Metagenome / Metatranscriptome Family F094325

Overview

Basic Information

• Family ID: F094325
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 106
• Average Sequence Length: 39 residues
• Representative Sequence: RLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF
• Number of Associated Samples: 92
• Number of Associated Scaffolds: 106

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 11.32 %
• % of genes near scaffold ends (potentially truncated): 60.38 %
• % of genes from short scaffolds (< 2000 bps): 92.45 %
• Associated GOLD sequencing projects: 90
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (70.755 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.094 % of family members)
• Environment Ontology (ENVO): Unclassified (29.245 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline) (48.113 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Transmembrane (alpha-helical)
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 53.12%
  β-sheet: 0.00%
  Coil/Unstructured: 46.88%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 106 Family Scaffolds
PF06439	3keto-disac_hyd	6.60
PF00296	Bac_luciferase	6.60
PF13472	Lipase_GDSL_2	2.83
PF03401	TctC	1.89
PF04248	NTP_transf_9	1.89
PF03459	TOBE	1.89
PF02769	AIRS_C	0.94
PF13367	PrsW-protease	0.94
PF07883	Cupin_2	0.94
PF04311	DUF459	0.94
PF01610	DDE_Tnp_ISL3	0.94
PF00580	UvrD-helicase	0.94
PF02265	S1-P1_nuclease	0.94
PF00144	Beta-lactamase	0.94
PF00872	Transposase_mut	0.94
PF13565	HTH_32	0.94
PF04055	Radical_SAM	0.94
PF12071	DUF3551	0.94
PF04392	ABC_sub_bind	0.94
PF00497	SBP_bac_3	0.94
PF00072	Response_reg	0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 106 Family Scaffolds
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	6.60
COG2343	Uncharacterized conserved protein, DUF427 family	Function unknown [S]	1.89
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	1.89
COG0210	Superfamily I DNA or RNA helicase	Replication, recombination and repair [L]	0.94
COG1074	3’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V)	Replication, recombination and repair [L]	0.94
COG1680	CubicO group peptidase, beta-lactamase class C family	Defense mechanisms [V]	0.94
COG1686	D-alanyl-D-alanine carboxypeptidase	Cell wall/membrane/envelope biogenesis [M]	0.94
COG2367	Beta-lactamase class A	Defense mechanisms [V]	0.94
COG2845	Peptidoglycan O-acetyltransferase, SGNH hydrolase family	Cell wall/membrane/envelope biogenesis [M]	0.94
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	0.94
COG3328	Transposase (or an inactivated derivative)	Mobilome: prophages, transposons [X]	0.94
COG3464	Transposase	Mobilome: prophages, transposons [X]	0.94
COG3973	DNA helicase IV	Replication, recombination and repair [L]	0.94

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	70.75 %
Unclassified	root	N/A	29.25 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	70.75 %
Unclassified	root	N/A	29.25 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	70.75 %
Unclassified	root	N/A	29.25 %

Level 4

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	66.04 %
Unclassified	root	N/A	29.25 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.94 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → environmental samples	0.94 %

Level 5

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	56.60 %
Unclassified	root	N/A	29.25 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.94 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.94 %

Level 6

Name	Rank	Taxonomy	Distribution
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	35.85 %
Unclassified	root	N/A	29.25 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	8.49 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1.89 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.94 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.94 %

Level 7

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	34.91 %
Unclassified	root	N/A	29.25 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	5.66 %
Acetobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	1.89 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.94 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.94 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.94 %

Level 8

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	34.91 %
Unclassified	root	N/A	29.25 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2.83 %
unclassified Bradyrhizobiaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae	1.89 %
Craurococcus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Craurococcus	0.94 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.94 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.94 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.94 %

Level 9

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	34.91 %
Unclassified	root	N/A	29.25 %
Bradyrhizobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium	1.89 %
Bradyrhizobium lablabi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	0.94 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Craurococcus → environmental samples	0.94 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.94 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.94 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.94 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.94 %

Level 10

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	34.91 %
Unclassified	root	N/A	29.25 %
Bradyrhizobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium	1.89 %
uncultured Craurococcus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Craurococcus → environmental samples → uncultured Craurococcus sp.	0.94 %
Bradyrhizobium lablabi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	0.94 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.94 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.94 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.94 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.94 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300000364|INPhiseqgaiiFebDRAFT_100577334	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1282
3300000837|AP72_2010_repI_A100DRAFT_1002279	All Organisms → cellular organisms → Bacteria → Proteobacteria	2716
3300002909|JGI25388J43891_1066659	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	547
3300002910|JGI25615J43890_1095152	All Organisms → cellular organisms → Bacteria	529
3300005332|Ga0066388_102715254	Not Available	904
3300005468|Ga0070707_100732958	All Organisms → cellular organisms → Bacteria → Proteobacteria	952
3300005471|Ga0070698_101483043	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	629
3300005553|Ga0066695_10532889	All Organisms → cellular organisms → Bacteria → Proteobacteria	717
3300005562|Ga0058697_10609692	Not Available	571
3300005616|Ga0068852_100073530	All Organisms → cellular organisms → Bacteria → Proteobacteria	3007
3300005618|Ga0068864_100600620	Not Available	1068
3300005713|Ga0066905_100195630	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1506
3300005764|Ga0066903_101079618	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1477
3300005764|Ga0066903_101914442	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1136
3300005764|Ga0066903_104659898	Not Available	730
3300005764|Ga0066903_106554259	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	606
3300005764|Ga0066903_106670978	Not Available	600
3300005764|Ga0066903_108125393	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	537
3300006028|Ga0070717_10729656	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	900
3300006038|Ga0075365_11061616	Not Available	570
3300006172|Ga0075018_10654419	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	564
3300006573|Ga0074055_10011012	Not Available	867
3300006904|Ga0075424_100146997	All Organisms → cellular organisms → Bacteria → Proteobacteria	2496
3300006914|Ga0075436_100335087	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1089
3300007255|Ga0099791_10002737	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	7159
3300009088|Ga0099830_10050101	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2943
3300009090|Ga0099827_10280762	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1405
3300009137|Ga0066709_101250723	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1091
3300009148|Ga0105243_12259528	Not Available	581
3300009162|Ga0075423_11561521	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	709
3300009176|Ga0105242_11254863	Not Available	763
3300009792|Ga0126374_10068631	Not Available	1886
3300009792|Ga0126374_10549265	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	843
3300010043|Ga0126380_11757016	Not Available	559
3300010046|Ga0126384_10684385	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	907
3300010359|Ga0126376_10204177	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1640
3300010360|Ga0126372_11004138	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Craurococcus → environmental samples → uncultured Craurococcus sp.	846
3300010366|Ga0126379_10395442	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1428
3300010366|Ga0126379_10536335	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1248
3300010366|Ga0126379_11463129	Not Available	789
3300010373|Ga0134128_13081479	Not Available	512
3300010376|Ga0126381_102612267	Not Available	723
3300010376|Ga0126381_103360863	Not Available	630
3300010398|Ga0126383_10747079	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1059
3300010398|Ga0126383_13523382	Not Available	511
3300011106|Ga0151489_1604134	Not Available	673
3300012180|Ga0153974_1051166	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	907
3300012198|Ga0137364_10579815	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	845
3300012201|Ga0137365_10857275	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	663
3300012208|Ga0137376_10310207	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1369
3300012349|Ga0137387_10892183	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	643
3300012361|Ga0137360_10618822	Not Available	927
3300012917|Ga0137395_10157785	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1557
3300012929|Ga0137404_12053033	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	534
3300012929|Ga0137404_12142746	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	522
3300012955|Ga0164298_11599883	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	513
3300012960|Ga0164301_10773014	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	731
3300012976|Ga0134076_10036604	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1810
3300014325|Ga0163163_12418695	Not Available	584
3300014969|Ga0157376_13107095	Not Available	503
3300015264|Ga0137403_10559758	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1011
3300015371|Ga0132258_10653778	All Organisms → cellular organisms → Bacteria → Proteobacteria	2643
3300015371|Ga0132258_11543135	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1677
3300016422|Ga0182039_11164406	Not Available	696
3300016445|Ga0182038_11397943	All Organisms → cellular organisms → Bacteria → Proteobacteria	627
3300018468|Ga0066662_11762363	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	648
3300021078|Ga0210381_10404285	Not Available	505
3300021444|Ga0213878_10181426	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	881
3300021560|Ga0126371_12462069	Not Available	630
3300022530|Ga0242658_1123457	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	643
3300022531|Ga0242660_1230460	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	521
3300022533|Ga0242662_10330278	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	515
3300022726|Ga0242654_10384368	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	535
3300025910|Ga0207684_10023821	All Organisms → cellular organisms → Bacteria	5224
3300025910|Ga0207684_10182593	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1809
3300025920|Ga0207649_11586390	Not Available	518
3300025931|Ga0207644_10082951	All Organisms → cellular organisms → Bacteria → Proteobacteria	2372
3300026095|Ga0207676_11014286	Not Available	818
3300027061|Ga0209729_1041354	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	582
3300027502|Ga0209622_1091863	All Organisms → cellular organisms → Bacteria → Proteobacteria	556
3300027654|Ga0209799_1010585	All Organisms → cellular organisms → Bacteria	1976
3300027846|Ga0209180_10449830	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	726
3300027903|Ga0209488_10332121	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	1132
3300027909|Ga0209382_12117925	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	535
3300028592|Ga0247822_10737332	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium	799
3300028711|Ga0307293_10019772	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1971
3300028768|Ga0307280_10034176	All Organisms → cellular organisms → Bacteria → Proteobacteria	1533
3300028811|Ga0307292_10194094	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium	832
3300028824|Ga0307310_10442214	Not Available	650
3300028878|Ga0307278_10379088	Not Available	622
3300031226|Ga0307497_10076817	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	1245
3300031545|Ga0318541_10268440	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	949
3300031765|Ga0318554_10119019	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1490
3300031777|Ga0318543_10157036	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1001
3300031777|Ga0318543_10283668	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	740
3300031782|Ga0318552_10357039	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	744
3300031832|Ga0318499_10082648	Not Available	1232
3300031947|Ga0310909_11021839	Not Available	674
3300032008|Ga0318562_10260244	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1008
3300032055|Ga0318575_10405351	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	692
3300032059|Ga0318533_10820349	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	683
3300032067|Ga0318524_10747336	Not Available	516
3300032174|Ga0307470_10332148	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1046
3300032180|Ga0307471_100384635	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1525
3300032261|Ga0306920_102889999	Not Available	651
3300033290|Ga0318519_10911496	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	543

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	83.02%
Host-Associated	Host-Associated	16.98%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	81.13%
Plants	Host-Associated → Plants	16.04%
Aquatic	Environmental → Aquatic	1.89%
Fungi	Host-Associated → Fungi	0.94%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	81.13%
Rhizosphere	Host-Associated → Plants → Rhizosphere	8.49%
Rhizoplane	Host-Associated → Plants → Rhizoplane	4.72%
Roots	Host-Associated → Plants → Roots	1.89%
Freshwater	Environmental → Aquatic → Freshwater	0.94%
Sediment	Environmental → Aquatic → Sediment	0.94%
Phylloplane	Host-Associated → Plants → Phylloplane	0.94%
Mycelium	Host-Associated → Fungi → Mycelium	0.94%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	66.04%
Loam	Environmental → Terrestrial → Soil → Loam	15.09%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	6.60%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.83%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.89%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.89%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.94%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.94%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	0.94%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.94%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified	0.94%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified	0.94%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	38.68%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	20.75%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	10.38%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	6.60%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	5.66%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.72%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.83%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.89%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.89%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.94%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.94%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.94%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	0.94%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.94%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified	0.94%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified	0.94%

Habitat

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	15.09%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	13.21%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	13.21%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	8.49%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	7.55%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.72%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	3.77%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	3.77%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.83%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	1.89%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.89%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	1.89%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.89%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.89%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.94%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.94%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.94%
Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil	0.94%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.94%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.94%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.94%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.94%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	0.94%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.94%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.94%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.94%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.94%
Agave	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave	0.94%
Attine Ant Fungus Gardens	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens	0.94%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental
3300000837	Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100	Environmental
3300002909	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm	Environmental
3300002910	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm	Environmental
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental
3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Environmental
3300005553	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144	Environmental
3300005562	Agave microbial communities from Guanajuato, Mexico - As.Ma.e	Host-Associated
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental
3300006038	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Host-Associated
3300006172	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014	Environmental
3300006573	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)	Environmental
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated
3300007255	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1	Environmental
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental
3300011106	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2)	Environmental
3300012180	Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaG	Host-Associated
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental
3300012976	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG	Environmental
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated
3300015264	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)	Environmental
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated
3300016422	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111	Environmental
3300016445	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108	Environmental
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental
3300021078	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo	Environmental
3300021444	Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02	Environmental
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental
3300022530	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2)	Environmental
3300022531	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)	Environmental
3300022533	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)	Environmental
3300022726	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)	Environmental
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated
3300027061	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes)	Environmental
3300027502	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes)	Environmental
3300027654	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)	Environmental
3300027846	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)	Environmental
3300027903	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)	Environmental
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated
3300028592	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30	Environmental
3300028711	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150	Environmental
3300028768	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119	Environmental
3300028811	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149	Environmental
3300028824	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197	Environmental
3300028878	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117	Environmental
3300031226	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S	Environmental
3300031545	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26	Environmental
3300031765	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22	Environmental
3300031777	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24	Environmental
3300031782	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20	Environmental
3300031832	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25	Environmental
3300031947	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H	Environmental
3300032008	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18	Environmental
3300032055	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23	Environmental
3300032059	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27	Environmental
3300032067	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22	Environmental
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental
3300033290	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
INPhiseqgaiiFebDRAFT_1005773343	3300000364	Soil	MLWVLEGDMSERRITQLFGLILGGIFTCTLVLSAFAY*
AP72_2010_repI_A100DRAFT_10022791	3300000837	Forest Soil	LRIRPPLTLGWEVEMSERRITQLFGPIPGAIVSCTMVLNAFAF*
JGI25388J43891_10666592	3300002909	Grasslands Soil	GYNQSQRMAIRLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF*
JGI25615J43890_10951521	3300002910	Grasslands Soil	VQPTQRMAGWEVEMSERRITQLFGLGLGAIITCTMVLNALAF*
Ga0066388_1027152542	3300005332	Tropical Forest Soil	MRQMLRVLEGDMSERRITQLFGLILGGIFTCTLVLSAFAY*
Ga0070707_1007329582	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	MANRLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF*
Ga0070698_1014830432	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	MANRLGWELKMSERRITQLFGLVLGAIITCTMVLNAFAF*
Ga0066695_105328891	3300005553	Soil	ALERRLAMSERKITQLFGLILGALFTCTLVLNAFAF*
Ga0058697_106096922	3300005562	Agave	MLRVLEGDMSERRITQLFGLILGGIFTCTLVLSAFAY*
Ga0068852_1000735301	3300005616	Corn Rhizosphere	SVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF*
Ga0068864_1006006201	3300005618	Switchgrass Rhizosphere	LIIRVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF*
Ga0066905_1001956301	3300005713	Tropical Forest Soil	MGVLDMSERRITQLFGLILGALVTCTLVLNAFAF*
Ga0066903_1010796183	3300005764	Tropical Forest Soil	MLAHATNVRVLEGDMSERRITQLFGLILGGIFTCTLVLSAFAY*
Ga0066903_1019144423	3300005764	Tropical Forest Soil	MREIFRAQVGRLDMTERRITQLFGLVLGAIVTCTLVLNAFAF*
Ga0066903_1046598981	3300005764	Tropical Forest Soil	MLYRQEGAMSERRITQVFGLALGAIFTCALVLNAFAY*
Ga0066903_1065542592	3300005764	Tropical Forest Soil	LGWEIEMSERRITQLFGLVLGAIVTCTLVLNAFAF*
Ga0066903_1066709782	3300005764	Tropical Forest Soil	TNQRDRELTMTERRITRLVGLALGALFTCGLILNAFAF*
Ga0066903_1081253931	3300005764	Tropical Forest Soil	RLGWEVEMSERRITQLFGLVLGAIVTCTLVLNAFAF*
Ga0070717_107296561	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	RLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF*
Ga0075365_110616161	3300006038	Populus Endosphere	VLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF*
Ga0075018_106544191	3300006172	Watersheds	GWELEMSERRITQLFGLVLGAIITCTMVLNAFAF*
Ga0074055_100110122	3300006573	Soil	NRSVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF*
Ga0075424_1001469974	3300006904	Populus Rhizosphere	LEREAEMSERRITQLFGLILGALFTCTLVLNAFAF*
Ga0075436_1003350872	3300006914	Populus Rhizosphere	MANRLGWELEMSERRITQVFGLVLGAITTCTMVLNAFAF*
Ga0099791_100027374	3300007255	Vadose Zone Soil	MAGWEVEMSERRITQLFGLGLGAIITCTMVLNALAF*
Ga0099830_100501015	3300009088	Vadose Zone Soil	MANRLGWELEMSERRITQLFGLGLGAIITCTMVLNALAF*
Ga0099827_102807622	3300009090	Vadose Zone Soil	MANRLGWELEMSERRITQLFGLGLGAIITCTMVLNAFAF*
Ga0066709_1012507232	3300009137	Grasslands Soil	MAIRLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF*
Ga0105243_122595282	3300009148	Miscanthus Rhizosphere	TNRSVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF*
Ga0075423_115615212	3300009162	Populus Rhizosphere	MANRLGWEVEMSERRITQLFGLGLGAIITCTMVLNAFAF*
Ga0105242_112548632	3300009176	Miscanthus Rhizosphere	RVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF*
Ga0126374_100686311	3300009792	Tropical Forest Soil	MRNAQVGRLDMTERRITQLFGLVLGAIVTCTLVLNAFAF*
Ga0126374_105492652	3300009792	Tropical Forest Soil	MANRLGWEMEMSERRITQLFGLGLGAIITCTMILNAFAF*
Ga0126380_117570162	3300010043	Tropical Forest Soil	VKSGRLEMSERRITQLFGLILGALFTCTLVLNAFAF*
Ga0126384_106843853	3300010046	Tropical Forest Soil	GGTSQPQMMDMSERRITQLFGLVLGAIVTCTLVLNAFAF*
Ga0126376_102041771	3300010359	Tropical Forest Soil	MANRLGWEMEMSERRITQLFGLGLGAIITCTMVLNAFAF*
Ga0126372_110041382	3300010360	Tropical Forest Soil	VGRLDMSERRITQLFGLILGAIVTCTLVLNAFAF*
Ga0126379_103954424	3300010366	Tropical Forest Soil	SVCGYNQSQRMANRLGWEMEMSERRITQLFGLGLGAIITCTMVLNAFAF*
Ga0126379_105363353	3300010366	Tropical Forest Soil	FRVLEGAMSERRITQWFGLILGAIFTFGLVLNAFAF*
Ga0126379_114631292	3300010366	Tropical Forest Soil	RLVGRLDMSERRITQLFGLILGAIVTCTLVLNAFAF*
Ga0134128_130814791	3300010373	Terrestrial Soil	PTNRSVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF*
Ga0126381_1026122672	3300010376	Tropical Forest Soil	KKGERDMSERKITQLFGLILGVLFACTLVLNVFAF*
Ga0126381_1033608631	3300010376	Tropical Forest Soil	RKIFRAQVGRLDMTERRITQLFGLALGAIVTCTLVLNAFAF*
Ga0126383_107470792	3300010398	Tropical Forest Soil	VVGRLDMTERRITQLFGLILGGMVTCTLVLNAFAF*
Ga0126383_135233821	3300010398	Tropical Forest Soil	MASRLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF*
Ga0151489_16041341	3300011106	Soil	MLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF*
Ga0153974_10511661	3300012180	Attine Ant Fungus Gardens	MANHLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF*
Ga0137364_105798151	3300012198	Vadose Zone Soil	RPMLRVLEGDMSERRITQLFGLILGGIFTCTLVLSAFAY*
Ga0137365_108572752	3300012201	Vadose Zone Soil	RATKVKDGRLDMSERKITQLFGLILGALFTCTLVLNAFAF*
Ga0137376_103102073	3300012208	Vadose Zone Soil	MAIRLGWELEMSERRITQLFGLGLGAIITCTMVLNAFAF*
Ga0137387_108921832	3300012349	Vadose Zone Soil	MPIRLGWELEISERPITQLFGLVLGAIITCTMVLNAFAF*
Ga0137360_106188222	3300012361	Vadose Zone Soil	IARATKVKDGRLEMSERRITQWFGLILGALFTCTLVLNAFAF*
Ga0137395_101577853	3300012917	Vadose Zone Soil	MAGWEVEMSERRITQLFGLVLGAIITCTMVLNAFAF*
Ga0137404_120530331	3300012929	Vadose Zone Soil	RLGWEVEMTERRITQLFGLTLGAMVTCTLVLNAFAF*
Ga0137404_121427462	3300012929	Vadose Zone Soil	MEWGAIMSERQITRLFGLILGAVLTCGLILNAFAF*
Ga0164298_115998832	3300012955	Soil	MANRLGWEVEMSERRITQLFGLVLGAIITCTMVLNAFAF*
Ga0164301_107730142	3300012960	Soil	MANDWVGSWKMSERRITQLFGLVLGAIITCTMVLNAFAF*
Ga0134076_100366044	3300012976	Grasslands Soil	FKWELDMSERKITQLFGLILGILFACTLVLNAFAF*
Ga0163163_124186951	3300014325	Switchgrass Rhizosphere	RSVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF*
Ga0157376_131070951	3300014969	Miscanthus Rhizosphere	TNGVVRPTNRSVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF*
Ga0137403_105597581	3300015264	Vadose Zone Soil	MAGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF*
Ga0132258_106537781	3300015371	Arabidopsis Rhizosphere	DRLIVWVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF*
Ga0132258_115431353	3300015371	Arabidopsis Rhizosphere	MANRLGWELEMSERRITQVFGLVLGAIITCTMVLNAFAF*
Ga0182039_111644062	3300016422	Soil	MRGAAAEMSERKITQLFGLILGALFTCALILNAFAS
Ga0182038_113979431	3300016445	Soil	MANRWVWELEMSERRITQLFGLGLGAIITCTMVLNAFAF
Ga0066662_117623632	3300018468	Grasslands Soil	RMAIRLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF
Ga0210381_104042851	3300021078	Groundwater Sediment	FDRLIVWVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF
Ga0213878_101814262	3300021444	Bulk Soil	MANRLGWELEMSERRITQLFGLGLGAIITCTMVLNAFAF
Ga0126371_124620691	3300021560	Tropical Forest Soil	MRKIFRAQVGRLDMTERRITQLFGLVLGAIVTCTLVLNAFAF
Ga0242658_11234571	3300022530	Soil	DWVGSWKMSERRITQLFGLGLGAIITCTMVLNAFAF
Ga0242660_12304602	3300022531	Soil	LGWELEMSERRITQLFGLGLGAIITCTMVLNAFAF
Ga0242662_103302782	3300022533	Soil	ANHLGWELEMSERRITQLFGLGLGAIITCTMVLNAFAF
Ga0242654_103843681	3300022726	Soil	NDWVGSWKMSERRITQLFGLGLGAIITCTMVLNAFAF
Ga0207684_100238217	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MAIRLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF
Ga0207684_101825933	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MANRLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF
Ga0207649_115863902	3300025920	Corn Rhizosphere	LIVRWLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF
Ga0207644_100829513	3300025931	Switchgrass Rhizosphere	TNGVVRPTNHSVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF
Ga0207676_110142861	3300026095	Switchgrass Rhizosphere	LIIRVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF
Ga0209729_10413542	3300027061	Forest Soil	MANRLGWKLKMSERRITQLFGLVLGAIITCTMVLNAFAF
Ga0209622_10918632	3300027502	Forest Soil	MANRLGWELKMSERRITQLFGLVLGAIITCTMVLNAFAF
Ga0209799_10105852	3300027654	Tropical Forest Soil	MVGTLDMSERRITQLFGLVLGAMVTCTLVLNAFAF
Ga0209180_104498302	3300027846	Vadose Zone Soil	MAGWEVEMSERRITQLFGLGLGAIITCTMVLNALAF
Ga0209488_103321212	3300027903	Vadose Zone Soil	SGLFDRLIVRVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF
Ga0209382_121179252	3300027909	Populus Rhizosphere	NLRVLEGAMSERRITQLFGLILGAIFTFGLVLNAFAF
Ga0247822_107373321	3300028592	Soil	RATNRSVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF
Ga0307293_100197721	3300028711	Soil	LLDRLIVRVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF
Ga0307280_100341763	3300028768	Soil	PSGLFDRLIIWVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF
Ga0307292_101940942	3300028811	Soil	VRVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF
Ga0307310_104422141	3300028824	Soil	PTNGTVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF
Ga0307278_103790881	3300028878	Soil	IVRVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF
Ga0307497_100768171	3300031226	Soil	FDRLIIRVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF
Ga0318541_102684402	3300031545	Soil	MASRLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF
Ga0318554_101190191	3300031765	Soil	VQQPQNLVGRLDMSERRITQLFGLVLGAMVTCTLVLNAFAF
Ga0318543_101570362	3300031777	Soil	RMASRLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF
Ga0318543_102836681	3300031777	Soil	VQVGRLDMSERRITQLFGLILGAIVTCTLVLNAFAF
Ga0318552_103570391	3300031782	Soil	TQRMASRLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF
Ga0318499_100826481	3300031832	Soil	QRMANRLGWELEMSERRITQLFGLGLGAIITCTMVLNAFAF
Ga0310909_110218391	3300031947	Soil	SARCAAEISERKITQLFGLILGALFTCTLILNAFAF
Ga0318562_102602443	3300032008	Soil	VQPTQRMANRLGWELEMSERRITQLFGLGLGAIITCTMVLNAFAF
Ga0318575_104053512	3300032055	Soil	RLRVQPTQRMANRLGWELEMSERRITQLFGLGLGAIITCTMVLNAFAF
Ga0318533_108203491	3300032059	Soil	RVQPTQRMANRLGWELEMSERRITQLFGLGLGAIITCTMVLNAFAF
Ga0318524_107473362	3300032067	Soil	RMANRLGWELEMSERRITQLFGLGLGAIITCTMVLNAFAF
Ga0307470_103321481	3300032174	Hardwood Forest Soil	MAGWEVEMSERRITQLFGLGLGAIITCTMVLNAFAF
Ga0307471_1003846353	3300032180	Hardwood Forest Soil	VIKFSGQVREAEMTERRITQLFGLILGALFTGTLILNAFAF
Ga0306920_1028899992	3300032261	Soil	GNMVWRLDMTERRITQLFGLILGAIVTCTLVLNAFAF
Ga0318519_109114961	3300033290	Soil	LRVQPTQRMANRLGWELEMSERRITQLFGLGLGAIITCTMVLNAFAF