATMISGGPTNDVPAKLRGVLIFVL
Ga0306922_1108004423300032001SoilMTSQPGTTGRPGTPEDTGYPRRRGPGPASDLSWPLVLPLTLLIILGLAGLRGTVIAPRWNGPLRHDGVVIGLALEVILVILLAVTIRRRSRALRATLPTGAPANDVPAKLRGVLILVLGAGMIAVAVGIIVSLHLR
Ga0318559_1008819133300032039SoilMTSQPGTTGRTGEPEGTGRPRRAGPRPASGLSWPLVLPLTLLIILGLAGLRGAVTAPRWNGPLRHDSVVIGLALEVILGVLLAAAIRRRSRALRATVLGGAPESDVPAKLRGLLMFALVVGMIAVAVAIFVSLHLRVGSVAPPVASFSAKPTVKPALKRA
Ga0318514_1059386613300032066SoilMTSQPGTTGRTGTPEDTGRPRRGEPWRAADLSWPLVLPLTLLIILGMAGLRGAVTGPRWNGPLRHDSVVIGLVLEVILGVLLALTIRRRSRASRAATLSGALPDDVPAKLRGVLIVALGAGLIAVAVGIVIGLHLRVSAVTPPLPAHSTKPVVAPTIR
Ga0318514_1071484313300032066SoilMTSQPGTTGRTGKPEDTGHPRRGAPRLASDLSWPLVLPLTLLIILGLAGLRGAVTGPRWNGPLRHDSVVIGLALEVILGVLLAAAIRRRSRALRATVLGGAPESDVPAKLRGLLMFALVVGMIAVAVAIF
Ga0306924_1216143413300032076SoilMSILPFRQVRKHEAMTSQPGTTDRTGTPEDTGRPGRGGPGRAADLSWPLVLPLTLLIILGLAGLRGAVTGPRWNGPLRHDSVVIGLALEVILGVLLALTIRRRSRASRAAALSGAPPNDVPAKLRGVLIFVLGAGMIAVAVGIVVGLHLRVSAVAPPLPGHSIKPRVQPTIRR
Ga0318525_1013296713300032089SoilMTSQPGTTGRTGEPEGTGRPRRAGPRPASGLSWPLVLPLTLLIILGLAGLRGAVTAPRWNGPLRHDSVVIGLALEVILGVLLAAAIRRRSRALRATVLGGAPESDVPAKLRGLLMFALVVGMIAVAVAIFVSLHLRVGSVAPPVASFSAK
Ga0318525_1073944213300032089SoilREAMTSQPGTTGRTGAPADTGHPGRGGPRLASDLSWPLVLPLTLLIILGLAGLRGAVTAPRWNGPLRHDGAVIGLALEVILGVLLAATVRRRSRALRETTLGDAAANDGPAKLRGVLIFVLGVGMIAVAVAIVISLHLRVASVAPPVPSFSAKPTVKPTLKRVPSE
Ga0306920_10262336023300032261SoilMTSQPGTTGRTGTPEDTGRPRRGEPWRAADLSWPLVLPLTLLIILGMAGLRGAVTGPRWNGPLRHDSVVIGLVLEVILGVLLALTIRRRSRASRAATLSGALPDDVPAKLRGVLIVALGAGLIAVAVGIVIGLHLRVSAVTPPLPAHSTKPAVAPTIRRESLP
Ga0335075_1089345223300032896SoilMTSREPGTPDGRPRLAPGQTWPLVVPLALLIILGLAGLRGAMSTPRWNAAARHDGVAIGLALEVVLGVLLALTVRRRSRAARGAVLGEAPVNDVAAKLRGVLVFVLGGGMIAAAVAI
Ga0335073_1205351713300033134SoilMTSREPGTPDGGPRLAPGQTWPLVLPLALLIILGLAGLRGATSAPRWNAAARHDGVVIGLVLEVVLGVLLALMVRRRSRATRDAMLGEVPVNDVAAKLRGVLILVLGGGMIATAVAIFVS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.