NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F094224

Metagenome / Metatranscriptome Family F094224

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F094224
Family Type Metagenome / Metatranscriptome
Number of Sequences 106
Average Sequence Length 41 residues
Representative Sequence LHGKLGFFFAGNDYFLRMYFPDENDTAEYCSEKSFQHDAA
Number of Associated Samples 92
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 48.11 %
% of genes near scaffold ends (potentially truncated) 43.40 %
% of genes from short scaffolds (< 2000 bps) 82.08 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.26

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(23.585 % of family members)
Environment Ontology (ENVO) Unclassified
(28.302 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.057 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 26.47%    β-sheet: 0.00%    Coil/Unstructured: 73.53%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.26
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF00709Adenylsucc_synt 23.58
PF02673BacA 22.64
PF01255Prenyltransf 2.83
PF00543P-II 1.89
PF08242Methyltransf_12 0.94
PF13476AAA_23 0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG0104Adenylosuccinate synthaseNucleotide transport and metabolism [F] 23.58
COG1968Undecaprenyl pyrophosphate phosphataseLipid transport and metabolism [I] 22.64
COG0020Undecaprenyl pyrophosphate synthaseLipid transport and metabolism [I] 2.83
COG0347Nitrogen regulatory protein PIISignal transduction mechanisms [T] 1.89

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090014|GPIPI_16696212All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus2829Open in IMG/M
2124908044|A5_c1_ConsensusfromContig9680All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium688Open in IMG/M
2162886007|SwRhRL2b_contig_749799All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium933Open in IMG/M
2199352025|deepsgr__Contig_174648All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300000890|JGI11643J12802_11829134All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1575Open in IMG/M
3300002899|JGIcombinedJ43975_10007171All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1809Open in IMG/M
3300005289|Ga0065704_10008910All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus3798Open in IMG/M
3300005332|Ga0066388_105984150All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300005457|Ga0070662_100416585All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1111Open in IMG/M
3300005540|Ga0066697_10189487All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1222Open in IMG/M
3300005563|Ga0068855_102525414All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300005566|Ga0066693_10007328All Organisms → cellular organisms → Bacteria2978Open in IMG/M
3300005574|Ga0066694_10159635All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1070Open in IMG/M
3300005764|Ga0066903_100031653All Organisms → cellular organisms → Bacteria6001Open in IMG/M
3300005764|Ga0066903_100126801All Organisms → cellular organisms → Bacteria3572Open in IMG/M
3300005764|Ga0066903_100691396All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1795Open in IMG/M
3300006175|Ga0070712_100020498All Organisms → cellular organisms → Bacteria4326Open in IMG/M
3300007076|Ga0075435_100820403All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium810Open in IMG/M
3300009094|Ga0111539_10528580All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1374Open in IMG/M
3300009094|Ga0111539_11714925All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium728Open in IMG/M
3300009094|Ga0111539_12686891All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300009162|Ga0075423_11267765All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300009174|Ga0105241_10262618All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1468Open in IMG/M
3300009176|Ga0105242_12677921All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300009792|Ga0126374_11220505All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300010048|Ga0126373_10472316All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1292Open in IMG/M
3300010154|Ga0127503_11079255All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium872Open in IMG/M
3300010325|Ga0134064_10097867All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia962Open in IMG/M
3300010326|Ga0134065_10023505All Organisms → cellular organisms → Bacteria1755Open in IMG/M
3300010337|Ga0134062_10048820All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1718Open in IMG/M
3300010360|Ga0126372_10309760All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1393Open in IMG/M
3300010361|Ga0126378_12176720All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300010362|Ga0126377_10021827All Organisms → cellular organisms → Bacteria5284Open in IMG/M
3300010371|Ga0134125_10902777All Organisms → cellular organisms → Bacteria970Open in IMG/M
3300010396|Ga0134126_10828687All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1044Open in IMG/M
3300010397|Ga0134124_10674918All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1020Open in IMG/M
3300012200|Ga0137382_10167970All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter1495Open in IMG/M
3300012204|Ga0137374_10010077All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus11135Open in IMG/M
3300012350|Ga0137372_10386120All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1064Open in IMG/M
3300012355|Ga0137369_10019789All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus6380Open in IMG/M
3300012469|Ga0150984_123494606All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium640Open in IMG/M
3300012885|Ga0157287_1032374All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter748Open in IMG/M
3300012896|Ga0157303_10220772All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300012901|Ga0157288_10196207All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300012903|Ga0157289_10186514All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300012905|Ga0157296_10097759All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium796Open in IMG/M
3300012908|Ga0157286_10045333All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter1103Open in IMG/M
3300012908|Ga0157286_10103548All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium840Open in IMG/M
3300012911|Ga0157301_10289900All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300012915|Ga0157302_10041811All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter1260Open in IMG/M
3300012916|Ga0157310_10011847All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus2122Open in IMG/M
3300012917|Ga0137395_10268713All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1202Open in IMG/M
3300012918|Ga0137396_10100462All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus2064Open in IMG/M
3300012924|Ga0137413_10715341All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium761Open in IMG/M
3300012927|Ga0137416_10603891All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter956Open in IMG/M
3300012930|Ga0137407_10756324All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium917Open in IMG/M
3300012955|Ga0164298_10052341All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1968Open in IMG/M
3300012957|Ga0164303_10787166All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium652Open in IMG/M
3300012984|Ga0164309_10124040All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1675Open in IMG/M
3300012984|Ga0164309_11462625All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300012988|Ga0164306_10723323All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus793Open in IMG/M
3300012988|Ga0164306_11969038All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium508Open in IMG/M
3300012989|Ga0164305_10747903All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus805Open in IMG/M
3300014166|Ga0134079_10042342All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1573Open in IMG/M
3300014325|Ga0163163_10691803All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1083Open in IMG/M
3300014745|Ga0157377_10807903All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus692Open in IMG/M
3300014969|Ga0157376_10403541All Organisms → cellular organisms → Bacteria1322Open in IMG/M
3300015200|Ga0173480_10623462All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium665Open in IMG/M
3300015201|Ga0173478_10261506All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus763Open in IMG/M
3300015241|Ga0137418_10632990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi834Open in IMG/M
3300015359|Ga0134085_10127008All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1072Open in IMG/M
3300015372|Ga0132256_100457124All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1384Open in IMG/M
3300015372|Ga0132256_100702635All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1127Open in IMG/M
3300015372|Ga0132256_100889825All Organisms → cellular organisms → Bacteria1006Open in IMG/M
3300015373|Ga0132257_100908324All Organisms → cellular organisms → Bacteria1104Open in IMG/M
3300015373|Ga0132257_100950316All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1079Open in IMG/M
3300015374|Ga0132255_100127724All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus3508Open in IMG/M
3300015374|Ga0132255_101065832All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1214Open in IMG/M
3300015374|Ga0132255_102977996All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia723Open in IMG/M
3300015374|Ga0132255_104245717All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300016294|Ga0182041_11179576All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium698Open in IMG/M
3300016341|Ga0182035_10349928All Organisms → cellular organisms → Bacteria1228Open in IMG/M
3300018052|Ga0184638_1095503All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1091Open in IMG/M
3300018482|Ga0066669_10069105All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus2326Open in IMG/M
3300019996|Ga0193693_1006635All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus2477Open in IMG/M
3300020018|Ga0193721_1005445All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus3319Open in IMG/M
3300020021|Ga0193726_1298979All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium625Open in IMG/M
3300021168|Ga0210406_11021726All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300021411|Ga0193709_1072235All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium777Open in IMG/M
3300023058|Ga0193714_1000977All Organisms → cellular organisms → Bacteria4755Open in IMG/M
3300025915|Ga0207693_10249688All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1392Open in IMG/M
3300025917|Ga0207660_10779014All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300025930|Ga0207701_10368153All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1241Open in IMG/M
3300025932|Ga0207690_10863509All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300025933|Ga0207706_10130048All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2214Open in IMG/M
3300025934|Ga0207686_10353998All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1106Open in IMG/M
3300025934|Ga0207686_11025340All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300025936|Ga0207670_10091938All Organisms → cellular organisms → Bacteria2147Open in IMG/M
3300026075|Ga0207708_10878582All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300026316|Ga0209155_1003080All Organisms → cellular organisms → Bacteria7597Open in IMG/M
3300028379|Ga0268266_10238329All Organisms → cellular organisms → Bacteria1678Open in IMG/M
3300028876|Ga0307286_10401937All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium514Open in IMG/M
3300031231|Ga0170824_111844941All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300031720|Ga0307469_10588016All Organisms → cellular organisms → Bacteria993Open in IMG/M
3300031910|Ga0306923_10283033All Organisms → cellular organisms → Bacteria1896Open in IMG/M
3300031944|Ga0310884_10104234All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1395Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil23.58%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.43%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere5.66%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.72%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.72%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.72%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.77%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.83%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.83%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere2.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere1.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.89%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.94%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.94%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.94%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.94%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.94%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.94%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.94%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.94%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
2124908044Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5EnvironmentalOpen in IMG/M
2162886007Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300002899Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607)EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012885Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1EnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019996Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021411Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2EnvironmentalOpen in IMG/M
3300023058Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPIPI_037944402088090014SoilMLRGLLGRFRLFFPGYDYFLRMYFPDENDAAEYRREKSFQHDAA
A5_c1_012112002124908044SoilLRGKLGFFFAGNDHFLRMYFPDENDAADYYPEKSFQHDAA
SwRhRL2b_0423.000003502162886007Switchgrass RhizosphereLCGKLGFFFAGNDHFLRVYFPDENDAAEDCPEKSFQHDAA
deepsgr_029565402199352025SoilSKLFRRLRCSRGKLGXXXAGDDYFLRMYFPDENDTAEYYPEKSFQHDAA
JGI11643J12802_1182913453300000890SoilLRGKLGFFFSGNDYFLRMYFPDENDTAEYCPEKSFQHDAA*
JGIcombinedJ43975_1000717123300002899SoilLLGKLGFFFAGNDYFLRMYFPDENDIAEYCQQESFQHDAA*
Ga0065704_1000891053300005289Switchgrass RhizosphereLCGKLGFFFAGNDHFLRVYFPDENDAAEDCPEKSFQHDAA*
Ga0066388_10598415023300005332Tropical Forest SoilLLGRLRFLFSGNDYFLRVYLPDENDTAKCDPKKSFQYDAD*
Ga0070662_10041658533300005457Corn RhizosphereLLGKLGFFFARNDYFLRMYFPDENDTAEYYPGKSLQHDAA*
Ga0066697_1018948723300005540SoilMLRSLLGRFHLLFTGNDYFLRMYFPDQNDTADNCPEKSFQHDAA*
Ga0068855_10252541423300005563Corn RhizosphereFFFAGNDYFLRMYFPNENDVAEQYQEKSFQYDSA*
Ga0066693_1000732843300005566SoilMLRCLRGKIGFFFAGNDYFLRMYFPDENDAAEYCQEKSIQHHAT*
Ga0066694_1015963533300005574SoilMLRSLLGRFHLLFTGNDYFLRMYFPDQNDTADNCQEKSFQHDAA*
Ga0066903_10003165353300005764Tropical Forest SoilMLRGLRGRFRFLFAGNDYFLRMYFPGEDDAAEYCPKKPLQHNAV*
Ga0066903_10012680143300005764Tropical Forest SoilMLGFFFAGNDDFLRIYLPDQNDAAEYREQTSFQHNAA*
Ga0066903_10069139623300005764Tropical Forest SoilLRGNLGFFFAGNDYFLRMYFPNENDAAEQYQEKSFQHDSA*
Ga0070712_10002049823300006175Corn, Switchgrass And Miscanthus RhizosphereLRGKLGFFFAANDHFLRMYFPDENDADYYPEKSFQHDAA*
Ga0075435_10082040313300007076Populus RhizosphereLRGNLGFSFAGNDYFLRMYFPNENDAAEQYQEKSFQHDSA*
Ga0111539_1052858013300009094Populus RhizosphereLFRRLRRLRENLGFFFAGNDYFLRMYFPNQNDAAEQYQEKSFQHDSA*
Ga0111539_1171492513300009094Populus RhizosphereLRGNLGFFFASNDYFLRMYFPNENDVAEQYQEKSF
Ga0111539_1268689123300009094Populus RhizosphereRGTFGFFLAGHDDFLRMYFRDENDTKKYYWEKSFQHDTA*
Ga0075423_1126776533300009162Populus RhizosphereLRRKRGLFFPGNDYFLRMYFPNENDAAEYRGEKSFQHDAA*
Ga0105241_1026261823300009174Corn RhizosphereMLGFLFARNDYFLRMNLSDENDAAEHRGEKSFQHNAA*
Ga0105242_1267792113300009176Miscanthus RhizosphereLGFFFAGNDHFLRMHFPDENDAAEYCPKKSFQHHAA*
Ga0126374_1122050523300009792Tropical Forest SoilSELFSRLRCLLGKLPFFFSCNDYFLRVYLPDENDTAKYCPKKSFQHDAA*
Ga0126373_1047231633300010048Tropical Forest SoilMLRFLFAGNDDFLRIYLPDQNEAAEYRGQISFQHNAA*
Ga0127503_1107925523300010154SoilLRGKLGFFFAGNDHFLRMHFPDENDAAEYCPKKSFQHDAA*
Ga0134064_1009786713300010325Grasslands SoilMLRCLRGKIGFFFAGNDYFLRMYFPDENDAAEYCQEKS
Ga0134065_1002350543300010326Grasslands SoilGKIGFFFAGNDYFLRMYFPDENDAAEYCQEKSIQHHAT*
Ga0134062_1004882033300010337Grasslands SoilMLRSLLGRFHLLFTGNDYFLRMYFPDQNDTADNCQEKSF
Ga0126372_1030976023300010360Tropical Forest SoilLRGNLGFFFAGNDYFLRMYFPNENDAAEQYQEKSFQHDPA*
Ga0126378_1217672013300010361Tropical Forest SoilRRRFCRMLGFFFVGNDDFLRIYLPDENDAAEYRGQTSFQHNAA*
Ga0126377_1002182773300010362Tropical Forest SoilLLGKLGFFFAGNDYFLRMYFPNENDNAKYWRKQSFQHDAA*
Ga0134125_1090277733300010371Terrestrial SoilRCLRGKLGFFFAANDHFLRMYFPDENDADYYPEKSFQHDAA*
Ga0134126_1082868713300010396Terrestrial SoilLLGKLGFFFARNDYFLRMYFPDENDTADYCPEKSLQHDAA*
Ga0134124_1067491823300010397Terrestrial SoilLRRTLGFLFARNDYFLRMNFSDENDAAEHRGEKSFQHNAA*
Ga0137382_1016797023300012200Vadose Zone SoilMLRCLRGKIGFFFAGNDYFLRMYFPDENDAAEYCQEKPFQHHAA*
Ga0137374_10010077133300012204Vadose Zone SoilLRGKVGFFLAGNDYFLCMYFPDENGAAEYCPEKSFQHDAA*
Ga0137372_1038612023300012350Vadose Zone SoilVKLGFFFAGHDYFLRTYFPDENDAAKYCPEKSFQHDAA*
Ga0137369_1001978973300012355Vadose Zone SoilLRGKVGFFLAGNDYFLCMYFPDENSAAEYCPEKSFQHDAA*
Ga0150984_12349460623300012469Avena Fatua RhizosphereMPAKLGFFLARNDDFLRMYFPDENETEEYCRKKSFQHDAA*
Ga0157287_103237433300012885SoilVRGTLGFFLAGNDYFLRMYFPDENDTEKYYGEKSFQHDTA*
Ga0157303_1022077213300012896SoilRRLRRLRGNLGFSFAGNDYFLRMYFPNQNDAAEQYQEKSFQHYSA*
Ga0157288_1019620723300012901SoilGKLGFFFSDNDYFLRMHFTDENDTAEYCPEKSFQHDAA*
Ga0157289_1018651413300012903SoilRRLLCVPAKLGFFLAGNDDFLRMYFPDENDTEKYYGEKSFQHDTA*
Ga0157296_1009775913300012905SoilLRGKLGFFFSGNDYFLRMYFTDENDTAEYCPEKSFQHDAA*
Ga0157286_1004533333300012908SoilFRRPRCLHGNLGFFFAGNDYFLPMYFPNENDAAEQYQEKSFQHDSA*
Ga0157286_1010354813300012908SoilLRGKLGFFFSGNDYFLRMYFPDENDAAEYCQEKSFQHHAA*
Ga0157301_1028990023300012911SoilGFGRKLFRRVRCVRGKLGFFLARNDDFLRMYFPDENDTEEYYGEKSFQHDTA*
Ga0157302_1004181133300012915SoilMPAKLGFFLAGNDDFLRMYFPDENDTEEYYGEKSFQHDTA*
Ga0157310_1001184723300012916SoilVRGKFGFFLARNDDFLRMYFPAENDTEEYYGEKSFQHDTA*
Ga0137395_1026871323300012917Vadose Zone SoilLCGKLGFFLASNDHFLRMYFTDENDAAKHCPEKSFQHDAA*
Ga0137396_1010046253300012918Vadose Zone SoilHGKLGFFFAGNDYFLRTYFPDENDTAEYHPEKSFQHDAA*
Ga0137413_1071534123300012924Vadose Zone SoilLRGNLGFFFAGNDHFLRMHFPDENDAAEYCPKKSFQHHAA*
Ga0137416_1060389113300012927Vadose Zone SoilRLRCLRGNLGFFFAGNDHFLRMHFPDENDTAEYHPEKSFQHDAA*
Ga0137407_1075632413300012930Vadose Zone SoilMLRSLLGSFRLLFARYDHFLRVYFSDENDAAEYCTEKSFQHDAA*
Ga0164298_1005234123300012955SoilLHGKLGFFFAGNDYFLRMYFPDENDTAEYCSEKSFQHDAA*
Ga0164303_1078716613300012957SoilLRGNLEFFFAGNDYFLRMYFPNQNDAAEQYQEKSFQHDSA*
Ga0164309_1012404023300012984SoilLDGKLGFFFAGNDYFLRMYFPDENDTAEYCSEKSFQHDAA*
Ga0164309_1146262513300012984SoilGKVGFFFAGNDYFLRMYFPDENDSAECYPEKSFQHDTT*
Ga0164306_1072332333300012988SoilFGSRLFRILRCLRGRFRFFFAGNDYFLRMYFPDENNTAEYCSEKSFQHDPA*
Ga0164306_1196903813300012988SoilLDGKLGFFFAGNDYFLRMYFPDENDTAEYCSEKSFQH
Ga0164305_1074790333300012989SoilRGNLEFFFAGNDYFLRMYFPNQNDAAEQYQEKSFQHDSA*
Ga0134079_1004234233300014166Grasslands SoilFFFAGNDYFLRMYFPDENDAAKYCPEKSFQHDAA*
Ga0163163_1069180313300014325Switchgrass RhizosphereRRLRRLLGKLGVFFARNDYFLRMYFPDENDTADYCPEKSLQHDAA*
Ga0157377_1080790333300014745Miscanthus RhizosphereVPAKLGFFLAGNDDFLRMYFPDENDTEKYYGEKSFQHDTA*
Ga0157376_1040354133300014969Miscanthus RhizosphereLRRTLGFLFARNDYFLRMNFPDENDAAEHRGEKSFQHNAA*
Ga0173480_1062346213300015200SoilMPAKLGFFLAGNDDFLRMYFPDENDTEKYYGEKSFQHDTA*
Ga0173478_1026150633300015201SoilGKFGFFFARNDDFLRMYFPAENDTEEYYGEKSFQHDTA*
Ga0137418_1063299023300015241Vadose Zone SoilLHGKLGFFFAGNDYFLRTYFPDENDTAEYHPEKSFQHDTA*
Ga0134085_1012700823300015359Grasslands SoilMLRCLRGKIGFFFAGNDYFLRMYFPDENDAAEYCQEKSFQHHAA*
Ga0132256_10045712433300015372Arabidopsis RhizosphereRWCCRFGSKLFRRLRCVRGKFRFFFAGNDYFLRMYFPDENDTAEYCSAKSFQHDPA*
Ga0132256_10070263523300015372Arabidopsis RhizosphereLRGNLGFFFAGNDYFLRMYFPNENDVAEQYQEKSFQYDSA*
Ga0132256_10088982513300015372Arabidopsis RhizosphereLRGNLEFFFAGNDYFLRKYFPDQNGAAEQYQEKSFQYDSA*
Ga0132257_10090832433300015373Arabidopsis RhizosphereVRGKLGFFLARNDDFLRMYFPDENDTEEYYGEKSFQHDTA*
Ga0132257_10095031623300015373Arabidopsis RhizosphereLRENLGFFFAGNDYFLRMYFPNQNDAAEQYQEKSFQHDSA*
Ga0132255_10012772423300015374Arabidopsis RhizosphereLRGNLGFFFAGNDYFLRMYFPDQNGAAEQYQEKSFQHDSA*
Ga0132255_10106583223300015374Arabidopsis RhizosphereLHGNLGFFFASNDYFLRMYFPNENDVAEQYQEKSFQHDSA
Ga0132255_10297799623300015374Arabidopsis RhizosphereVKLGFFLAGNDYFLRMHFSDENDAAECCPEKSFQHDAA*
Ga0132255_10424571713300015374Arabidopsis RhizosphereKLFSRLRCLRGKLGFFFAGNDYFLRMYFPDENDAAEYCPEKSFQHNAA*
Ga0182041_1117957613300016294SoilLRGNLGFFFASNDYVLRMYVPNENDAAEQYQGKSF
Ga0182035_1034992823300016341SoilVKLGFFFASNDYFLRMYFPDQNDYADYCPEKSFQHDAA
Ga0184638_109550313300018052Groundwater SedimentLGFFFASKDYFLRMYFPDENDAAEYCSEKSFQHDTA
Ga0066669_1006910533300018482Grasslands SoilMLRSLLGRFHLLFTGNDYFLRMYFPDQNDTADNCQEKSFQHDAA
Ga0193693_100663523300019996SoilLHAKLGFFFTGNDYFLRMHFPDENDTAEYCSEKSFQHDAA
Ga0193721_100544533300020018SoilLRGKLGFFFAGNDYFLRMYFPDENDSAEYDPEKSFQHDAA
Ga0193726_129897913300020021SoilLRGKLGFFFAGNDYFLRMCFPDENDAAEYYPEKSFQ
Ga0210406_1102172613300021168SoilGGLGFFFAGDDYFLRMYFPDENDTAEYCSEKSFQHDAA
Ga0193709_107223513300021411SoilLRGNLGFFFAGNDYFLRMYFPDENDTAEYYPEKSFQHD
Ga0193714_100097753300023058SoilLRRKLGFFFSGNDYFLRMYFPDENDSAEYDPEKSFQHDAA
Ga0207693_1024968823300025915Corn, Switchgrass And Miscanthus RhizosphereLRGKLGFFFAANDHFLRMYFPDENDADYYPEKSFQHDAA
Ga0207660_1077901433300025917Corn RhizosphereKVGFFFAGNDYFLRMYFPDENDSAEYYPEKSFQHDAAR
Ga0207701_1036815323300025930Corn, Switchgrass And Miscanthus RhizosphereLRRTLGFLFARNDYFLRMNFPDENDAAEHRGEKSFQHNAA
Ga0207690_1086350913300025932Corn RhizosphereLFRRLLCVRGTLGFFLAGNDDFLRMYFPDENDTEKYYGEKSFQHDTA
Ga0207706_1013004833300025933Corn RhizosphereVRGTFGFFLAGNDDFLRMYFPDENDTEKYYGEKSFQHDTA
Ga0207686_1035399823300025934Miscanthus RhizosphereMPAKLGFFLAGNDDFLRMYFPDENDTEKYYGEKSFQ
Ga0207686_1102534013300025934Miscanthus RhizosphereTFRFFFAGNDYFLRMYFPDENDTAEYCSEKSFQHDPA
Ga0207670_1009193823300025936Switchgrass RhizosphereVPAKLGFFLAGNDDFLRMYFPDENDTEKYYGEKSFQHDTA
Ga0207708_1087858223300026075Corn, Switchgrass And Miscanthus RhizosphereSRLRCLRGRLGFFFAGNDYFLRMYFPDENDTAEYCPGKSFQHDAGG
Ga0209155_100308053300026316SoilMLRCLRGKIGFFFAGNDYFLRMYFPDENDAAEYCQEKSIQHHAT
Ga0268266_1023832923300028379Switchgrass RhizosphereLRRTLGFLFARNDYFLRMNFSDENDAAEHRGEKSFQHNAA
Ga0307286_1040193713300028876SoilLLGKFGFFFAGNDYFLRMYFPDQNDTAEYYPGKSFQH
Ga0170824_11184494133300031231Forest SoilGFFFAGNDYFLRMYFPEENDTAEYYPEKSFQHDAA
Ga0307469_1058801613300031720Hardwood Forest SoilLRRSLGKLGFFFPGNDYFLRMYFSYENNTAEHCPTKSFQHDAA
Ga0306923_1028303333300031910SoilLRGNLGFFFASNDYFLRMYFPNENDVAEQYQEKSFQHDSA
Ga0310884_1010423423300031944SoilVRGKFRFFFAGNDYFLRMYFPDENDSAEYRSKKSFQHDAA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.