| Basic Information | |
|---|---|
| Family ID | F094209 |
| Family Type | Metagenome |
| Number of Sequences | 106 |
| Average Sequence Length | 52 residues |
| Representative Sequence | MTEPSPARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIVALCT |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 31.63 % |
| % of genes near scaffold ends (potentially truncated) | 40.57 % |
| % of genes from short scaffolds (< 2000 bps) | 74.53 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.075 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (13.207 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.302 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.566 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.95% β-sheet: 0.00% Coil/Unstructured: 48.05% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF13378 | MR_MLE_C | 41.51 |
| PF07690 | MFS_1 | 21.70 |
| PF00440 | TetR_N | 5.66 |
| PF02738 | MoCoBD_1 | 1.89 |
| PF08241 | Methyltransf_11 | 0.94 |
| PF02803 | Thiolase_C | 0.94 |
| PF04412 | AcnX | 0.94 |
| PF13531 | SBP_bac_11 | 0.94 |
| PF04392 | ABC_sub_bind | 0.94 |
| PF00857 | Isochorismatase | 0.94 |
| PF03707 | MHYT | 0.94 |
| PF00108 | Thiolase_N | 0.94 |
| PF00990 | GGDEF | 0.94 |
| PF00941 | FAD_binding_5 | 0.94 |
| PF00005 | ABC_tran | 0.94 |
| PF00528 | BPD_transp_1 | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 1.89 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.94 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.94 |
| COG1679 | Mevalonate 5-phosphate dehydratase subunit 1, aconitase superfamily (modified mevalonate pathway) | Lipid transport and metabolism [I] | 0.94 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.94 |
| COG3300 | MHYT domain, NO-binding membrane sensor | Signal transduction mechanisms [T] | 0.94 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.08 % |
| Unclassified | root | N/A | 17.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886013|SwBSRL2_contig_1772882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1132 | Open in IMG/M |
| 2199352025|deepsgr__Contig_1594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 16278 | Open in IMG/M |
| 2209111006|2214888020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 570 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1000661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5276 | Open in IMG/M |
| 3300000816|AF_2010_repII_A10DRAFT_1005927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1269 | Open in IMG/M |
| 3300004479|Ga0062595_100037783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2072 | Open in IMG/M |
| 3300004633|Ga0066395_10446462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 737 | Open in IMG/M |
| 3300004643|Ga0062591_101025494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 787 | Open in IMG/M |
| 3300005160|Ga0066820_1009240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 636 | Open in IMG/M |
| 3300005165|Ga0066869_10007602 | Not Available | 1405 | Open in IMG/M |
| 3300005277|Ga0065716_1011350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 629 | Open in IMG/M |
| 3300005332|Ga0066388_100065124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3905 | Open in IMG/M |
| 3300005332|Ga0066388_100073189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3747 | Open in IMG/M |
| 3300005332|Ga0066388_100276174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2323 | Open in IMG/M |
| 3300005332|Ga0066388_100695756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1624 | Open in IMG/M |
| 3300005332|Ga0066388_101632981 | Not Available | 1136 | Open in IMG/M |
| 3300005332|Ga0066388_102066642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1024 | Open in IMG/M |
| 3300005332|Ga0066388_102331256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 969 | Open in IMG/M |
| 3300005332|Ga0066388_105245772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 657 | Open in IMG/M |
| 3300005334|Ga0068869_100143718 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1845 | Open in IMG/M |
| 3300005354|Ga0070675_100831358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 845 | Open in IMG/M |
| 3300005435|Ga0070714_101770922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 603 | Open in IMG/M |
| 3300005436|Ga0070713_100003697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 10128 | Open in IMG/M |
| 3300005455|Ga0070663_100787549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 814 | Open in IMG/M |
| 3300005455|Ga0070663_101055657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 708 | Open in IMG/M |
| 3300005545|Ga0070695_101567190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 549 | Open in IMG/M |
| 3300005546|Ga0070696_100126886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1852 | Open in IMG/M |
| 3300005548|Ga0070665_102539684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 514 | Open in IMG/M |
| 3300005616|Ga0068852_101607672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 672 | Open in IMG/M |
| 3300005713|Ga0066905_100191516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1519 | Open in IMG/M |
| 3300005719|Ga0068861_100211602 | Not Available | 1633 | Open in IMG/M |
| 3300005764|Ga0066903_100059326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4764 | Open in IMG/M |
| 3300005764|Ga0066903_101602330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1235 | Open in IMG/M |
| 3300005764|Ga0066903_108050187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 540 | Open in IMG/M |
| 3300006057|Ga0075026_100409618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 764 | Open in IMG/M |
| 3300006175|Ga0070712_100441923 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300006844|Ga0075428_100302114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1721 | Open in IMG/M |
| 3300006854|Ga0075425_101499719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 761 | Open in IMG/M |
| 3300006904|Ga0075424_100046632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4520 | Open in IMG/M |
| 3300006904|Ga0075424_100562085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1218 | Open in IMG/M |
| 3300006914|Ga0075436_100517729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 874 | Open in IMG/M |
| 3300007076|Ga0075435_101513174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 588 | Open in IMG/M |
| 3300009792|Ga0126374_10408137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 952 | Open in IMG/M |
| 3300010043|Ga0126380_10027733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2819 | Open in IMG/M |
| 3300010043|Ga0126380_10496727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 935 | Open in IMG/M |
| 3300010043|Ga0126380_11126330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 671 | Open in IMG/M |
| 3300010046|Ga0126384_10254490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1421 | Open in IMG/M |
| 3300010360|Ga0126372_12899398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300010362|Ga0126377_10296846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1592 | Open in IMG/M |
| 3300010366|Ga0126379_12950565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300010398|Ga0126383_10405327 | Not Available | 1401 | Open in IMG/M |
| 3300010401|Ga0134121_11033909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 809 | Open in IMG/M |
| 3300011244|Ga0137483_100010 | All Organisms → cellular organisms → Bacteria | 233958 | Open in IMG/M |
| 3300012685|Ga0137397_10487332 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300012944|Ga0137410_11844304 | Not Available | 535 | Open in IMG/M |
| 3300012955|Ga0164298_10030595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2414 | Open in IMG/M |
| 3300012957|Ga0164303_11245711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300012985|Ga0164308_10738505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 852 | Open in IMG/M |
| 3300012989|Ga0164305_10418334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1032 | Open in IMG/M |
| 3300013297|Ga0157378_10157846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2119 | Open in IMG/M |
| 3300014325|Ga0163163_11380146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 766 | Open in IMG/M |
| 3300015373|Ga0132257_102275843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 702 | Open in IMG/M |
| 3300015374|Ga0132255_101075107 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1209 | Open in IMG/M |
| 3300018067|Ga0184611_1239776 | Not Available | 643 | Open in IMG/M |
| 3300018433|Ga0066667_10873545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 771 | Open in IMG/M |
| 3300020581|Ga0210399_10410523 | Not Available | 1129 | Open in IMG/M |
| 3300021560|Ga0126371_10099934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2888 | Open in IMG/M |
| 3300023058|Ga0193714_1045385 | Not Available | 636 | Open in IMG/M |
| 3300025900|Ga0207710_10478811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 645 | Open in IMG/M |
| 3300025911|Ga0207654_10062736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2179 | Open in IMG/M |
| 3300025942|Ga0207689_10008575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8908 | Open in IMG/M |
| 3300025944|Ga0207661_11479798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 622 | Open in IMG/M |
| 3300026067|Ga0207678_11886578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300026142|Ga0207698_10703497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. H62 | 1006 | Open in IMG/M |
| 3300026805|Ga0207507_103299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300027288|Ga0208525_1019384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 785 | Open in IMG/M |
| 3300027907|Ga0207428_10463617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 923 | Open in IMG/M |
| 3300027907|Ga0207428_11305741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 503 | Open in IMG/M |
| 3300028819|Ga0307296_10023076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3281 | Open in IMG/M |
| 3300028828|Ga0307312_10352217 | Not Available | 963 | Open in IMG/M |
| 3300031543|Ga0318516_10603961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 626 | Open in IMG/M |
| 3300031545|Ga0318541_10288733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. H62 | 913 | Open in IMG/M |
| 3300031572|Ga0318515_10099560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1523 | Open in IMG/M |
| 3300031573|Ga0310915_10002498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9745 | Open in IMG/M |
| 3300031720|Ga0307469_12003037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 562 | Open in IMG/M |
| 3300031724|Ga0318500_10091965 | Not Available | 1367 | Open in IMG/M |
| 3300031736|Ga0318501_10054889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1877 | Open in IMG/M |
| 3300031740|Ga0307468_100224170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1296 | Open in IMG/M |
| 3300031779|Ga0318566_10519375 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 583 | Open in IMG/M |
| 3300031798|Ga0318523_10069251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1692 | Open in IMG/M |
| 3300031859|Ga0318527_10129151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1051 | Open in IMG/M |
| 3300031892|Ga0310893_10007859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2816 | Open in IMG/M |
| 3300031908|Ga0310900_11516226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 565 | Open in IMG/M |
| 3300032179|Ga0310889_10151183 | Not Available | 1039 | Open in IMG/M |
| 3300032180|Ga0307471_101257502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 903 | Open in IMG/M |
| 3300034129|Ga0370493_0168337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 724 | Open in IMG/M |
| 3300034157|Ga0370506_060727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 807 | Open in IMG/M |
| 3300034820|Ga0373959_0016542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1368 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 13.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.38% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.43% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.83% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.89% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.89% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.94% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.94% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.94% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.94% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.94% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886013 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 | Host-Associated | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000816 | Forest soil microbial communities from Amazon forest - 2010 replicate II A10 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005160 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMB | Environmental | Open in IMG/M |
| 3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
| 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011244 | Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 18 - S13.2.60.3.a - transect 2, repeat 3, age 113 years, surface depth) | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300023058 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1 | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026805 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK01-A (SPAdes) | Environmental | Open in IMG/M |
| 3300026995 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB (SPAdes) | Environmental | Open in IMG/M |
| 3300027288 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300034129 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_16 | Environmental | Open in IMG/M |
| 3300034157 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_18 | Environmental | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SwBSRL2_0687.00000330 | 2162886013 | Switchgrass Rhizosphere | MNRVNPMTEPSPARTPYLLLWSTGIAALILSMAAFALWGTTGTRALFDMIVALCT |
| deepsgr_02654910 | 2199352025 | Soil | MTEPSSTNTTPYLLLWSTGVVAFVLCMAAFVLWGTTGMRTLFDMIVALCG |
| 2213941898 | 2209111006 | Arabidopsis Rhizosphere | MTEPSPARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIV |
| AF_2010_repII_A01DRAFT_10006616 | 3300000580 | Forest Soil | MNRVSPMTEPSPARTPYLLLWSTGIAALILSMAAFALWGTTGTRALFDMIVALCT* |
| AF_2010_repII_A10DRAFT_10059272 | 3300000816 | Forest Soil | MNRVNPMTEPSPVRTPYLLLWSTGIAALILSMAAFALWGTTGTRALFDMIVALCT* |
| Ga0062595_1000377832 | 3300004479 | Soil | MNRVNPMTEPSPARTPYLLLWSTGIAALILSMAAFALWGTTGTRALFDMIVALCT* |
| Ga0066395_104464622 | 3300004633 | Tropical Forest Soil | MTEPSPARTPYLLLWSTGIAALILSMAAFALWGTTGTRALFDMIVALCT* |
| Ga0062591_1010254942 | 3300004643 | Soil | MNRVSPMTEPSPARTPYLLLWSTGIAALVLSMTAFALWGTTGARTLFDMIVALCT* |
| Ga0066820_10092402 | 3300005160 | Soil | MTEPSSARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIVALCT* |
| Ga0066869_100076021 | 3300005165 | Soil | SPMTEPSSARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIVALCT* |
| Ga0065716_10113501 | 3300005277 | Arabidopsis Rhizosphere | MTEPSPARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIVALCT* |
| Ga0066388_1000651244 | 3300005332 | Tropical Forest Soil | MTEPSRADTPYLLLWSIGVLAFVLCTVAFVLWGITGTRTLFDMMIALCT* |
| Ga0066388_1000731894 | 3300005332 | Tropical Forest Soil | MTEPSPARTPYLLLWSTGITALILSMAAFALWGATGTRALFDVIVALCT* |
| Ga0066388_1002761743 | 3300005332 | Tropical Forest Soil | MTEQSPARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIVALCT* |
| Ga0066388_1006957562 | 3300005332 | Tropical Forest Soil | MTEPSSVRTPHLLLWSTGIAALILSMAAFALWGTTGTRALFDMIVALCT* |
| Ga0066388_1016329811 | 3300005332 | Tropical Forest Soil | YLLLWSTGIAALILSMAAFALWGTTGTRALFDMIVALCT* |
| Ga0066388_1020666422 | 3300005332 | Tropical Forest Soil | MSEPSSARTPYLLLWSTGIAALILSMAAFALWGTTGTRALFDMIVALCT* |
| Ga0066388_1023312561 | 3300005332 | Tropical Forest Soil | MNRVNPMTEPSPVRTPYLLLWSTGIAALILSMAAFALWGTTGTRALFDMIVAL |
| Ga0066388_1052457721 | 3300005332 | Tropical Forest Soil | MTEPSPARTPYLLLWSTGIAALILSMAAFALWGTTGTRALFDMIVALCT |
| Ga0068869_1001437182 | 3300005334 | Miscanthus Rhizosphere | MTEPSTARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIVALCT* |
| Ga0070675_1008313582 | 3300005354 | Miscanthus Rhizosphere | MNRVNPMTEPSPARTPYLLLWSTGIAALILSMVAFALWGTTGTRALFDMIVALCT* |
| Ga0070714_1017709222 | 3300005435 | Agricultural Soil | ARTPYLLLWSTGIAALILSMAAFALWGTTGTRALFDMIVALCT* |
| Ga0070713_10000369713 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | TPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIVALCT* |
| Ga0070705_1004826832 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | AKSRYRVSRRQQHLHSWRRHMNRVSPMTEPSPARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIVALCT* |
| Ga0070663_1007875491 | 3300005455 | Corn Rhizosphere | MTEPSSARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIV |
| Ga0070663_1010556572 | 3300005455 | Corn Rhizosphere | MNRVSPMTEPSPARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIVALCT* |
| Ga0070695_1015671902 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | ARTPYLLLWSTGIAALVLSMAALALWGTTGARTLFDMIVALCT* |
| Ga0070696_1001268863 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | EPSSARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIVALCT* |
| Ga0070665_1025396842 | 3300005548 | Switchgrass Rhizosphere | MNRVSPMTEPSTARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIVALCT* |
| Ga0068852_1016076721 | 3300005616 | Corn Rhizosphere | QMNRVSPMTEPSSARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIVALCT* |
| Ga0066905_1001915162 | 3300005713 | Tropical Forest Soil | MAEPSPARTPYLLLWSTGIAALILSMAAFALWGTTGTRALFDMIVALCT* |
| Ga0068861_1002116022 | 3300005719 | Switchgrass Rhizosphere | MNLSPMTEPSSARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIVALCT* |
| Ga0066903_1000593262 | 3300005764 | Tropical Forest Soil | MNRVNPMSEPSSARTPYLLLWSTGIAALILSMAAFALWGTTGTRALFDMIVALCT* |
| Ga0066903_1016023302 | 3300005764 | Tropical Forest Soil | MNRASPMTEPSPARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIVALCT* |
| Ga0066903_1080501872 | 3300005764 | Tropical Forest Soil | VSSMTEPSPARTPYLLLWSTGIAALILSMAAFALWGTTGTRALFDVIVALCT* |
| Ga0066903_1083404702 | 3300005764 | Tropical Forest Soil | NSRYRASRFRQRLHSWYRRMNRVNSMTEPSPARTPYLLLWSTGITALILSMAAFALWGATGTRALFDVIVALCT* |
| Ga0075026_1004096182 | 3300006057 | Watersheds | MNRVSQMTEPSSARTPYFLLWSTGVVALVLSMAAFALWGTTGTRTLFDMIVALCS* |
| Ga0070712_1004419232 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MNPVSTMTEPSPARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIVALCT* |
| Ga0075428_1003021141 | 3300006844 | Populus Rhizosphere | RRTRAAQITTATGASPADTPYWLLWSTGIVAFVLSIVAFVLWGINGASTLFDMIVALCT* |
| Ga0075425_1014997192 | 3300006854 | Populus Rhizosphere | MNQVSPMTETSPARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIVALCT* |
| Ga0075424_1000466322 | 3300006904 | Populus Rhizosphere | VNPMTEPSPARTPYLLLWSTGIAALILSMVAFALWGTTGTRALFDMIVALCT* |
| Ga0075424_1005620852 | 3300006904 | Populus Rhizosphere | MTETSPARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIVALCT* |
| Ga0075436_1005177292 | 3300006914 | Populus Rhizosphere | MRSTRPNWLLWSSGIAAVVLAAVAFILWGTNGPGMLFDMIVALCM* |
| Ga0075435_1015131741 | 3300007076 | Populus Rhizosphere | NRVSPMTEPSPARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIVALCT* |
| Ga0126374_104081371 | 3300009792 | Tropical Forest Soil | MNRVNSMTEPSPARTPYLLLWSTGITALILSMAAFALWGATGTRALFDVIVALCT* |
| Ga0126380_100277332 | 3300010043 | Tropical Forest Soil | MTEPSPARTPYLLLWSTGIAALILSMAAFALWATTGTRALFDMIVALCT* |
| Ga0126380_104967272 | 3300010043 | Tropical Forest Soil | MNRVNPMSEPSSTRTPYLLLWSTGIAALILSMAAFALWGTTGTRALFDMIVALCT* |
| Ga0126380_111263302 | 3300010043 | Tropical Forest Soil | MNRVNPMTEPSPARTPYLLLWSTSIAALILSMAAFALWGTTGTRALFDMIVALCT* |
| Ga0126384_102544902 | 3300010046 | Tropical Forest Soil | MTEPSPARTPYLLLWSTSIAALILSMAAFALWGTTGTRALFDMIVALCT* |
| Ga0126372_128993981 | 3300010360 | Tropical Forest Soil | MNRVNSMTEPSPARTPYLLLWSTGIAALVLSMAAFALWGTTGTRALFDVIVALCT* |
| Ga0126377_102968462 | 3300010362 | Tropical Forest Soil | MNRVNPMTEPSPARTPYLLLWSTGIAALILSMAAFALWGTTGTRALFDLIVALCT* |
| Ga0126379_129505651 | 3300010366 | Tropical Forest Soil | MNRVNPMTEPSPARTPYLLLWSTGIAALILSMAAFALWGTTGTRA |
| Ga0126383_104053272 | 3300010398 | Tropical Forest Soil | PARTPYLLLWSTGIAALILSMAAFALWGTTGTRALFDMIVALCT* |
| Ga0134121_110339092 | 3300010401 | Terrestrial Soil | MNRVNPMTEPSPARTPYLLLWSTGIAALILSMAAFALWGTTGTRALFDMIVAL |
| Ga0137483_100010114 | 3300011244 | Glacier Forefield Soil | MTGTGTRTREAAEQSPARTPYGLLWTTGIAAVVLSIAAFILWGTNGASTLFDMIVALCT* |
| Ga0137397_104873322 | 3300012685 | Vadose Zone Soil | GGSAGMSTTSPAADTPYRLLWSTGIAAFVLAVAAFALWGLNGASTLFDMIAAFCT* |
| Ga0137410_118443043 | 3300012944 | Vadose Zone Soil | ARMSTPASATPYWLLWSSGIAAAVLAVAAFALWGTIGESTLFDMIVALCM* |
| Ga0164298_100305952 | 3300012955 | Soil | MTEPSSARTPYLLLWSTGIAALVLSMTAFALWGTTGARTLFDMIVALCT* |
| Ga0164303_112457111 | 3300012957 | Soil | EPSSARTPYLLLWSTGIAALVLSMAAFALWGTTGARTSFDMIVALCT* |
| Ga0164308_107385052 | 3300012985 | Soil | MTEPSPARTPYLLLWSTGIAALVLGMAAFALWGTTGARTLFDMIVALCT* |
| Ga0164305_104183341 | 3300012989 | Soil | MNRVNPMTEPSPARTPYLLLWSTGTAARTLSMAAFALWGTTGTRALFDMIVALCT* |
| Ga0157378_101578464 | 3300013297 | Miscanthus Rhizosphere | PYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIVALCT* |
| Ga0163163_113801462 | 3300014325 | Switchgrass Rhizosphere | SARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIVALCT* |
| Ga0132257_1022758431 | 3300015373 | Arabidopsis Rhizosphere | MTEPSSARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMI |
| Ga0132255_1010751071 | 3300015374 | Arabidopsis Rhizosphere | IGFVTEVSPADTPYWLLWSTGIVASVLCIAAFALWSVNGASTLFDMIVALCT* |
| Ga0184611_12397762 | 3300018067 | Groundwater Sediment | AAEPPAANTPYGLLWTTGIAAVVLSVAAFIFWGTSGASTLFDMIVALCT |
| Ga0066667_108735451 | 3300018433 | Grasslands Soil | MNRVSPMTEPSPARTPYLLLWSTGIAALILSMAAFALWATTGTRALFDMIVALCT |
| Ga0210399_104105231 | 3300020581 | Soil | MSATSPAPGASPAGTPYRLLWSTGIAAFVLTAAAFALWGLNGTGTLFDIIAAFCT |
| Ga0126371_100999342 | 3300021560 | Tropical Forest Soil | MTEPSPARTPYLLLWSTGITALILSMAAFALWGATGTRALFDVIVALCT |
| Ga0193714_10453851 | 3300023058 | Soil | TGIGTRIRGAGEQPPAKTPYGLLWTTGIAAVVLSIAAFVLWGTNGASTLFDMIVALCT |
| Ga0207710_104788112 | 3300025900 | Switchgrass Rhizosphere | MNRVSPMTEPSTARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIVALCT |
| Ga0207654_100627364 | 3300025911 | Corn Rhizosphere | SSARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIVALCT |
| Ga0207689_100085752 | 3300025942 | Miscanthus Rhizosphere | MTEPSSARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMFVALCT |
| Ga0207661_114797981 | 3300025944 | Corn Rhizosphere | SPMTEPSSARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIVALCT |
| Ga0207677_113540932 | 3300026023 | Miscanthus Rhizosphere | MTEPSTARTPYLLLWSTGIAALVLSMAAFALWGTTGARTL |
| Ga0207678_118865782 | 3300026067 | Corn Rhizosphere | TEPSPARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIVALCT |
| Ga0207698_107034972 | 3300026142 | Corn Rhizosphere | CPQMNRVSPMTEPSSARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIVALCT |
| Ga0207507_1032992 | 3300026805 | Soil | MTEPSSARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIVALC |
| Ga0208761_10103212 | 3300026995 | Soil | MTEPSSARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLF |
| Ga0208525_10193841 | 3300027288 | Soil | VPCPQMNRVSAMTEPSSARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIVALCT |
| Ga0207428_104636172 | 3300027907 | Populus Rhizosphere | MTEPSPARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIVAL |
| Ga0207428_113057411 | 3300027907 | Populus Rhizosphere | TEPSTARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIVALCT |
| Ga0268264_122228681 | 3300028381 | Switchgrass Rhizosphere | YRVSRRRQHLHSWRRHMNRVSPMTEPSPARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIVALCT |
| Ga0307296_100230764 | 3300028819 | Soil | MAEPSPSDTPYLLLWSTGVVAFVLCIVAFVLWGITGTRTLFDMIIALCT |
| Ga0307312_103522172 | 3300028828 | Soil | LSPMAEPSPADTPYLLLWSTGVVAFVLCIVAFVLWGITGTRTLFDMIIALCT |
| Ga0318516_106039612 | 3300031543 | Soil | MNRVNSMTEPSPARTPYLLLWSTGIAALVLSMAAFALWGTTGTRALFDVIVALCT |
| Ga0318541_102887331 | 3300031545 | Soil | PAPARTPYLLLWSTGIAALVLSMAAFALWGTTGTRALFDVIVALCT |
| Ga0318515_100995601 | 3300031572 | Soil | PYLLLWSTGIAALVLSMAAFALWGTTGTRALFDVIVALCT |
| Ga0310915_100024989 | 3300031573 | Soil | VNSMTEPSPARTPYLLLWSTGIAALVLSMAAFALWGTTGTRALFDVIVALCT |
| Ga0307469_120030372 | 3300031720 | Hardwood Forest Soil | MTTARTPYWLLWSVGGAAFVLSMLAFVLWGTTGTRTLFDMIVALCF |
| Ga0318500_100919651 | 3300031724 | Soil | RRMNRVNSMTEPSPARTPYLLLWSTGIAALVLSMAAFALWGTTGTRALFDVIVALCT |
| Ga0318501_100548891 | 3300031736 | Soil | HSWYRRMNRVNSMTEPSPARTPYLLLWSTGIAALVLSMAAFALWGTTGTRALFDVIVALC |
| Ga0307468_1002241702 | 3300031740 | Hardwood Forest Soil | MTEPSPARTPYLLLWSTGIAVLVLSMAAFALWGTTGARTLFDMIVALCT |
| Ga0318566_105193751 | 3300031779 | Soil | SMTEPSPARTPYLLLWSTGIAALVLSMAAFALWGTTGTRALFDVIVALCT |
| Ga0318529_100656171 | 3300031792 | Soil | STGAFANSRYRASRFRQRLHSWYRRMNRVNSMTEPSPARTPYLLLWSTGIAALVLSMAAFALWGTTGTRALFDVIVALCT |
| Ga0318523_100692512 | 3300031798 | Soil | MNRVNSMTEPAPARTPYLLLWSTGIAALVLSMAAFALWGTTGTRALFDVIVALCT |
| Ga0310904_112614361 | 3300031854 | Soil | RRRQHLHSWRRHMNQVSPMTETSPARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIVALCT |
| Ga0310892_112857291 | 3300031858 | Soil | SRRRQHLHSWRRHMNQVSPMTETSPARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIVALCT |
| Ga0318527_101291511 | 3300031859 | Soil | VNSMTEPSPARTPYLLLWSTGIAALVLSMAAFALWGTTGTRALFDVIVALC |
| Ga0310893_100078592 | 3300031892 | Soil | MTETSPARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIVALCT |
| Ga0310900_115162262 | 3300031908 | Soil | MNQVSPMTETSPARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIVALCT |
| Ga0310889_101511831 | 3300032179 | Soil | SPMTETSPARTPYLLLWSTGIAALVLSMAAFALWGTTGARTLFDMIVALCT |
| Ga0307471_1012575021 | 3300032180 | Hardwood Forest Soil | MTEPSSARTPYLLLWSTGVVALVLSMAAFALWGTTGTRTLFDMIVALCT |
| Ga0370493_0168337_370_531 | 3300034129 | Untreated Peat Soil | MSTTGSGPQPARTPYWLLWSTGIVAVLLSAVAFVLWGINGTATLFDMIVALCT |
| Ga0370506_060727_16_177 | 3300034157 | Untreated Peat Soil | MNTTGTGIPAARTPYWLLWSTGIVAFVLCVAAFVLWGINGASTLFDMIVALCT |
| Ga0373959_0016542_816_965 | 3300034820 | Rhizosphere Soil | MTEPSPARTPYLLLWSTGIAALVLSMAAFALWGTTGARTVFDMIVALCT |
| ⦗Top⦘ |