| Basic Information | |
|---|---|
| Family ID | F094206 |
| Family Type | Metagenome |
| Number of Sequences | 106 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MIDVLYVAGTVLFFALMLGYVAACERLGRSADVERAREDAR |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 74.53 % |
| % of genes near scaffold ends (potentially truncated) | 16.04 % |
| % of genes from short scaffolds (< 2000 bps) | 88.68 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.019 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (13.207 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.302 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.226 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 56.52% β-sheet: 0.00% Coil/Unstructured: 43.48% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF09604 | Potass_KdpF | 33.96 |
| PF03814 | KdpA | 33.02 |
| PF02518 | HATPase_c | 24.53 |
| PF00486 | Trans_reg_C | 2.83 |
| PF00122 | E1-E2_ATPase | 0.94 |
| PF00702 | Hydrolase | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG2060 | K+-transporting ATPase, KdpA subunit | Inorganic ion transport and metabolism [P] | 33.02 |
| COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 0.94 |
| COG2216 | K+ transport ATPase, ATPase subunit KdpB | Inorganic ion transport and metabolism [P] | 0.94 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.02 % |
| Unclassified | root | N/A | 16.98 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908041|P3_CLC_ConsensusfromContig14803 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27 | 638 | Open in IMG/M |
| 2170459009|GA8DASG01ECRJD | Not Available | 513 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105512248 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300004114|Ga0062593_100822007 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300004633|Ga0066395_10436387 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300004633|Ga0066395_10480852 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300005328|Ga0070676_10182950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1364 | Open in IMG/M |
| 3300005329|Ga0070683_102313267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. B1 | 515 | Open in IMG/M |
| 3300005332|Ga0066388_100086017 | All Organisms → cellular organisms → Bacteria | 3543 | Open in IMG/M |
| 3300005332|Ga0066388_102147300 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27 | 1006 | Open in IMG/M |
| 3300005332|Ga0066388_102815149 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300005341|Ga0070691_10718261 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27 | 601 | Open in IMG/M |
| 3300005347|Ga0070668_100499490 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300005434|Ga0070709_10029735 | All Organisms → cellular organisms → Bacteria | 3271 | Open in IMG/M |
| 3300005434|Ga0070709_10314743 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27 | 1147 | Open in IMG/M |
| 3300005436|Ga0070713_100119384 | All Organisms → cellular organisms → Bacteria | 2310 | Open in IMG/M |
| 3300005436|Ga0070713_100523075 | Not Available | 1121 | Open in IMG/M |
| 3300005529|Ga0070741_10924316 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 753 | Open in IMG/M |
| 3300005534|Ga0070735_10571761 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300005538|Ga0070731_10692472 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300005547|Ga0070693_101578753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 515 | Open in IMG/M |
| 3300005564|Ga0070664_101138787 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300005577|Ga0068857_101768797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 605 | Open in IMG/M |
| 3300005764|Ga0066903_100165269 | All Organisms → cellular organisms → Bacteria | 3221 | Open in IMG/M |
| 3300005764|Ga0066903_101668076 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
| 3300005764|Ga0066903_102875511 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300005764|Ga0066903_103462189 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 851 | Open in IMG/M |
| 3300005764|Ga0066903_103686130 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300005764|Ga0066903_104679804 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300005842|Ga0068858_100777123 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300005937|Ga0081455_10106019 | All Organisms → cellular organisms → Bacteria | 2244 | Open in IMG/M |
| 3300006028|Ga0070717_10675056 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300006175|Ga0070712_100571752 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27 | 954 | Open in IMG/M |
| 3300006237|Ga0097621_100930323 | Not Available | 811 | Open in IMG/M |
| 3300006804|Ga0079221_10370309 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 874 | Open in IMG/M |
| 3300006854|Ga0075425_100910017 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300006854|Ga0075425_102912640 | Not Available | 525 | Open in IMG/M |
| 3300006903|Ga0075426_11260628 | Not Available | 561 | Open in IMG/M |
| 3300009029|Ga0066793_10138254 | All Organisms → cellular organisms → Bacteria | 1420 | Open in IMG/M |
| 3300009098|Ga0105245_10037547 | All Organisms → cellular organisms → Bacteria | 4307 | Open in IMG/M |
| 3300009545|Ga0105237_11378674 | Not Available | 711 | Open in IMG/M |
| 3300009553|Ga0105249_12707288 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300009789|Ga0126307_11135247 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27 | 632 | Open in IMG/M |
| 3300010046|Ga0126384_11244497 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27 | 688 | Open in IMG/M |
| 3300010047|Ga0126382_10167398 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27 | 1526 | Open in IMG/M |
| 3300010358|Ga0126370_10288835 | Not Available | 1294 | Open in IMG/M |
| 3300010358|Ga0126370_10613139 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27 | 942 | Open in IMG/M |
| 3300010358|Ga0126370_12238784 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300010359|Ga0126376_10157947 | All Organisms → cellular organisms → Bacteria | 1826 | Open in IMG/M |
| 3300010362|Ga0126377_10073412 | All Organisms → cellular organisms → Bacteria | 3051 | Open in IMG/M |
| 3300010362|Ga0126377_10257087 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27 | 1703 | Open in IMG/M |
| 3300010376|Ga0126381_104413040 | Not Available | 544 | Open in IMG/M |
| 3300010398|Ga0126383_10258038 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27 | 1715 | Open in IMG/M |
| 3300010398|Ga0126383_11524140 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300012931|Ga0153915_10011526 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 8489 | Open in IMG/M |
| 3300012948|Ga0126375_10911560 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300012960|Ga0164301_10245546 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27 | 1172 | Open in IMG/M |
| 3300012960|Ga0164301_10720307 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27 | 753 | Open in IMG/M |
| 3300012964|Ga0153916_10517231 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27 | 1265 | Open in IMG/M |
| 3300012971|Ga0126369_10784159 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300012984|Ga0164309_11006201 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27 | 687 | Open in IMG/M |
| 3300012987|Ga0164307_11158309 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27 | 638 | Open in IMG/M |
| 3300013102|Ga0157371_10618249 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27 | 807 | Open in IMG/M |
| 3300013104|Ga0157370_11409267 | Not Available | 627 | Open in IMG/M |
| 3300013297|Ga0157378_11388243 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300013307|Ga0157372_11051165 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27 | 942 | Open in IMG/M |
| 3300013307|Ga0157372_11318758 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27 | 833 | Open in IMG/M |
| 3300015371|Ga0132258_11490874 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27 | 1708 | Open in IMG/M |
| 3300015371|Ga0132258_13194575 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300017792|Ga0163161_11467359 | Not Available | 598 | Open in IMG/M |
| 3300017927|Ga0187824_10074772 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27 | 1068 | Open in IMG/M |
| 3300017937|Ga0187809_10005039 | All Organisms → cellular organisms → Bacteria | 4931 | Open in IMG/M |
| 3300017937|Ga0187809_10083592 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27 | 1056 | Open in IMG/M |
| 3300017966|Ga0187776_10200397 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27 | 1255 | Open in IMG/M |
| 3300017966|Ga0187776_10265377 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| 3300018058|Ga0187766_10164639 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27 | 1384 | Open in IMG/M |
| 3300018064|Ga0187773_10346429 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27 | 844 | Open in IMG/M |
| 3300021432|Ga0210384_11303347 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 631 | Open in IMG/M |
| 3300021560|Ga0126371_13390534 | Not Available | 538 | Open in IMG/M |
| 3300025899|Ga0207642_10365711 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27 | 855 | Open in IMG/M |
| 3300025907|Ga0207645_10156143 | Not Available | 1491 | Open in IMG/M |
| 3300025909|Ga0207705_10130218 | All Organisms → cellular organisms → Bacteria | 1872 | Open in IMG/M |
| 3300025912|Ga0207707_10679057 | Not Available | 866 | Open in IMG/M |
| 3300025928|Ga0207700_10583541 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27 | 994 | Open in IMG/M |
| 3300025929|Ga0207664_10780324 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300025932|Ga0207690_10418429 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300025933|Ga0207706_10306373 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27 | 1383 | Open in IMG/M |
| 3300025938|Ga0207704_10169538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Pelotomaculum → unclassified Pelotomaculum → Pelotomaculum sp. PtaU1.Bin065 | 1564 | Open in IMG/M |
| 3300025944|Ga0207661_11630922 | Not Available | 590 | Open in IMG/M |
| 3300025945|Ga0207679_10914524 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300027869|Ga0209579_10455478 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300027874|Ga0209465_10505312 | Not Available | 603 | Open in IMG/M |
| 3300031640|Ga0318555_10705610 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27 | 545 | Open in IMG/M |
| 3300031719|Ga0306917_11440634 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27 | 531 | Open in IMG/M |
| 3300031720|Ga0307469_11998914 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27 | 563 | Open in IMG/M |
| 3300031753|Ga0307477_10307458 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27 | 1094 | Open in IMG/M |
| 3300031879|Ga0306919_10758178 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300031902|Ga0302322_100667548 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1229 | Open in IMG/M |
| 3300031910|Ga0306923_12264334 | Not Available | 543 | Open in IMG/M |
| 3300032174|Ga0307470_11177851 | Not Available | 621 | Open in IMG/M |
| 3300032205|Ga0307472_101470746 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27 | 664 | Open in IMG/M |
| 3300032770|Ga0335085_12364195 | Not Available | 530 | Open in IMG/M |
| 3300033433|Ga0326726_10099435 | All Organisms → cellular organisms → Bacteria | 2601 | Open in IMG/M |
| 3300033475|Ga0310811_10224989 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2256 | Open in IMG/M |
| 3300033480|Ga0316620_10048941 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2872 | Open in IMG/M |
| 3300033486|Ga0316624_11620147 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca → Gemmatimonas aurantiaca T-27 | 597 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.21% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 11.32% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.72% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.77% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.77% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.77% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.83% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.83% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.83% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.83% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.89% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.94% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.94% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.94% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.94% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.94% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908041 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3 | Environmental | Open in IMG/M |
| 2170459009 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| P3_CLC_02258080 | 2124908041 | Soil | IDIIYVAGSVAFFALMVGYVAACERLGRTQEIEERDHESR |
| F47_06351500 | 2170459009 | Grass Soil | MIDVLYVAGTILFFALMLLYVEGCNRLGRVADVERTPDENAQ |
| INPhiseqgaiiFebDRAFT_1055122483 | 3300000364 | Soil | MIDILYIAATVLFFALMLAYAAACNRLGRQADVERVPEDDR* |
| Ga0062593_1008220072 | 3300004114 | Soil | MIDLIYLGSTVAFFALMIAYVAGCDRLGRAHDAERGDGDAR* |
| Ga0066395_104363872 | 3300004633 | Tropical Forest Soil | MIDLIYVAATVAFFALMLLYVAGCARLGRTADVEQARDEGESQ* |
| Ga0066395_104808522 | 3300004633 | Tropical Forest Soil | MMDALYLAGTLAFFALMLLYVEGCDRLGRAADVERTPSESER* |
| Ga0070676_101829501 | 3300005328 | Miscanthus Rhizosphere | MIDVLYVAGTVLFFALMLGYVAACERLGRSADVERAREDAR* |
| Ga0070683_1023132671 | 3300005329 | Corn Rhizosphere | MIDVLYVAGTVLFFALMIGYAAACDRLGRSADVERAREDGR* |
| Ga0066388_1000860172 | 3300005332 | Tropical Forest Soil | MIDAIYVTGTILFFALMLLYVEACARLGRAADVERSPEENGR* |
| Ga0066388_1021473002 | 3300005332 | Tropical Forest Soil | MIDFIYVAATVVFFALMLLYVAACDRLGRSADVERTRDQGEPQ* |
| Ga0066388_1028151492 | 3300005332 | Tropical Forest Soil | MIDIAYVVGTILFFGLMLLYVAGCDRLGRSADVERVSEEGK* |
| Ga0070691_107182612 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MIDLIYVLASILFFWLMILYVAGCERLGRTGEVERAAETDQ* |
| Ga0070668_1004994901 | 3300005347 | Switchgrass Rhizosphere | MGTGPMIDVLYVAGTVLFFALMLGYVAACERLGRSADVERAREDAR* |
| Ga0070709_100297353 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VIDILYVLATILFFWLMILYVAGCDRLGRAADVERTTKE* |
| Ga0070709_103147432 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MIDLVYVAGTILFFALMLLYVEGCDRLGRVADVERSPEENAR* |
| Ga0070713_1001193842 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VIDLVYVVATILFFALMIVYVAACDRLGRAADVERGGKEES* |
| Ga0070713_1005230752 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VIDFIYVVTTVLFFALMIAYVAACHRLGGSADVERASKEQR* |
| Ga0070741_109243162 | 3300005529 | Surface Soil | MLDLVYVAVTLVFFGLMLAYVAGCDRLGRSADVERAAEESR* |
| Ga0070735_105717613 | 3300005534 | Surface Soil | VLDLIYVAGSIAFFALMILYVAACDRLGRAADVERSEEMKP* |
| Ga0070731_106924722 | 3300005538 | Surface Soil | MIDLVYIVGTLAFFTLMLLYVAGCDFIGRHADVERAEPERGDSR* |
| Ga0070693_1015787531 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MLDVLYVAGTVLFFALMLGYVAACERLGRSADVERAREDAR* |
| Ga0070664_1011387871 | 3300005564 | Corn Rhizosphere | METGLVIDVLYVVATVLFFALMLGYVAACNRLGRSADVERAKEDVR* |
| Ga0068857_1017687973 | 3300005577 | Corn Rhizosphere | RCHASHTTMETGLVIDVLYVVATVLFFALMLGYVAACNRLGRSADVERAKEDVR* |
| Ga0066903_1001652693 | 3300005764 | Tropical Forest Soil | MIDFIYVAATVAFFALMLLYVAGCDRLGRSADVERAREEGEPQ* |
| Ga0066903_1016680762 | 3300005764 | Tropical Forest Soil | MIDFIYVIATLAFFGLMLLYVAACDRLGGSADVERAQEQGQ* |
| Ga0066903_1028755111 | 3300005764 | Tropical Forest Soil | MIDFIYVAATVVFFALMLLYVAACDRLGRSADVERGRDEGAAQ* |
| Ga0066903_1034621893 | 3300005764 | Tropical Forest Soil | VVGTILFFGLMVLYIAGCDRLGRGADVERVSEEGK* |
| Ga0066903_1036861302 | 3300005764 | Tropical Forest Soil | VIDILYVVATLLFFALMILYVEACDRLGRAADVERAADGGQR* |
| Ga0066903_1046798042 | 3300005764 | Tropical Forest Soil | MIDFIYVAATVVFFALMLLYVAACDRLGRSADVERTR |
| Ga0068858_1007771231 | 3300005842 | Switchgrass Rhizosphere | LYVAGTVLFFALMLGYVAACDRLGRNADVERAKEDVP* |
| Ga0081455_101060192 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MIDLVYVVGTVVFFVLMLLYIAGCERLGRGADVERTNEEP* |
| Ga0070717_106750562 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VIDFIYVLTTVLFFALMVAYVAACQRLGRHADVERATKEQP* |
| Ga0070712_1005717522 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MIDALYIAGTSLFFALMLLYVEGCDRLGRVADVERAPDENAR* |
| Ga0097621_1009303232 | 3300006237 | Miscanthus Rhizosphere | MIDALYVAGTILFFALMLLYVEGCDRLGRVADVERAPDENAR* |
| Ga0079221_103703092 | 3300006804 | Agricultural Soil | MIDVVYVATTVVFFALMVAYVAACDRLGRKADADRVKSEQP* |
| Ga0075425_1009100172 | 3300006854 | Populus Rhizosphere | VIDFIYVVATVLFFAVMIGYTAACDRLGRAADVERATKEQS* |
| Ga0075425_1029126402 | 3300006854 | Populus Rhizosphere | MIDALYIAGTILFFALMLLYVEGCDRLGRVADVERAPDENAR* |
| Ga0075426_112606281 | 3300006903 | Populus Rhizosphere | VIDFIYVVATVLFFAGMIAYTAACDRLGRAADVERATKEQS* |
| Ga0066793_101382542 | 3300009029 | Prmafrost Soil | MIDIIYVAGSVAFFALMVGYVAACERLGRTQEIEERDHESR* |
| Ga0105245_100375474 | 3300009098 | Miscanthus Rhizosphere | MLDVLYVAGTVLFFALMLGYVAACDRLGRNADVERAKEDVP* |
| Ga0105237_113786743 | 3300009545 | Corn Rhizosphere | MIDAVYVAGTIVFFALMILYAEGCDHLGRGADVERASSEDEAR* |
| Ga0105249_127072882 | 3300009553 | Switchgrass Rhizosphere | MIDVLYVAGTVLFFALMLGYVAACERLRRSADVERARED |
| Ga0126307_111352471 | 3300009789 | Serpentine Soil | MIDVVYVVATVLFFALMLGYVAACDRLGRSGDVERAEEDAR* |
| Ga0126384_112444973 | 3300010046 | Tropical Forest Soil | MIDVVYVAGTMLFFALMILYAEGCDRLGRAADVERGAAEDEPR* |
| Ga0126382_101673983 | 3300010047 | Tropical Forest Soil | MIDIAYIVGTILFFGLMVLYIAGCDRLGRTADVERAPEEGK* |
| Ga0126370_102888351 | 3300010358 | Tropical Forest Soil | MIDFIYVAATVVFFALMLLYVAACDRLGRSADVERAREEGEPL* |
| Ga0126370_106131392 | 3300010358 | Tropical Forest Soil | MMDALYLAGTLAFFALMLLYVEGCDRLGRAADVDRTPSESER* |
| Ga0126370_122387842 | 3300010358 | Tropical Forest Soil | VIDILYVVATLLFFALMILYVEACDRLGRAADVERAPDGGQR* |
| Ga0126376_101579472 | 3300010359 | Tropical Forest Soil | MRDAPSDKAAVVIDIIYIVSTIVFFALMIAYVAACDHLGRSADVERGGKEQS* |
| Ga0126377_100734123 | 3300010362 | Tropical Forest Soil | MLDLVYVLGTVAFFGLMLLYIAGCDRLGRSADVERGSEERK* |
| Ga0126377_102570873 | 3300010362 | Tropical Forest Soil | MIDLVYVLGTVAFFGLMLLYIAGCDRLGRAADVERGSEEGK* |
| Ga0126381_1044130403 | 3300010376 | Tropical Forest Soil | VIDFMYVVATVLFFALMIAYVAGCDRLGRSADVERASKDQS* |
| Ga0126383_102580383 | 3300010398 | Tropical Forest Soil | MIDLIYVAATVAFFALMLLYVAGCAWLGRTADVEQARDEGESQ* |
| Ga0126383_115241402 | 3300010398 | Tropical Forest Soil | MIDFIYVAATLVFFALMLLYVAACDRLGRSADVERTRDQGEPQ* |
| Ga0153915_100115267 | 3300012931 | Freshwater Wetlands | MIDVIYVVASVLFFALMLLYVYACDRLGRSAEVERAHEENP* |
| Ga0126375_109115602 | 3300012948 | Tropical Forest Soil | MIDLVYVLGTVAFFGLMLLYIAGCDRLGRSADVERGSE |
| Ga0164301_102455462 | 3300012960 | Soil | MSQMIDALYIAGTILFFALMLLYVEGCDRLGRVADVERAPDENTR* |
| Ga0164301_107203071 | 3300012960 | Soil | DDAFCTSHTTMGTGPMIDVLYVAGTVLFFALMLGYVAACERLGRSADVERAREDAR* |
| Ga0153916_105172312 | 3300012964 | Freshwater Wetlands | MLDLVYIAVTVLFFALMLLYVHGCDRLGRSADIEEPKP* |
| Ga0126369_107841591 | 3300012971 | Tropical Forest Soil | MIDFIYVAVTVVFFALMLLYVAACDRLGRSADVERAREEGEPLCRSKAG |
| Ga0164309_110062011 | 3300012984 | Soil | MSQMIDALYIAGTILFFALMLLYVEGCDRLGRVADVERAPDENAR* |
| Ga0164307_111583091 | 3300012987 | Soil | MPEHATRISQMIDALHIAGTILFFALMLLYIEGCDRLGRVADVERAPDENTR* |
| Ga0157371_106182491 | 3300013102 | Corn Rhizosphere | METGLVIDVLYVVATVLFFALMLGYVAACERLGRSADVERAREDAR* |
| Ga0157370_114092672 | 3300013104 | Corn Rhizosphere | MIDVLYVVATVLFFALMLGYVAACNRLGRSADVERAKEDVR* |
| Ga0157378_113882432 | 3300013297 | Miscanthus Rhizosphere | MIDVLYVAGTVLFFALMLGYVAACERLGRSADVERAREDVR* |
| Ga0157372_110511653 | 3300013307 | Corn Rhizosphere | METGLVIDVLYVVATVLFFALMLGYVAACNRLGRSGDVERAKEDVR* |
| Ga0157372_113187583 | 3300013307 | Corn Rhizosphere | VEATLVIDLIYVLITVLFFVLMAAYVAACYRLGRSADVERASREQP* |
| Ga0132258_114908742 | 3300015371 | Arabidopsis Rhizosphere | MIDVLYVAATVLFFALMLGYAAACDRLGRNADVERAKEDAR* |
| Ga0132258_131945752 | 3300015371 | Arabidopsis Rhizosphere | MMDLIYVASTIAFFALMIAYVAGCDRLGRTADAERSNDRSVQ* |
| Ga0163161_114673591 | 3300017792 | Switchgrass Rhizosphere | MLDVLYVAGTVLFFALMLGYVAACDRLGRNADVERAKEDVP |
| Ga0187824_100747723 | 3300017927 | Freshwater Sediment | MIDAVYILGTILFFALMLAYVAGCDRIGRTADVERAVEDVQ |
| Ga0187809_100050394 | 3300017937 | Freshwater Sediment | MLDVLYVVGTVLFFALMIAYAAACDRLGRRADVERAPEDAR |
| Ga0187809_100835923 | 3300017937 | Freshwater Sediment | VIDFIYVLATVLFFALMVAYVAACDRLGRNADVERASKEQP |
| Ga0187776_102003973 | 3300017966 | Tropical Peatland | MIDAVYVAGTVLFFALMILYIEGCDRLGRTADVERAPEDETR |
| Ga0187776_102653773 | 3300017966 | Tropical Peatland | MIDLIYVIATLAFFALMLLYVAACDRLGRNADVERAHEGETQ |
| Ga0187766_101646393 | 3300018058 | Tropical Peatland | MIDVIYVAATIAFFALMLLYVAACDRLGRSADVERAPKEEQ |
| Ga0187773_103464293 | 3300018064 | Tropical Peatland | MIDLIYVIATLAFFGHMLLYVAACDRLGRNADVERAHEGETQ |
| Ga0210384_113033472 | 3300021432 | Soil | MLDLVYIAATVLFFGLTLLYVRSCERLGRTKDTDGSA |
| Ga0126371_133905343 | 3300021560 | Tropical Forest Soil | MIDALYVAGTILFFALMILYAQGCDRLGRAADVERGAEEELR |
| Ga0207642_103657111 | 3300025899 | Miscanthus Rhizosphere | MIDVLYVAGTVLFFALMLGYVAACERLGRSADVERAREDAR |
| Ga0207645_101561431 | 3300025907 | Miscanthus Rhizosphere | MLDVLYVAGTVLFFALMLGYVAACERLGRSADVERAREDAR |
| Ga0207705_101302182 | 3300025909 | Corn Rhizosphere | MLDVVYVLATTAFFAMMLGYVAACARRGRGDVDSPESL |
| Ga0207707_106790573 | 3300025912 | Corn Rhizosphere | MIDLIYVLASILFFWLMILYVAGCERLGRTGEVERAAETDQ |
| Ga0207700_105835412 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VIDFIYVLTTVLFFALMVAYVAACQRLGRHADVERATKEQP |
| Ga0207664_107803241 | 3300025929 | Agricultural Soil | VIDFIYVVTTVLFFALMIAYVAACHRLGGSADVERASKE |
| Ga0207690_104184292 | 3300025932 | Corn Rhizosphere | METGLVIDVLYVVATVLFFALMLGYVAACNRLGRSADVERAKEDVR |
| Ga0207706_103063733 | 3300025933 | Corn Rhizosphere | METGLVIDVLYVVATVLFFALMLGYVAACERLGRSADVERAREDAR |
| Ga0207704_101695381 | 3300025938 | Miscanthus Rhizosphere | PMIDVLYVAGTVLFFALMLGYVAACERLGRSADVERAREDAR |
| Ga0207661_116309221 | 3300025944 | Corn Rhizosphere | MIDVLYVAGTVLFFALMIGYAAACDRLGRSADVERAREDGR |
| Ga0207679_109145242 | 3300025945 | Corn Rhizosphere | VIDVLYVVATVLFFALMLGYVAACNRLGRSADVERAKEDVR |
| Ga0209579_104554782 | 3300027869 | Surface Soil | MIDLVYIVGTLAFFTLMLLYVAGCDFIGRHADVERAEPERGDSR |
| Ga0209465_105053122 | 3300027874 | Tropical Forest Soil | MMDALYLAGTLAFFALMLLYVEGCDRLGRAADVERTPSESER |
| Ga0318555_107056103 | 3300031640 | Soil | HMIDVVYVAATILFFALMILYVEGCDRLGRTADVERASEESSR |
| Ga0306917_114406343 | 3300031719 | Soil | MIDFIYVAATVAFFGLMLLYVAACDRLGRSADVERTQDREQ |
| Ga0307469_119989143 | 3300031720 | Hardwood Forest Soil | TVPQSEAGVVIDLVYVAATVLFFALMIVYVAACDRLGRAADVERGGKEQS |
| Ga0307477_103074582 | 3300031753 | Hardwood Forest Soil | MLDLIYVAATIVFFALMILYIHACDLLGRSADVERAEETVR |
| Ga0306919_107581781 | 3300031879 | Soil | MIDVVYVAATILFFALMILYVEGCDRLGRTADVERASEES |
| Ga0302322_1006675483 | 3300031902 | Fen | MNDILYLVLIVAFFALMLGYVAACARLGRSSGAEETGNDNR |
| Ga0306923_122643342 | 3300031910 | Soil | MIDVVYVAATILFFALMILYVEGCDRLGRTADVERASEESSR |
| Ga0307470_111778512 | 3300032174 | Hardwood Forest Soil | VIDLVYVAATVLFFALMIVYVAACDRLGRAADVERGGKEQS |
| Ga0307472_1014707461 | 3300032205 | Hardwood Forest Soil | SEAGVVIDLVYVAATILFFALMIVYVAACDRLGRAADVERGGKEQS |
| Ga0335085_123641952 | 3300032770 | Soil | MIDAAYLIGTVLFFALMIAYAAACDRLGQSADVERPEEDVR |
| Ga0326726_100994353 | 3300033433 | Peat Soil | MIDAVYVAGTVLFFALMILYVEGCDRLGRSADVERAAEEEPR |
| Ga0310811_102249891 | 3300033475 | Soil | METHMKDIGYVVATIAFFALMLAFVAGCARLGRIADSERAEETAR |
| Ga0316620_100489414 | 3300033480 | Soil | MIDLIYVVATILFFALMLLYVAACDRLGRAAEAERAPEENP |
| Ga0316624_116201471 | 3300033486 | Soil | YVAATLAFFALMLLYVAACDRLGRNADVERAHEEGEPQ |
| ⦗Top⦘ |