 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F094252 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MLRRKTIIVLVITLMVTAMVTAFSYLYISQILRLRIANANE |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 23.08 % |
| % of genes near scaffold ends (potentially truncated) | 12.26 % |
| % of genes from short scaffolds (< 2000 bps) | 10.38 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (87.736 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.924 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.528 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.717 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.52% β-sheet: 0.00% Coil/Unstructured: 43.48% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF02954 | HTH_8 | 97.17 |
| PF00072 | Response_reg | 0.94 |
| PF00691 | OmpA | 0.94 |
| PF13505 | OMP_b-brl | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 87.74 % |
| All Organisms | root | All Organisms | 12.26 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300010343|Ga0074044_10867019 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300010876|Ga0126361_10960454 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300012955|Ga0164298_10241940 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300017927|Ga0187824_10370991 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300021433|Ga0210391_10397111 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300026333|Ga0209158_1118411 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300027652|Ga0209007_1003623 | All Organisms → cellular organisms → Bacteria | 4341 | Open in IMG/M |
| 3300030847|Ga0075405_11232048 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300031236|Ga0302324_100279076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2580 | Open in IMG/M |
| 3300031740|Ga0307468_102269790 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300031819|Ga0318568_10783623 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300031820|Ga0307473_10546028 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300032805|Ga0335078_11782987 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.92% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.49% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.66% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.66% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.66% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.72% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.83% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.83% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.83% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.89% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.89% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.89% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.94% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.94% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.94% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.94% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.94% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.94% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300004476 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022509 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022715 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024220 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU5 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030847 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030848 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300030917 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030935 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032756 | Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_100428423 | 3300001356 | Peatlands Soil | MLRRKTIIVLVITLMVTAMVTAFSYLYISQILRLRIANANETATSLTHQL |
| Ga0068966_13103021 | 3300004476 | Peatlands Soil | MLRRKAIIVLVITLMVTAMVSAFSYLYISQILRLRIANAYETATNLT |
| Ga0062388_1013311971 | 3300004635 | Bog Forest Soil | MFRRKTIIVLAITLMVTAMVSAFSYLYISQILRLRIENANTTATN |
| Ga0070713_1015239161 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRRKTIIVLAITLMVTVMVTAFSYLYLSQILRLRIVNASDTANS |
| Ga0070734_104559372 | 3300005533 | Surface Soil | MLRRKTLIVLVITLMVTIMVSAFSYLYISQILRLRIANAMETASSL |
| Ga0070762_112275751 | 3300005602 | Soil | MLRRKTIIVLVITFMVTAMVASFSYLYISQILRLRIV |
| Ga0070763_101407852 | 3300005610 | Soil | MLRRKTIIVLVITLMVTVMVSAFSFLYISQILRLRIANAYETATSLTHQLAYA |
| Ga0075019_110197221 | 3300006086 | Watersheds | MRRKTKIVLAITFMVTAMVSAFSYLYVSQVLRLRVNNASDTAKL |
| Ga0075014_1000039741 | 3300006174 | Watersheds | MLRRKTIIVLAITLMVTVMVTAFSYLYVSQMLRLRIANAHETAASL |
| Ga0116222_13005192 | 3300009521 | Peatlands Soil | MLRRKTIIVLVITLMVIVMVSAFSYLYISQILRLRVGNTYET |
| Ga0116221_13833482 | 3300009523 | Peatlands Soil | MRRKTIIVLGITFMVTVMVTAFSYLYVSETLSQQITGAC |
| Ga0116225_13581782 | 3300009524 | Peatlands Soil | MRRKAIIVLTITVMVTVMVAAFSYLYISSLLRQRITN |
| Ga0116101_11669732 | 3300009759 | Peatland | MLRRKTIIVLVITLMVTVMVSAFSYLYISQILRLRIANAYETAT |
| Ga0074044_108670192 | 3300010343 | Bog Forest Soil | MLRRKTIIVLVITLMVTAMVSTFSYMYLSQMLRLQIRNEYEAALSLASQFQYAAQ |
| Ga0126376_132857581 | 3300010359 | Tropical Forest Soil | MRRKTIIVLTITLMVTAMVSVFSYLYIQQILRLGIQNAYET |
| Ga0126381_1000295017 | 3300010376 | Tropical Forest Soil | MLRRKTIIVLVITLMVTAMVTVFSYLYVSQILRLRILNAN |
| Ga0126381_1050871331 | 3300010376 | Tropical Forest Soil | MSRKSKIVLAITLMVAVMVSAFSYLYVSQVVRQRLNS |
| Ga0136449_1003223373 | 3300010379 | Peatlands Soil | MLRRKTIIVLTITFMVTLMVSAFSYLYISQVLRLRIDNVNEAANQLTH |
| Ga0136449_1014713321 | 3300010379 | Peatlands Soil | MLRRKTIIVLVITLMVTAMVTAFSYLYISQILRLRIANANE |
| Ga0126361_109604541 | 3300010876 | Boreal Forest Soil | MLRRKTIIVLVITLMVTVMVAAFSFLYISQILRLRIAFANELATSLTHQLAYA |
| Ga0150983_102219172 | 3300011120 | Forest Soil | MRRKTIIVLGITFMVTVMVTAFSYLYVSETLSQQITGAS |
| Ga0137384_103313312 | 3300012357 | Vadose Zone Soil | MLRRKTIIVLVITLMVTVMVTAFSYLYVSQILRLRITNAN |
| Ga0126375_119094482 | 3300012948 | Tropical Forest Soil | MFRRKTIIVLVITLMVATMVTAFSYLYISQILRLRIVGAFDTATSLTHQ |
| Ga0164298_102419401 | 3300012955 | Soil | MRRKTKIILAITFMVVVMVSAFSYLYISQLLRQRLAAAGDI |
| Ga0164307_113231412 | 3300012987 | Soil | MRRKTIIVLVITLMVTVLVSAFSYLYISQILRLRIVS |
| Ga0181526_109244342 | 3300014200 | Bog | MLRRKTIIVLVITLMVTAMVAAFSYLYISQILRLRIANANETAANLTHQL |
| Ga0181522_100139643 | 3300014657 | Bog | MRRKTTIVLAITLLVTVMAVAFSYFYLTQILAQHITGAY |
| Ga0137403_114606022 | 3300015264 | Vadose Zone Soil | MRRKTIIVLTITFMVMIMVLAFSYLYISQILRQRINSAHET |
| Ga0132256_1005589632 | 3300015372 | Arabidopsis Rhizosphere | MLRRKTIIVLTITMMVIVMVTAFSYLYISQILRLRIVNANETASNLTR |
| Ga0187818_102154482 | 3300017823 | Freshwater Sediment | MRRKAIIVFAITLMVAVMVTAFSYLYISQILRQRI |
| Ga0187820_11379281 | 3300017924 | Freshwater Sediment | MFRRKTIIVLVITLMVTAMVTAFSYLYISQILRLRIAN |
| Ga0187824_103709911 | 3300017927 | Freshwater Sediment | MRRKTKIILAITFMVVVMVSAFSYLYISQLLRQRLTSA |
| Ga0187801_104784852 | 3300017933 | Freshwater Sediment | MRRKAIIVFAITLMVAVMVTAFSYLYISQILRQRITS |
| Ga0187808_105675472 | 3300017942 | Freshwater Sediment | MLRRKTIIVLVITLMVTAMVTAFSYLYISQILRLRITS |
| Ga0187781_112386772 | 3300017972 | Tropical Peatland | MRRKTIIVLTITLMVTAMVSVFSYLYIQQILRLGIQN |
| Ga0187782_113153291 | 3300017975 | Tropical Peatland | MLRRKTIIVLVITLMVTVMVSAFSYLYISQMLRLRLQSA |
| Ga0210403_110628381 | 3300020580 | Soil | MLRRKTIIVLVITLMVTVMVASFSYLYISQILRLRINYANET |
| Ga0210396_109018511 | 3300021180 | Soil | MLRRKTIIVLVITLMVTAMVTAFSYLYISQILRLGITSANETATSL |
| Ga0210388_101017453 | 3300021181 | Soil | MLRRKTIIVLVITVMVATLVTAFSILYISQILRLRISNAKE |
| Ga0210388_112565351 | 3300021181 | Soil | MLRRKTIIVLVITLMVTVMVSAFSFLYISQILRLRIANAYETATSLTHQPAY |
| Ga0210385_101000831 | 3300021402 | Soil | MLRRKTIIVLVITLMVTAMVTAFSYLYISQILRLGITSA |
| Ga0210391_103971111 | 3300021433 | Soil | MLRRKTIIVLVITVMVATLVTAFSILYISQILRLRISNAKETATSLTRQLAYAAA |
| Ga0210390_103704842 | 3300021474 | Soil | MRRKTIIVLGITFMVTVMVTAFSYLYISQILRQRITNAY |
| Ga0210402_105205211 | 3300021478 | Soil | MLRRKTIIVLTITFMMTVMVSAFSYLYISQILRLRIDNAQETA |
| Ga0126371_109134522 | 3300021560 | Tropical Forest Soil | MRRKTIIVLTITLMVTAMVSVFSYLYIQQILRLGIQNAYETA |
| Ga0126371_127727922 | 3300021560 | Tropical Forest Soil | MLRRKTIIVLTITMMVIVMVTAFSYLYISQILRLRIVNA |
| Ga0242649_10383712 | 3300022509 | Soil | MLRRKTIIVLVITLMVTAMVTAFSYLYLSQILRLRIANANETATSLTHQLAYA |
| Ga0242659_10748241 | 3300022522 | Soil | MLRRKTIIVLVITLMVTAMVTAFSYLYLSQILRLRIANANETAT |
| Ga0212123_104014032 | 3300022557 | Iron-Sulfur Acid Spring | MLRRKTIIVLVITLMVTVMVAAFSVLYISQILRLRIANANE |
| Ga0242678_10640281 | 3300022715 | Soil | MLRRKTIIVLVITVMVTAMVAAFSYLYISQILRLRIAN |
| Ga0242661_10063073 | 3300022717 | Soil | MLRRKTIIVLVITLMVTAMVAAFSYLYATQILRLRIA |
| Ga0242661_11112502 | 3300022717 | Soil | MLRRKTIIVLVITLMVTAMVTAFSYLYISQILRLRIANANETAT |
| Ga0224568_10162871 | 3300024220 | Plant Litter | MLRRKTIIVLVITLMVTAMVAAFSYLYISQILRLRIANANETASN |
| Ga0207692_103757262 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRRKTIIVLVITLMVTAMVSAFSYLYVSQILRLRIT |
| Ga0207700_103127752 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRKTIIVLVITLMVTVLVSAFSYLYISQILRLRIVSAYETA |
| Ga0207700_112573242 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRRKTIIVLAITLMVTVMVTAFSYLYLSQILRLRIVNASDTANSLTH |
| Ga0207664_105215131 | 3300025929 | Agricultural Soil | MRRKTIIVLVITLMVTVMVSAFSYLYISQILRLRIVNAYETAA |
| Ga0207665_100694791 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRRKTIIVLVITLMVTAMVSAFSYLYVSQILRLR |
| Ga0207665_109311522 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRRKAIIVLTITLMVIVMVTAFSYLYISQILRLRIANANETAS |
| Ga0209470_13811882 | 3300026324 | Soil | MRRKTIIVLVITLMVTVLVSAFSYLYISQILRLRIVSAYETATSLTHQL |
| Ga0209158_11184112 | 3300026333 | Soil | MRRKTKIALAITFMVVVMVSAFSYLYISQLLRQRLNA |
| Ga0209219_10454972 | 3300027565 | Forest Soil | MLRRKTIIVLVITLMVTVMVTAFSILYISQILRLRIA |
| Ga0209007_10036234 | 3300027652 | Forest Soil | MLRRKTIIVLVITLMVATMVTAFSILYISQILRLRISNAKETATSLTRQLAYA |
| Ga0209736_10131211 | 3300027660 | Forest Soil | MLRRKTIIVLVITLMVTVMVTAFSILYISQILRLRIANANDTATSLTHQLAY |
| Ga0209736_12019102 | 3300027660 | Forest Soil | MLRRKTIIVLVITLMVTVMVTAFSILYISQILRLRIANANETATNLTHQLA |
| Ga0209009_10882211 | 3300027667 | Forest Soil | MLRRKTIIVLVITLMVTVMVTAFSILYISQILRLRIANAN |
| Ga0209118_11527921 | 3300027674 | Forest Soil | MRRKAIIVLIITFMVTMMVTAFSYLYISQILRLRITS |
| Ga0209448_101376942 | 3300027783 | Bog Forest Soil | MLRRKTIIVLVITLMVTAMVTAFSYLYISQILRLRIANANETATNLTH |
| Ga0209580_104182392 | 3300027842 | Surface Soil | MRRKIIIVLSITFMVAVMVTVFSVLYISQILNSRAR |
| Ga0209701_101533781 | 3300027862 | Vadose Zone Soil | MRRKTIIVLTLTFMVTVMVSAFSYLYISQVLRLRA |
| Ga0209167_107421942 | 3300027867 | Surface Soil | MLRRKTIIVLVITLMVTAMVSAFSYLYISQILRLRIANAY |
| Ga0209169_101031471 | 3300027879 | Soil | MLRRKTIIVLVITLMVTVMVAGFSFVYIRQIVRLRLENANTTAEKLVRQLVFTAEND |
| Ga0209067_100340731 | 3300027898 | Watersheds | MLRRKTIIVLAITLMVTVMVTAFSYLYLSQILRLRIANAHETATSLT |
| Ga0302219_101963191 | 3300028747 | Palsa | MFRRKTIIVLVVALMVTTMVTAFSYLYISQFLRLRIANDCD |
| Ga0311352_112258292 | 3300029944 | Palsa | MLRRKTIIVLVITFMVAAMVASFSYLYVSQILRLRIVNAN |
| Ga0311371_110926621 | 3300029951 | Palsa | MLRRKTIIVLVITFMVAAMVASFSYLYVSQILRLRIV |
| Ga0311346_102314551 | 3300029952 | Bog | MRRKTIIVLAITLLVTVMVTAFSYLYISQILRQRIDNTYES |
| Ga0302179_100483291 | 3300030058 | Palsa | MRRKAIIVTGITFMVTVMVTAFSYLYISQILRQRITNA |
| Ga0311372_117588292 | 3300030520 | Palsa | MRRKFIIVTTITFMVTVTVSAFSYLYTSVILRMNIT |
| Ga0311357_113067111 | 3300030524 | Palsa | MFRRKTIIVLVVALMVTTMVTAFSYLYISQFLRLRIANDCDTADSLT |
| Ga0310038_104061821 | 3300030707 | Peatlands Soil | MLRRKAIIVLVITLMVTTMVSAFSYLYISQILRLRVA |
| Ga0075405_112320482 | 3300030847 | Soil | MRRKIIIVLAITFMVTVMVTAFSYLYISQILRQRI |
| Ga0075388_113490502 | 3300030848 | Soil | MLRRKTIIVLVITLMVMVMVSAFSYLYISQILRLRVSSTNETATNLTHQLA |
| Ga0302314_112972902 | 3300030906 | Palsa | MRRKAIIVTGITFMVTVMVTAFSYLYITQILRQRITSAYE |
| Ga0075382_108012091 | 3300030917 | Soil | MLRRKTIIVLVISLMVTVMVTAFSYLYLSQILRLRISNANETATS |
| Ga0075401_117516642 | 3300030935 | Soil | MRRKIIIVLAITFMVTVMVTAFSYLYISQILRQRIGTANE |
| Ga0265760_103229801 | 3300031090 | Soil | MRRKTIIVLGITFMVTVMVTAFSYLYVSETLSQQITGACDG |
| Ga0302324_1002790763 | 3300031236 | Palsa | MRRKAIIVTGITFMVTVMVTAFSYLYITQILRQRIT |
| Ga0265325_103459341 | 3300031241 | Rhizosphere | MLRRKTIIVLVITLMVTAMVTAFSYLYISQILRLRITNANETATSLTHQLA |
| Ga0170819_159210242 | 3300031469 | Forest Soil | MLRRKTIIVLVITLMVTAMVTAFSYLYVSQILRLRIVSANETA |
| Ga0310686_1138990551 | 3300031708 | Soil | MRRKTIIVLAITLLVTVMAAAFSYLYISEILGQQISEA |
| Ga0307474_106652582 | 3300031718 | Hardwood Forest Soil | MLRRKTIIVLVITLMVTVMVTAFSFLYISQILRLRIANANE |
| Ga0307468_1022697902 | 3300031740 | Hardwood Forest Soil | MRRKTKIILAITFMVVVMVSAFSYLYISQLLRQRL |
| Ga0318568_107836231 | 3300031819 | Soil | MRRKTKIVLAITFMVVVMVTAFSYLYISQLLRQRLN |
| Ga0307473_105460282 | 3300031820 | Hardwood Forest Soil | MRRKTKIVLAITFMVVTMVSAFSYLYISLFLRQRLNS |
| Ga0306926_107723292 | 3300031954 | Soil | MLRRKTIIVLAITLMVTVMVTTFSYLYVSQMLRWRITNAQETA |
| Ga0311301_120138681 | 3300032160 | Peatlands Soil | MLRRKTIIVLTITFMVTLMVSAFSYLYISQVLRLRID |
| Ga0315742_131657091 | 3300032756 | Forest Soil | MLRRKTIIVLVITLMVTVMVAAFSFLYISQILRLRIAFANELATSLTHQ |
| Ga0335079_105868442 | 3300032783 | Soil | MLRRKTIIVLAITLMVTTMVSAFSYLYISQILRLRIVNAHETASSLTRQIAFS |
| Ga0335079_114736281 | 3300032783 | Soil | MLRRKTIIVLAITFMVAAMVSAFSYLYISQILRLRIENAHE |
| Ga0335078_117829872 | 3300032805 | Soil | MLRRKTIIVLTIALMVTAMVSAFSYLYISQILRLRIANAYETATNLTHQLAYA |
| Ga0335080_117587601 | 3300032828 | Soil | MRRKTIIVLVITLMVTAMVSAFSYLYISQIHRQRIANAY |
| Ga0335084_111319041 | 3300033004 | Soil | MLRRKTIIVLVITLMVTAMVTAFSYLYISQILRLRIVNAYETATSLTHQ |
| Ga0335073_103984592 | 3300033134 | Soil | MRRKTIIVLVITLMVTAMVTAFSYLYISQILRLRIANAY |
| Ga0310914_108658672 | 3300033289 | Soil | MLRRKTIIVLAITLMVTAMVTAFSYLYVSQILRLRIAN |
| Ga0310811_110612071 | 3300033475 | Soil | MRRKTIIVLVITLMVTAMVTAFSYLYISQILRLRIAGAYETATSL |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |