Basic Information | |
---|---|
Family ID | F094304 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 106 |
Average Sequence Length | 40 residues |
Representative Sequence | MLPETLAPAAEILPSLTVSVELAVGSQLPLFVTMVTFQVPS |
Number of Associated Samples | 101 |
Number of Associated Scaffolds | 106 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 62.26 % |
% of genes near scaffold ends (potentially truncated) | 55.66 % |
% of genes from short scaffolds (< 2000 bps) | 84.91 % |
Associated GOLD sequencing projects | 96 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (70.755 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.151 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.585 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.057 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 26.09% Coil/Unstructured: 73.91% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 106 Family Scaffolds |
---|---|---|
PF01042 | Ribonuc_L-PSP | 15.09 |
PF00551 | Formyl_trans_N | 10.38 |
PF00656 | Peptidase_C14 | 1.89 |
PF00291 | PALP | 0.94 |
PF04392 | ABC_sub_bind | 0.94 |
PF06776 | IalB | 0.94 |
PF02774 | Semialdhyde_dhC | 0.94 |
PF01471 | PG_binding_1 | 0.94 |
PF12833 | HTH_18 | 0.94 |
PF04235 | DUF418 | 0.94 |
PF00892 | EamA | 0.94 |
COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
---|---|---|---|
COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 15.09 |
COG4249 | Uncharacterized conserved protein, contains caspase domain | General function prediction only [R] | 1.89 |
COG0002 | N-acetyl-gamma-glutamylphosphate reductase | Amino acid transport and metabolism [E] | 0.94 |
COG0136 | Aspartate-semialdehyde dehydrogenase | Amino acid transport and metabolism [E] | 0.94 |
COG2311 | Uncharacterized membrane protein YeiB | Function unknown [S] | 0.94 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.94 |
COG5342 | Invasion protein IalB, involved in pathogenesis | General function prediction only [R] | 0.94 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 70.75 % |
Unclassified | root | N/A | 29.25 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002245|JGIcombinedJ26739_100327438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1414 | Open in IMG/M |
3300005434|Ga0070709_11568245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3809 | 536 | Open in IMG/M |
3300005447|Ga0066689_10642378 | Not Available | 667 | Open in IMG/M |
3300005519|Ga0077119_10278400 | Not Available | 652 | Open in IMG/M |
3300005529|Ga0070741_10004396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 32968 | Open in IMG/M |
3300005529|Ga0070741_10267073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1622 | Open in IMG/M |
3300005554|Ga0066661_10218585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1181 | Open in IMG/M |
3300005586|Ga0066691_10357553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 865 | Open in IMG/M |
3300005614|Ga0068856_100043735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 4406 | Open in IMG/M |
3300005944|Ga0066788_10192254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3809 | 529 | Open in IMG/M |
3300005993|Ga0080027_10079226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3809 | 1215 | Open in IMG/M |
3300006028|Ga0070717_10005326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 9376 | Open in IMG/M |
3300006050|Ga0075028_100096168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1504 | Open in IMG/M |
3300006173|Ga0070716_100259091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1189 | Open in IMG/M |
3300006358|Ga0068871_100992101 | Not Available | 782 | Open in IMG/M |
3300006358|Ga0068871_101147602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3809 | 728 | Open in IMG/M |
3300006871|Ga0075434_100675889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1050 | Open in IMG/M |
3300007255|Ga0099791_10164274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1041 | Open in IMG/M |
3300009093|Ga0105240_10393777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1562 | Open in IMG/M |
3300009551|Ga0105238_11051991 | Not Available | 836 | Open in IMG/M |
3300010046|Ga0126384_12075553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3809 | 545 | Open in IMG/M |
3300010359|Ga0126376_10326112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1348 | Open in IMG/M |
3300010360|Ga0126372_11620665 | Not Available | 686 | Open in IMG/M |
3300010371|Ga0134125_10025162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6630 | Open in IMG/M |
3300010376|Ga0126381_103988842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3809 | 575 | Open in IMG/M |
3300010866|Ga0126344_1147343 | Not Available | 575 | Open in IMG/M |
3300011120|Ga0150983_14300504 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1525 | Open in IMG/M |
3300012010|Ga0120118_1085594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3809 | 772 | Open in IMG/M |
3300012202|Ga0137363_10946939 | Not Available | 731 | Open in IMG/M |
3300012206|Ga0137380_11644390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3809 | 526 | Open in IMG/M |
3300012207|Ga0137381_10792091 | Not Available | 822 | Open in IMG/M |
3300012357|Ga0137384_10663074 | Not Available | 849 | Open in IMG/M |
3300012361|Ga0137360_10064854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2681 | Open in IMG/M |
3300012395|Ga0134044_1139120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3809 | 655 | Open in IMG/M |
3300012582|Ga0137358_10270403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1155 | Open in IMG/M |
3300012909|Ga0157290_10030282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1266 | Open in IMG/M |
3300012925|Ga0137419_11611395 | Not Available | 552 | Open in IMG/M |
3300012960|Ga0164301_10650988 | Not Available | 786 | Open in IMG/M |
3300013104|Ga0157370_10361367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1338 | Open in IMG/M |
3300013105|Ga0157369_10242237 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1883 | Open in IMG/M |
3300013105|Ga0157369_10316370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1623 | Open in IMG/M |
3300014325|Ga0163163_10038854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM2254 | 4641 | Open in IMG/M |
3300014499|Ga0182012_10356013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 975 | Open in IMG/M |
3300014657|Ga0181522_10024800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3284 | Open in IMG/M |
3300015089|Ga0167643_1000756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 3813 | Open in IMG/M |
3300015372|Ga0132256_102805417 | Not Available | 585 | Open in IMG/M |
3300016319|Ga0182033_10593858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 961 | Open in IMG/M |
3300016319|Ga0182033_12150160 | Not Available | 509 | Open in IMG/M |
3300016445|Ga0182038_10188885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1611 | Open in IMG/M |
3300017947|Ga0187785_10002370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6210 | Open in IMG/M |
3300017973|Ga0187780_10323854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1086 | Open in IMG/M |
3300017975|Ga0187782_11538470 | Not Available | 524 | Open in IMG/M |
3300018058|Ga0187766_10770405 | Not Available | 670 | Open in IMG/M |
3300018090|Ga0187770_11539599 | Not Available | 542 | Open in IMG/M |
3300020069|Ga0197907_10455326 | Not Available | 957 | Open in IMG/M |
3300020081|Ga0206354_11505024 | Not Available | 721 | Open in IMG/M |
3300020580|Ga0210403_11384087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3809 | 534 | Open in IMG/M |
3300021168|Ga0210406_10002595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 20503 | Open in IMG/M |
3300021178|Ga0210408_10012638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6936 | Open in IMG/M |
3300021405|Ga0210387_10283812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1454 | Open in IMG/M |
3300021441|Ga0213871_10035005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2 | 1326 | Open in IMG/M |
3300021559|Ga0210409_11449598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3809 | 562 | Open in IMG/M |
3300021861|Ga0213853_10768885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4125 | Open in IMG/M |
3300021861|Ga0213853_11120405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3809 | 737 | Open in IMG/M |
3300022467|Ga0224712_10194838 | Not Available | 919 | Open in IMG/M |
3300022523|Ga0242663_1120768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3809 | 540 | Open in IMG/M |
3300022530|Ga0242658_1095105 | Not Available | 706 | Open in IMG/M |
3300022531|Ga0242660_1011942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1502 | Open in IMG/M |
3300022533|Ga0242662_10286906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3809 | 545 | Open in IMG/M |
3300025664|Ga0208849_1001381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 17126 | Open in IMG/M |
3300025906|Ga0207699_11310222 | Not Available | 536 | Open in IMG/M |
3300025910|Ga0207684_10170011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1879 | Open in IMG/M |
3300025912|Ga0207707_10050646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3617 | Open in IMG/M |
3300025924|Ga0207694_10334900 | Not Available | 1251 | Open in IMG/M |
3300025939|Ga0207665_10389100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1060 | Open in IMG/M |
3300025981|Ga0207640_11577525 | Not Available | 591 | Open in IMG/M |
3300026281|Ga0209863_10026653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1762 | Open in IMG/M |
3300026304|Ga0209240_1162906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3809 | 684 | Open in IMG/M |
3300026305|Ga0209688_1049982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3809 | 788 | Open in IMG/M |
3300026335|Ga0209804_1212064 | Not Available | 788 | Open in IMG/M |
3300026942|Ga0207783_1019755 | Not Available | 665 | Open in IMG/M |
3300027528|Ga0208985_1023010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3809 | 1207 | Open in IMG/M |
3300027591|Ga0209733_1060180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3809 | 996 | Open in IMG/M |
3300027635|Ga0209625_1060646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3809 | 845 | Open in IMG/M |
3300027817|Ga0209112_10037412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1455 | Open in IMG/M |
3300027829|Ga0209773_10279843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 697 | Open in IMG/M |
3300028566|Ga0302147_10237298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3809 | 610 | Open in IMG/M |
3300030906|Ga0302314_10791498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3809 | 950 | Open in IMG/M |
3300030990|Ga0308178_1170817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3809 | 512 | Open in IMG/M |
3300030997|Ga0073997_12073060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3809 | 874 | Open in IMG/M |
3300031082|Ga0308192_1028698 | Not Available | 761 | Open in IMG/M |
3300031249|Ga0265339_10503947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3809 | 559 | Open in IMG/M |
3300031524|Ga0302320_11407304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3809 | 694 | Open in IMG/M |
3300031543|Ga0318516_10010187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4514 | Open in IMG/M |
3300031590|Ga0307483_1017462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3809 | 682 | Open in IMG/M |
3300031668|Ga0318542_10053861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1835 | Open in IMG/M |
3300031708|Ga0310686_102237249 | Not Available | 517 | Open in IMG/M |
3300031718|Ga0307474_11561614 | Not Available | 519 | Open in IMG/M |
3300031719|Ga0306917_10653397 | Not Available | 827 | Open in IMG/M |
3300031799|Ga0318565_10609372 | Not Available | 525 | Open in IMG/M |
3300031910|Ga0306923_10031233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5749 | Open in IMG/M |
3300031941|Ga0310912_10331545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1180 | Open in IMG/M |
3300032805|Ga0335078_10344336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1983 | Open in IMG/M |
3300032893|Ga0335069_11148435 | Not Available | 853 | Open in IMG/M |
3300032954|Ga0335083_10190573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1888 | Open in IMG/M |
3300033290|Ga0318519_11039922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3809 | 509 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.15% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.55% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.66% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.66% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.72% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.72% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.77% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.83% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.83% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 1.89% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.89% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.89% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.89% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.89% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.89% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.94% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.94% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.94% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.94% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.94% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.94% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.94% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.94% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.94% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.94% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.94% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.94% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.94% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.94% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.94% |
Arabidopsis Root | Host-Associated → Plants → Roots → Epiphytes → Unclassified → Arabidopsis Root | 0.94% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.94% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.94% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.94% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.94% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.94% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005519 | Combined assembly of arab plate scrape CL_Col (Combined Assembly) | Host-Associated | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012395 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300015089 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Host-Associated | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025664 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026942 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 63 (SPAdes) | Environmental | Open in IMG/M |
3300027528 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300028566 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2 | Environmental | Open in IMG/M |
3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030997 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031082 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_193 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031590 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ26739_1003274382 | 3300002245 | Forest Soil | MLPETLAPAPEILPSLTVKVELAVGSQLPLLVTMVTFQSPS* |
Ga0070709_115682452 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPDTFAPAAEILPSVTISVELAVGSQLPLFVTMVTFQVPS* |
Ga0066689_106423782 | 3300005447 | Soil | MLPETSPPAAEILPSVTVKVELAVGSQVPLLVTMVTCQSPS |
Ga0077119_102784002 | 3300005519 | Arabidopsis Root | MVPETLAPGAVILPSETVSMELAVGSQEPVLVTMVTCQLP |
Ga0070741_1000439627 | 3300005529 | Surface Soil | MLPETLAPAAEILPSLTVSVELAVGSQLPLFVTMVTFQVPS* |
Ga0070741_102670731 | 3300005529 | Surface Soil | MLPETLAPAAEILPSATVSVELAVCSQLPVLVTIVTFQT |
Ga0066661_102185851 | 3300005554 | Soil | MLPETSPPAAEILPSVTVKVELAVGSQLPLLVTMVTCQSPS |
Ga0066691_103575531 | 3300005586 | Soil | MLPETSPPAAEILPSVTVKVELAVGSQLPLLVTMVTCQSP |
Ga0068856_1000437357 | 3300005614 | Corn Rhizosphere | MLPVTSAPAAEIFPSVMVSVERVSGSQLPVFVTTFTLQSPS* |
Ga0066788_101922542 | 3300005944 | Soil | MLPVTSAPAPEILPSATVSVERADGSQLPVLVTIVTLQR |
Ga0080027_100792261 | 3300005993 | Prmafrost Soil | MLPEMSAPAAETLPSATVSVERVEGSQLPVFVTTVTFQSPS* |
Ga0070717_100053262 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPETLAPAPEILPSATVKVELAVGSQLPLLVTMVTFQSPS* |
Ga0075028_1000961682 | 3300006050 | Watersheds | MLPETLAPGPEILPSATVKVELAVGSQLPLLVMMVTFQSPS* |
Ga0070716_1002590914 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPETFAPGAEILPSVTVSVELAVGSQPPLFVTMV |
Ga0068871_1009921012 | 3300006358 | Miscanthus Rhizosphere | MLPETSAPPPEILPSVTVTVELALGSQLPLFVTIV |
Ga0068871_1011476023 | 3300006358 | Miscanthus Rhizosphere | MLPDTLVPGPEILPSVTVRVELAVGSQVPVLVTIVTC |
Ga0075434_1006758891 | 3300006871 | Populus Rhizosphere | MLPEMSAPAAEILPSVTVSVELAVGSQLPLFVTMVTFQ |
Ga0099791_101642743 | 3300007255 | Vadose Zone Soil | MLPETLAPAAEILPSATVSVERVDGSQVPVLVTIVTFQS |
Ga0105240_103937773 | 3300009093 | Corn Rhizosphere | MLPETLAPAAEILPSVTVSVELAVCSQLPVFVTMVTFQTPS* |
Ga0105238_110519912 | 3300009551 | Corn Rhizosphere | MVPETLAPAAEILPSVTVSVELAVGSQLPLFVTMVT |
Ga0126384_120755531 | 3300010046 | Tropical Forest Soil | MLPETFAPAAEILPSLTVSVELAVGSQLPLFVTIVTFQTPSNGC* |
Ga0126376_103261121 | 3300010359 | Tropical Forest Soil | MLPETLAPFAEILPSETVRVELAVGSQVPVFVTIVTCHSPS |
Ga0126372_116206652 | 3300010360 | Tropical Forest Soil | MLPETSAPAAEILPSVTVSVELAVGSQLPLFVTIVTLQTPSKGCW |
Ga0134125_100251626 | 3300010371 | Terrestrial Soil | MRPETFAPAAEILPSVTVSVEVAVGSQLPVLVTMVTFQTPS* |
Ga0126381_1039888421 | 3300010376 | Tropical Forest Soil | MLPETFAPADEILPSLTVTVELAEGSQLPLFVTMVTFHVPSKGD* |
Ga0126344_11473431 | 3300010866 | Boreal Forest Soil | MLPDTLAPAAVILPSLTVSVELAEGSQLPLFVTMVTFQTPS* |
Ga0150983_143005044 | 3300011120 | Forest Soil | MLPVTSAPGAETLPSATVSVERLDGSQVPVFVTTVTFHSPS* |
Ga0120118_10855942 | 3300012010 | Permafrost | MLPETSAPAAETLPSATVSVERVDGSQLPLFVTTVTLQS |
Ga0137363_109469391 | 3300012202 | Vadose Zone Soil | MLPETLAPDAEILPSVTDSVELALGSQLPVLVTMVTLQSPS* |
Ga0137380_116443901 | 3300012206 | Vadose Zone Soil | MLPVMSAPAAETLPSVTVNVERVDGSQEPALVTIVTFHSPS* |
Ga0137381_107920911 | 3300012207 | Vadose Zone Soil | MLPDTFAPDPEILPSVTVKVELADGSQLPALVTIVTCHSPS* |
Ga0137384_106630741 | 3300012357 | Vadose Zone Soil | MLPETLAPAPEILPSATVSVELADGSQVPLLVTMVTFQSP |
Ga0137360_100648541 | 3300012361 | Vadose Zone Soil | MLPETLAPGAETLPSETVSVERVVGSQLPALVTIVT |
Ga0134044_11391201 | 3300012395 | Grasslands Soil | MLPETFAPGAETLPSETVSVERVVGSQVPALVTMVTFQS |
Ga0137358_102704031 | 3300012582 | Vadose Zone Soil | MLPETSAPAAETLPSVTVSVERVDGSQEPALVTIVTFQ |
Ga0157290_100302823 | 3300012909 | Soil | MVPETLAPGAVILPSATVSRELAVGSQVPVLVTMVTCQLPSYGVWAKAGAA |
Ga0137419_116113951 | 3300012925 | Vadose Zone Soil | MLPETLAPGPEILPSATVKVELAVGSQVPLLVMMVTFQSPS* |
Ga0164301_106509881 | 3300012960 | Soil | VPEIAAPCAEIFPSMTFTVERDDGSQLPVLVTTVT |
Ga0157370_103613674 | 3300013104 | Corn Rhizosphere | MRPETFAPAAEILPSVTVSVEVAVGSQLPVLVTMVTF |
Ga0157369_102422373 | 3300013105 | Corn Rhizosphere | MLPETLAPAAEILPSVTVSVELAVCSQLPVFVTIVTFQTPS* |
Ga0157369_103163701 | 3300013105 | Corn Rhizosphere | MVPETLAPAAEILPSVTVSVELAVGSQLPLFVTMVTFQVPS* |
Ga0163163_100388546 | 3300014325 | Switchgrass Rhizosphere | MVPETLAPGAVILPSETVSMELAVGSQEPDLVTMVTCQLPS* |
Ga0182012_103560133 | 3300014499 | Bog | MLPETSAPGAVILPSATVSVECVEGSQDPDLVTIVT |
Ga0181522_100248005 | 3300014657 | Bog | MLPVTSAPEAETLPSEIISVERVCGSQLPLFVTTVTLQTPS* |
Ga0167643_10007563 | 3300015089 | Glacier Forefield Soil | MLPVTSAPGAETLPSATVSVERLDGSQLPVFVTTVTFHRPS* |
Ga0132256_1028054171 | 3300015372 | Arabidopsis Rhizosphere | MLPETFAPAAEILPSVTRSVELAVGSQLPLFVTIVSFQVP |
Ga0182033_105938583 | 3300016319 | Soil | MLPETLAPAAEILPSVTVRVELAVGSQLPVLVTIVTCQSP |
Ga0182033_121501601 | 3300016319 | Soil | MLPDTLAPAPEILPSVTVTVEVALGSQLPLCVMMVTFQMPSYGCWAKQGAD |
Ga0182038_101888851 | 3300016445 | Soil | MLPETLAPVDEILPSVTVTVELAVGSHVPLFVTMVTFQ |
Ga0187785_100023706 | 3300017947 | Tropical Peatland | MLPETFEPADEILPSVTVTVELVEASQVPLFVTMVTLQMPSNGD |
Ga0187780_103238542 | 3300017973 | Tropical Peatland | MLPETLAPAAEILPSLTVSVELALGSQLPLFVTMVTFQIPS |
Ga0187782_115384702 | 3300017975 | Tropical Peatland | MLPETFWPAAEILPSVTVSVELAVGSQLPLLVTIVTC |
Ga0187766_107704052 | 3300018058 | Tropical Peatland | MLPETFAPAPEILPSVTRSVELAVGSQLPLFVTMVTFQVPSKGCCA |
Ga0187770_115395992 | 3300018090 | Tropical Peatland | MLPETLAPAAEILPSLTVSVELAVGSQLPLFVTMVTFQIPS |
Ga0197907_104553261 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPETFAPAAEILPSVTVSVELAVGSQLPVFVTMVTFQTPS |
Ga0206354_115050241 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPETFAPGAEILPSVTVSVELAVGSQLPLLVTIVTFQVPSYGCWASADVA |
Ga0210403_113840871 | 3300020580 | Soil | MLPETLAPAPEILPSATVNVELAVGSQVPLLVMMVTFQSPS |
Ga0210406_1000259510 | 3300021168 | Soil | MLPETLAPGPEILPSATVKVELAVGSQLPLLVMMVTFQSPS |
Ga0210408_100126386 | 3300021178 | Soil | MLPETLAPAPEILPSATVKVELAVGSQLPLLVTMVTFQSPS |
Ga0210387_102838124 | 3300021405 | Soil | MLPETSAPAAEILPSATVSVERADGSQLPVFVTMVTFQR |
Ga0213871_100350051 | 3300021441 | Rhizosphere | MLPETSAPDAVILPSLTVSVELAVGSQLPLLVTIVTC |
Ga0210409_114495981 | 3300021559 | Soil | MLPETLAPAPEILPSLTVKVELAVGSQLPLLVTMVTFQSPS |
Ga0213853_107688854 | 3300021861 | Watersheds | MLPETLAPEAEILPSATVKVELAVGSQLPLFVTMVTFQSPS |
Ga0213853_111204051 | 3300021861 | Watersheds | MLPETSEPGAEILPSATVSVERVDGSHDPALVIIVTFQSPS |
Ga0224712_101948381 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPETLAPAAEILPSVTVSVELALGSQLPVFVTMVTFQTPSKGCWARAEV |
Ga0242663_11207682 | 3300022523 | Soil | MLPVTSAPEAETLPSETISVERVCGSQLPLFVTTVTL |
Ga0242658_10951051 | 3300022530 | Soil | MLPETLAPAAEILPSVTVKVELAMGSQLPVLVTIATCQ |
Ga0242660_10119421 | 3300022531 | Soil | MLPVTSAPGAETLPSATVSVERLDGSQVPVFVTTVTFHSPS |
Ga0242662_102869061 | 3300022533 | Soil | MLPDTLAPAAEILPSVTVSVELAVGSQLPLFVTMVTLQVPS |
Ga0208849_10013813 | 3300025664 | Arctic Peat Soil | MLPVTSAPAAETLPSVTVSVERFSGSQEPALVTMVTFQSPS |
Ga0207699_113102221 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPVTSPPPPEILPSLTVTVELAVGSQLPLFVMIVTRQVPS |
Ga0207684_101700114 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPETLAPAPEILPSVTDKVELAVGSQLPLLVTMVTFQSPS |
Ga0207707_100506462 | 3300025912 | Corn Rhizosphere | MVPETLAPAAEILPSVTVSVELAVGSQLPLFVTMVTFQVPS |
Ga0207694_103349003 | 3300025924 | Corn Rhizosphere | MVPETLAPAAEILPSVTVNVELAVGSQLPLFVTMVTFQVPS |
Ga0207665_103891001 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPETFAPGAEILPSVTVSVELAVGSQPPLFVTMVTFQVPSYGCWARAGVA |
Ga0207640_115775251 | 3300025981 | Corn Rhizosphere | MLPETFAPGAEILPSVTVSVELAVGSQPPLFVTMVTFQV |
Ga0209863_100266532 | 3300026281 | Prmafrost Soil | MLPEMSAPAAETLPSATVSVERVEGSQLPVFVTTVTFQSPS |
Ga0209240_11629061 | 3300026304 | Grasslands Soil | MLPLTSAPAAEILPSDTVSVELLEGSQLPLLVTTVTFHSPS |
Ga0209688_10499822 | 3300026305 | Soil | MLPETFAPGAETLPSETVTVERVVGSQVPALVTIVTFQSPSY |
Ga0209804_12120642 | 3300026335 | Soil | MLPETLAPAPEILPSVTVKVELAVGSQLPLLVIMVTFQSPS |
Ga0207783_10197551 | 3300026942 | Tropical Forest Soil | MLPETFAPAEEILPSVTVTVELAVGSHVPLFVTMVTFQIPS |
Ga0208985_10230101 | 3300027528 | Forest Soil | MLPVTSAPAAETFPSVTVSVERFSGSQDPALVTMVTFQSPS |
Ga0209733_10601802 | 3300027591 | Forest Soil | MLPETFAPEAEILPSVTVSVELLDGSQVPVLVTIVTFQSPS |
Ga0209625_10606461 | 3300027635 | Forest Soil | MLPVTSAPGAEILPSVTVSVELLDGSQLPDFVTTVTC |
Ga0209112_100374122 | 3300027817 | Forest Soil | MLPETFAPEAEILPSLTVNVELVLGSQLPLLVTTVTFQVPS |
Ga0209773_102798432 | 3300027829 | Bog Forest Soil | MLPETLAPAPEILPSATVKVELALGSQLPVLVIMVTFQSPS |
Ga0302147_102372982 | 3300028566 | Bog | MLPETSAPGAVILPSATVSVECVEGSQDPDLVTIVTSQSP |
Ga0302314_107914981 | 3300030906 | Palsa | MLPETSEPAADTLPSVTVMVELADGSQVPVLVTIFTL |
Ga0308178_11708171 | 3300030990 | Soil | MLPVTSAPAAETLPSVTLSVERVDGSQLPVLVKTV |
Ga0073997_120730601 | 3300030997 | Soil | MLPDTAAPDAETLPSVTVSVELVDGWQLPLLVTTVTCQSPS |
Ga0308192_10286982 | 3300031082 | Soil | MVPETLAPGAVILPSATVSKELAVGSQEPLLVTMVTCQL |
Ga0265339_105039472 | 3300031249 | Rhizosphere | MLPDTSAPAAETLPSLMVSVERVCGSQVPLLVTTVTLQSPSYGVWAMAGA |
Ga0302320_114073041 | 3300031524 | Bog | MLPRTSAPGPEILPSVTVSVERDEGSQLPVLVMTVTFQSPS |
Ga0318516_100101874 | 3300031543 | Soil | MLPETFAPAEEILPSVTVTVELAVGSHVPLFVTMVTFQTPS |
Ga0307483_10174621 | 3300031590 | Hardwood Forest Soil | MLPVMSAPVAEILPSVTVSVEWVDGSQEPALVTIVTFHRP |
Ga0318542_100538614 | 3300031668 | Soil | MLPETFAPAEEILPSVTVTVELAVGSHVPLFVTMVTFQ |
Ga0310686_1022372492 | 3300031708 | Soil | MLPETSAPGAVILPSATVSVECVEGSQEPALVTMVTSHS |
Ga0307474_115616142 | 3300031718 | Hardwood Forest Soil | MLPETSAPAADTRPSATVSVERADGSQLPVLVRTVT |
Ga0306917_106533971 | 3300031719 | Soil | MLPETLAPAAEILPSVTVRVELAVGSQLPVLVTIVTCQSPSYG |
Ga0318565_106093721 | 3300031799 | Soil | MVPETLAPGAVIRPSETVSMELAVGSQEPLLVTMVT |
Ga0306923_100312337 | 3300031910 | Soil | MLPETFAPAEEILPSVTVTVELAVGSHVPLFVTMVTFQTP |
Ga0310912_103315454 | 3300031941 | Soil | MLPETFAPAEEILPSVTVTVELAVGSHVPLFVTMVTFQIP |
Ga0335078_103443364 | 3300032805 | Soil | MLPETFAPADEILPSVTVTVELAVGSQVPLFVIMVTFQVPSKGD |
Ga0335069_111484352 | 3300032893 | Soil | MLPETLAPDAEILPSVTVSVELAVASQLPLLVTIVTCHR |
Ga0335083_101905732 | 3300032954 | Soil | MLPETFAPVDEILPSVTVTVELVEASQLPLFVIIVTFQVPSYGD |
Ga0318519_110399221 | 3300033290 | Soil | MLPETLAPVDEILPSVTVTVELAVGSHVPLFVTMVTFQVPSYG |
⦗Top⦘ |