NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F094244

Metagenome Family F094244

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F094244
Family Type Metagenome
Number of Sequences 106
Average Sequence Length 51 residues
Representative Sequence GLMSDADVALATRLLPHHTHVKFRNLGHALFIQQPEPVLRAVTNFLESL
Number of Associated Samples 98
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.94 %
% of genes near scaffold ends (potentially truncated) 97.17 %
% of genes from short scaffolds (< 2000 bps) 87.74 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (83.962 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog
(12.264 % of family members)
Environment Ontology (ENVO) Unclassified
(29.245 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(35.849 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 57.14%    β-sheet: 10.20%    Coil/Unstructured: 32.65%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF00278Orn_DAP_Arg_deC 32.08
PF02784Orn_Arg_deC_N 30.19
PF03544TonB_C 8.49
PF07228SpoIIE 5.66
PF13185GAF_2 4.72
PF03572Peptidase_S41 0.94
PF02806Alpha-amylase_C 0.94
PF00156Pribosyltran 0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG0019Diaminopimelate decarboxylaseAmino acid transport and metabolism [E] 62.26
COG1166Arginine decarboxylase (spermidine biosynthesis)Amino acid transport and metabolism [E] 62.26
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 8.49
COG02961,4-alpha-glucan branching enzymeCarbohydrate transport and metabolism [G] 0.94
COG0366Glycosidase/amylase (phosphorylase)Carbohydrate transport and metabolism [G] 0.94
COG0793C-terminal processing protease CtpA/Prc, contains a PDZ domainPosttranslational modification, protein turnover, chaperones [O] 0.94
COG1523Pullulanase/glycogen debranching enzymeCarbohydrate transport and metabolism [G] 0.94


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.96 %
UnclassifiedrootN/A16.04 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001661|JGI12053J15887_10393542Not Available666Open in IMG/M
3300004082|Ga0062384_100816851All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300004091|Ga0062387_101280240All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300004092|Ga0062389_100455989All Organisms → cellular organisms → Bacteria1415Open in IMG/M
3300004463|Ga0063356_102465843All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300005334|Ga0068869_100554075All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300005446|Ga0066686_10607878All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter743Open in IMG/M
3300005518|Ga0070699_101604318All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300005537|Ga0070730_10853867All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300005591|Ga0070761_10408033All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae829Open in IMG/M
3300006052|Ga0075029_100701535All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300006102|Ga0075015_100045133All Organisms → cellular organisms → Bacteria2065Open in IMG/M
3300006174|Ga0075014_100201049All Organisms → cellular organisms → Bacteria1004Open in IMG/M
3300006174|Ga0075014_100846800All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium544Open in IMG/M
3300006358|Ga0068871_100216685All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1657Open in IMG/M
3300006642|Ga0075521_10073581All Organisms → cellular organisms → Bacteria1532Open in IMG/M
3300009088|Ga0099830_11665236All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300009156|Ga0111538_12464711All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300009547|Ga0116136_1082441All Organisms → cellular organisms → Bacteria851Open in IMG/M
3300009616|Ga0116111_1066188All Organisms → cellular organisms → Bacteria → Acidobacteria989Open in IMG/M
3300009617|Ga0116123_1073485Not Available938Open in IMG/M
3300009623|Ga0116133_1122322All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii671Open in IMG/M
3300009632|Ga0116102_1150844All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300009635|Ga0116117_1013412All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2096Open in IMG/M
3300009643|Ga0116110_1130407All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300009644|Ga0116121_1126371All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300009792|Ga0126374_11593469All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300010304|Ga0134088_10679082All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300010343|Ga0074044_10871481All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7588Open in IMG/M
3300010379|Ga0136449_104068711All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae545Open in IMG/M
3300011120|Ga0150983_10603199All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7607Open in IMG/M
3300011270|Ga0137391_10754211Not Available805Open in IMG/M
3300012210|Ga0137378_11253969All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300012350|Ga0137372_10573574Not Available831Open in IMG/M
3300012363|Ga0137390_10439160All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1282Open in IMG/M
3300012685|Ga0137397_10614927All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300012922|Ga0137394_10247399All Organisms → cellular organisms → Bacteria1524Open in IMG/M
3300014159|Ga0181530_10445030All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300014491|Ga0182014_10053433All Organisms → cellular organisms → Bacteria2757Open in IMG/M
3300014493|Ga0182016_10064586All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2753Open in IMG/M
3300014498|Ga0182019_10476299All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium862Open in IMG/M
3300014501|Ga0182024_12597421All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7544Open in IMG/M
3300014638|Ga0181536_10249934All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii849Open in IMG/M
3300015052|Ga0137411_1015834All Organisms → cellular organisms → Bacteria1030Open in IMG/M
3300016341|Ga0182035_11563122Not Available594Open in IMG/M
3300017823|Ga0187818_10339643Not Available662Open in IMG/M
3300017925|Ga0187856_1016085All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4006Open in IMG/M
3300017925|Ga0187856_1168575All Organisms → cellular organisms → Bacteria813Open in IMG/M
3300017996|Ga0187891_1049156All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1778Open in IMG/M
3300018012|Ga0187810_10023565All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2227Open in IMG/M
3300018016|Ga0187880_1271138Not Available741Open in IMG/M
3300018025|Ga0187885_10068443All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1777Open in IMG/M
3300018025|Ga0187885_10242351All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae825Open in IMG/M
3300018026|Ga0187857_10131996All Organisms → cellular organisms → Bacteria1196Open in IMG/M
3300018044|Ga0187890_10219168All Organisms → cellular organisms → Bacteria1075Open in IMG/M
3300018046|Ga0187851_10454984All Organisms → cellular organisms → Bacteria → Acidobacteria729Open in IMG/M
3300018047|Ga0187859_10691098All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300019882|Ga0193713_1102886All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300021475|Ga0210392_11155572All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300021477|Ga0210398_10450772All Organisms → cellular organisms → Bacteria1048Open in IMG/M
3300024295|Ga0224556_1125700All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium628Open in IMG/M
3300025442|Ga0208034_1009728All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3322Open in IMG/M
3300025442|Ga0208034_1097462Not Available500Open in IMG/M
3300025711|Ga0207696_1126461All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300025922|Ga0207646_10201527All Organisms → cellular organisms → Bacteria1798Open in IMG/M
3300027768|Ga0209772_10117811Not Available823Open in IMG/M
3300027854|Ga0209517_10069006All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2523Open in IMG/M
3300027857|Ga0209166_10577994All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300027898|Ga0209067_10318636All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300027898|Ga0209067_10764066All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300027905|Ga0209415_10658539All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300028268|Ga0255348_1052803All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300028379|Ga0268266_10371631All Organisms → cellular organisms → Bacteria1347Open in IMG/M
3300028572|Ga0302152_10170863Not Available699Open in IMG/M
3300028574|Ga0302153_10065037All Organisms → cellular organisms → Bacteria1227Open in IMG/M
3300028788|Ga0302189_10169265All Organisms → cellular organisms → Bacteria932Open in IMG/M
3300028882|Ga0302154_10265464Not Available852Open in IMG/M
3300029817|Ga0247275_1040622All Organisms → cellular organisms → Bacteria1349Open in IMG/M
3300029907|Ga0311329_10408214All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae948Open in IMG/M
3300029913|Ga0311362_10327141All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1570Open in IMG/M
3300029987|Ga0311334_10995801Not Available697Open in IMG/M
3300030003|Ga0302172_10302157Not Available517Open in IMG/M
3300030020|Ga0311344_10123616All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2863Open in IMG/M
3300030507|Ga0302192_10370661All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300030688|Ga0311345_11064319Not Available601Open in IMG/M
3300031128|Ga0170823_15554679All Organisms → cellular organisms → Bacteria → Proteobacteria603Open in IMG/M
3300031128|Ga0170823_16546224All Organisms → cellular organisms → Bacteria874Open in IMG/M
3300031236|Ga0302324_101910885Not Available749Open in IMG/M
3300031259|Ga0302187_10389921All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300031524|Ga0302320_10822221All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1023Open in IMG/M
3300031546|Ga0318538_10618222All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300031708|Ga0310686_109484361All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300031711|Ga0265314_10303238All Organisms → cellular organisms → Bacteria895Open in IMG/M
3300031720|Ga0307469_11659091All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300031720|Ga0307469_12236087All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7533Open in IMG/M
3300031770|Ga0318521_10580530All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300031788|Ga0302319_10075762All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5071Open in IMG/M
3300031788|Ga0302319_11450889All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300031912|Ga0306921_12713802Not Available509Open in IMG/M
3300032001|Ga0306922_10059992All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3955Open in IMG/M
3300032035|Ga0310911_10230201Not Available1059Open in IMG/M
3300032180|Ga0307471_100075709All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2931Open in IMG/M
3300032828|Ga0335080_10330839All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1647Open in IMG/M
3300033158|Ga0335077_11195557All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300033433|Ga0326726_10046212All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3805Open in IMG/M
3300034090|Ga0326723_0388108All Organisms → cellular organisms → Bacteria633Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog12.26%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland9.43%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland9.43%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.55%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds5.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.72%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil3.77%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.83%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.83%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.89%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.89%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.89%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.89%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.89%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.89%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.89%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.89%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.89%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.89%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.94%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.94%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.94%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.94%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.94%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.94%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.94%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.94%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.94%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009547Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40EnvironmentalOpen in IMG/M
3300009616Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100EnvironmentalOpen in IMG/M
3300009617Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100EnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009632Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40EnvironmentalOpen in IMG/M
3300009635Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300024295Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5EnvironmentalOpen in IMG/M
3300025442Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025711Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028268Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25.v5EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028572Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1EnvironmentalOpen in IMG/M
3300028574Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2EnvironmentalOpen in IMG/M
3300028788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2EnvironmentalOpen in IMG/M
3300028882Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3EnvironmentalOpen in IMG/M
3300029817Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25EnvironmentalOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300029913III_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029987I_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030003Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3EnvironmentalOpen in IMG/M
3300030020II_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030507Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2EnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031259Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3EnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031711Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaGHost-AssociatedOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12053J15887_1039354213300001661Forest SoilLMSDADVALAARLLPHHAHVKFRALGHALFIQQPEPVLRAVTNFMESL*
Ga0062384_10081685123300004082Bog Forest SoilLMSDADVALATRLLPHHAHVKFRDLGHALFIQQPEPVLRAVTNFLESL*
Ga0062387_10128024023300004091Bog Forest SoilLGGLMSDADVALATRLLPHHAHVKFRNLGHALFIQQPEPVLRAVTNFLESL*
Ga0062389_10045598923300004092Bog Forest SoilLQGTTELGGLMSDADVALAMRLLPYPAHVKFSNLGHALFIQQPETVLREVTKFLESMS*
Ga0063356_10246584313300004463Arabidopsis Thaliana RhizosphereLQASPSLGGMMSDNDVQRACALLAHPVRVRFPTLGHALFIQNPEPILRSVTNFLESLEP*
Ga0068869_10055407513300005334Miscanthus RhizosphereLLQASPSLGGMMTDHDVNRACTLLARPVRVKFPTLGHALFIQNPEPVLRAVTNFLESLDV
Ga0066686_1060787813300005446SoilTLLLQGSRDLGGLMSDADVALATRLLPHHTHVKFRTLGHALFIQQPEPVLRAVTNFLESLSD*
Ga0070699_10160431813300005518Corn, Switchgrass And Miscanthus RhizosphereLQASGDLGGLMSDADVALATRLLPHHTHVKFHTLGHALFIQQPEPVLRAVTNFLESLSE*
Ga0070730_1085386723300005537Surface SoilPELGGLMSDADVALATRLLPHHAHVKFRNLGHALFIQQPEPVLRAVTNFLESL*
Ga0070761_1040803333300005591SoilLQGSPELGGLMSDADVTLAKRLLPHHTHVKFRNLGHALFIQQPEPVLRAVTNFLESL*
Ga0075029_10070153513300006052WatershedsLPHHTHVKFRNLGHALFIQQPDPVLRAVTNFLESLG*
Ga0075015_10004513313300006102WatershedsNRELGGLMTDADVALATRLLLHHTHVYLRSLGHALFIQQPEPVLRAVTNFLESL*
Ga0075014_10020104913300006174WatershedsDVALATRLLPHHTHVKFRNLGHALFIQQPEPVLRAVTNFLESL*
Ga0075014_10084680023300006174WatershedsLMTDADVALAKRILPHHTHVYLRSLGHALFIQQPEPVLRAVTNFLESL*
Ga0068871_10021668533300006358Miscanthus RhizosphereRPVRVKFPTLGHALFIQNPEPVLRAVTNFLESLDV*
Ga0075521_1007358113300006642Arctic Peat SoilPHHAHVRFRNLGHALFIQQPEPVLRAVTNFLESL*
Ga0099830_1166523623300009088Vadose Zone SoilALATSVLPHHTHVKFRNLGHALFIQQPEPVLRAVTNFLESLG*
Ga0111538_1246471123300009156Populus RhizosphereSLGGMMSDNDVQRACALLAHPVRVRFPTLGHALFIQNPEPILRSVTNFLESLEP*
Ga0116136_108244113300009547PeatlandGTPELGGLMSDADVALATRLLPHHAHVKFRNLGHALFIQQPEPVLRAVTNFLESL*
Ga0116111_106618833300009616PeatlandDVALATRLLPHHAHVKFRNLGHALFIQQPEPVLRAVTNFLESL*
Ga0116123_107348523300009617PeatlandRELGGLMSDADVALATRLLPHHTHVKFRNLGHALFIQQPEPVLRAVTNFLESL*
Ga0116133_112232223300009623PeatlandQGAPELGGLMSDADVALATRLLPHHAHVKFQNLGHALFIQQPEPVLRAVTNFLESLG*
Ga0116102_115084413300009632PeatlandRLLPHHTHVKFRNLGHALFIQQPEPVLRAVTNFLESL*
Ga0116117_101341213300009635PeatlandLMSDADVAMATRLLAHHTHVRFRNLGHALFIQQPEPVLRAVTNFLESL*
Ga0116110_113040723300009643PeatlandGLMSDADVALATRLLPHHTHVKFRNLGHALFIQQPEPVLRAVTNFLESL*
Ga0116121_112637123300009644PeatlandELGGLMSDADVALATRLLPHHAHVKFQNLGHALFIQQPEPVLRAVTNFLESLG*
Ga0126374_1159346923300009792Tropical Forest SoilMGGMMSDADVTLAEKMLPHHTHVYLRTVGHALFLQQPEPVLRAVTNFLEAL*
Ga0134088_1067908213300010304Grasslands SoilRDLGGLMSDADVALATRLLPHHTHVKFRTLGHALFIQQPEPVLRAVTNFLESLSE*
Ga0074044_1087148133300010343Bog Forest SoilPHHAHVKFRNLGHALFIQQPEPVLRAVTNFLESL*
Ga0136449_10406871123300010379Peatlands SoilLPHHTHVKFRNLGHALFIQQPEPVLRAVTNFLESL*
Ga0150983_1060319913300011120Forest SoilLMSDADVTLAKRLLPHHTHVKFRNLGHALFIQQPEPVLRAVTNFLESL*
Ga0137391_1075421113300011270Vadose Zone SoilLLLQGSQELGGLMSDADVALATRVLPHHTHVKFRNLGHALFIQQPEPVLRAVTNFLESL*
Ga0137378_1125396913300012210Vadose Zone SoilNAVHVRFPTLGHALYIQQPEPVLREVTGFLEKLRIID*
Ga0137372_1057357413300012350Vadose Zone SoilADVALATRLLPHHTHVRFRNIGHALFIQQPEPVLRAVTNFMEALI*
Ga0137390_1043916033300012363Vadose Zone SoilLGPRVLAIHAIRLSDADIALATRVLPHHTHVKFRNLGHALFIQQPEPVLRAVTNFLESL*
Ga0137397_1061492713300012685Vadose Zone SoilTRLLPHHTHVKFRALGHALFIQQPEPVLRAVTNFLESLSE*
Ga0137394_1024739923300012922Vadose Zone SoilMSDADVALAARLLPHHAHVKFRALGHALFIQQPEPVLRAITNFLESL*
Ga0181530_1044503023300014159BogLMSDADVALATRLLPHHTHVKFRNLGHALFIQQPEPVLRAVTNFLESL*
Ga0182014_1005343313300014491BogQASQELGGLMSDADVALATRLLPHHTHVKFRNLGHALFIQQPEPVLRAVTNFLESL*
Ga0182016_1006458633300014493BogDGETVLRGIGCATLLLQGSPELGGLMSDADVALATKLLPHHAHVKFRNLGHALFIQQPEPVLRAVTNFLESL*
Ga0182019_1047629923300014498FenASPELGGLMSDADVALATRLLPHHAHVRFRNLGHALFIQQPEPVLRAVTNFLESL*
Ga0182024_1259742113300014501PermafrostTLLLQGTPELGGLMSDADVALATRLLPHHTHVKFRNLGHALFIQQPEPVLRAVTNFLESL
Ga0181536_1024993413300014638BogTRLLPHHAHVKFRNLGHALFIQQPEPVLRAVTNFLESLG*
Ga0137411_101583423300015052Vadose Zone SoilLRGIKCSTLLLQASRELGGLMSDADVALATRLLPHHTHVKFRALGHALFIQQPEPVLRAVTNFLESLSE*
Ga0182035_1156312223300016341SoilALLGITCPTLLLQANREVGGLMHDADVALAEKILPHHTHVYFRSVGHALFIQQPEPVLRAITNFLESL
Ga0187818_1033964323300017823Freshwater SedimentDVALATRMLPHHTHVKFRNLGHALFIQQPEPVLRVVTNFLEAL
Ga0187856_101608543300017925PeatlandLLPHHTHVKFRNLGHALFIQQPEPVLRAATNFLESL
Ga0187856_116857513300017925PeatlandGTPELGGLMSDADVALATRLLPHHAHVKFRNLGHALFIQQPEPVLRAVTNFLESL
Ga0187891_104915613300017996PeatlandQELGGLMSDADVALATRLLPHHTHVKFRNLGHALFIQQPEPVLRAVTNFLESL
Ga0187810_1002356533300018012Freshwater SedimentILPHHTHVHFRSLGHALFIQQPEPVLRAVTNFLESLG
Ga0187880_127113823300018016PeatlandRLLPHHTHVKFRNLGHALFIQQPEPVLRAVTNFLEAL
Ga0187885_1006844333300018025PeatlandMSDADVALATRLLPHHAHVKFRNLGHALFIQQPEPVLRAVTNFLESL
Ga0187885_1024235113300018025PeatlandLGGLMSDADVALATRLLPHHAHVKFRNLGHALFIQQPEPVLRAVTNFLESL
Ga0187857_1013199613300018026PeatlandELGGLMSDADVTLATRLLTHHAHVKFRNLGHALFIQQPEPVLRAVTNFLESL
Ga0187890_1021916823300018044PeatlandLAHHTHVRMRNLGHALFIQQPEPVLRAVTNFLESL
Ga0187851_1045498423300018046PeatlandVAEQRLRHHAHVKFRDLGHALFIQQPEPVLRAVTNFLESL
Ga0187859_1069109813300018047PeatlandTLLLQASQELGGLMSDADVALATRLLPHHAHVKFRNLGHALFIQQPEPVLRAVTNFLESL
Ga0193713_110288623300019882SoilLGGLMSDADVALATRLLPHHTHVKFRSLGHALFIQQPEPVLRAVTNFLESL
Ga0210392_1115557213300021475SoilTLLLQGAHELGGLMSEADVALATRLLPHHTHVKFRNLGHALFIQQPEPVLRAVMNFLEAL
Ga0210398_1045077213300021477SoilDADVTLAKRLLPHHTHVKFRNLGHALFIQQPEPVLRAVTNFLESL
Ga0224556_112570013300024295SoilDIALATRLLPHHAHVKFHNLGHALFIQQPEPVLRAVTNFLESL
Ga0208034_100972843300025442PeatlandQGTPELGGLMSDADVALATRLLPHHAHVKFRNLGHALFIQQPEPVLRAVTNFLESL
Ga0208034_109746223300025442PeatlandGGLMSDADVALATRLLPHHTHVKFRNLGHALFIQQPEPVLRAATNFLESL
Ga0207696_112646113300025711Switchgrass RhizosphereALLLQASPSLGGMMSDNDVQRACALLAHPVRVRFPTLGHALFIQNPEPILRSVTNFLESLEP
Ga0207646_1020152733300025922Corn, Switchgrass And Miscanthus RhizosphereELGGLMSDADVALATRLLTHHTHVKFRNLGHALFIQQPEPVLRAVTNFLESL
Ga0209772_1011781113300027768Bog Forest SoilQATPELGGLMSDADVALAASTLLHHAHVKFRNLGHALFIQQPDPVLRAVTNFLESL
Ga0209517_1006900613300027854Peatlands SoilDVALATRLLPHHAHVKFRNLGHALFIQQPEPVLRAVTNFLESL
Ga0209166_1057799423300027857Surface SoilPELGGLMSDADVALATRLLPHHAHVKFRNLGHALFIQQPEPVLRAVTNFLESL
Ga0209067_1031863633300027898WatershedsVALATRLLPHHTHVKFRNLGHALFIQQPEPVLRAVTNFLESLG
Ga0209067_1076406623300027898WatershedsLLLQASRELGGLMSDADVALATRLLPHHTHVKFRNLGHALFIQQPEPVLRAVTNFLESL
Ga0209415_1065853913300027905Peatlands SoilADVALATRLLPHHTHVRFRNLGHALFIQQPEPVLRAVTNFLESL
Ga0255348_105280313300028268SoilLTHHAHVKFRNLGHALFIQQPEPVLRAVTNFLESL
Ga0268266_1037163133300028379Switchgrass RhizospherePALLLQASPSLGGMMTDHDVNRACTLLARPVRVKFPTLGHALFIQNPEPVLRAVTNFLESLDV
Ga0302152_1017086313300028572BogLQGSPELGGLMSDADVAIASRLLPHHAHVKFRGLGHALFIQQPEPVLRAVTNFLESL
Ga0302153_1006503723300028574BogLMSDADVAIASRLLPHHAHVKFRGLGHALFIQQPEPVLRAVTNFLESL
Ga0302189_1016926513300028788BogVALATRLLPHHAHVKFRNLGHALFIQQPEPVLRAVTNFLESL
Ga0302154_1026546413300028882BogSDADVAIASRLLPHHAHVKFRGLGHALFIQQPEPVLRAVTNFLESL
Ga0247275_104062223300029817SoilLLPHHTHVKFRNLGHALFIQQPEPVLRAVTNFLESL
Ga0311329_1040821433300029907BogVLRGIGCATLLLQGSPELGGLMSDADVALATRLLPHHAHVKFRNLGHALFIQQPEPVLRAVTNFLESL
Ga0311362_1032714113300029913BogDGSSLEGWDGETVLRGIGCATLLLQGSPELGGLMSDADVALATRLLPHHAHVKFRNLGHALFIQQPEPVLRAVTNFLESL
Ga0311334_1099580123300029987FenPTLLLQANRELGGLMSDADVALATRILPHHAHVQLRTLGHALFIQQPEPVLRAVTNFLES
Ga0302172_1030215713300030003FenNRELGGLMSDADVALATRILPHHAHVQLRTLGHALFIQQPEPVLRAVTNFLESL
Ga0311344_1012361613300030020BogMSDADVAIASRLLPHHAHVKFRGLGHALFIQQPEPVLRAVTNFLESL
Ga0302192_1037066123300030507BogATLLLQGSPELGGLMSDADVALATRLLPHHAHVKFRNLGHALFIQQPEPVLRAVTNFLES
Ga0311345_1106431913300030688BogADVALATRLLPHHAHVKFRNLGHALFIQQPEPVLRAVTNFLESL
Ga0170823_1555467933300031128Forest SoilLGGLMSDADVALAARLLPHHAHVKFRNLGHALFIQQPEPVLRAVTNFLESL
Ga0170823_1654622433300031128Forest SoilLKLLAHPVHVSFPTLGHALYMQQPEPVLRALNNFLESL
Ga0302324_10191088523300031236PalsaSDADVALATRLLPHHAHVKFRDLGHALFIQHPEPVLRAVTNFLESL
Ga0302187_1038992113300031259BogDGETVLRGIGCATLLLQGSPELGGLMSDADVALATRLLPHHAHVKFRNLGHALFIQQPEPVLRAVTNFLESL
Ga0302320_1082222133300031524BogLQGSPELGGLMSDADVALATKLLPHHAHVKFRNLGHALFIQQPEPVLRAVTNFLESL
Ga0318538_1061822223300031546SoilTLLLQASPQFGALMSDEDVALALRLLKHPVHVRFDNLGHGLYMQQPEPVLRAITNFLDSLEE
Ga0310686_10948436113300031708SoilTLLLQASQELGGLMSDADVALATRLLPHHAHVKFRDLGHALFIQHPEPVLRAVTNFLESL
Ga0265314_1030323823300031711RhizosphereDVALAKRLLPHHTHVKLRNLGHALFIQQPEPVLRAVTNFLESL
Ga0307469_1165909113300031720Hardwood Forest SoilLLQGSPELGGLMSDADVALATRLLPHHAHVKFRNLGHALFIQQPEPVLRVVTNFLESL
Ga0307469_1223608713300031720Hardwood Forest SoilHHTHVKFRTLGHALFIQQPEPVLRAVTNFLESLSE
Ga0318521_1058053013300031770SoilLQASPQFGALMSDEDVALALRLLKHPVHVRFDNLGHGLYMQQPEPVLRAITNFLDSLEE
Ga0302319_1007576263300031788BogLLQGSPELGGLMSDADVALATRLLPHHAHVKFRNLGHALFIQQPEPVLRAVTNFLESL
Ga0302319_1145088913300031788BogVLRGIGCATLLLQGSPELGGLMSDADVALATKLLPHHAHVKFRNLGHALFIQQPEPVLRAVTNFLESL
Ga0306921_1271380213300031912SoilITCPTLLLQANREVGGLMHDADVALAEKILPHHTHVYFRSVGHALFIQQPEPVLRAITNFLESL
Ga0306922_1005999213300032001SoilMSDEDVALALRLLKHPVHVRFDNLGHGLYMQQPEPVLRAITNFLDSLEE
Ga0310911_1023020113300032035SoilSDEDVALALRLLKHPVHVRFDNLGHGLYMQQPEPVLRAITNFLDSLEE
Ga0307471_10007570913300032180Hardwood Forest SoilVALATRLLPHHTHVKVRTLGHALFIQQPEPVLRAVTNFLESLSD
Ga0335080_1033083923300032828SoilMNDDDVALAARLLLHHVHVKFRTLGHALFIQQPEPVLRAVTNFLESL
Ga0335077_1119555723300033158SoilTSLLAHHTHVRFRSLGHALFIQQPDPVLRAVTNFLESL
Ga0326726_1004621213300033433Peat SoilGCCLGERILPHHTHVYLRSLGHALFMQQPEPVLPAVTNFLESL
Ga0326723_0388108_430_6033300034090Peat SoilLQASRELGGLMSDADVALATRLLPHHTHVRFRTLGHALFIQQPEPVLRAVTNFLESL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.