NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F094202

Metagenome / Metatranscriptome Family F094202

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F094202
Family Type Metagenome / Metatranscriptome
Number of Sequences 106
Average Sequence Length 43 residues
Representative Sequence MERIQINEVSLELLTAGDGPPLLFLHGGDYFAQHREFFDRL
Number of Associated Samples 95
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 97.17 %
% of genes from short scaffolds (< 2000 bps) 90.57 %
Associated GOLD sequencing projects 89
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.226 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(46.226 % of family members)
Environment Ontology (ENVO) Unclassified
(52.830 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.340 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 18.84%    β-sheet: 14.49%    Coil/Unstructured: 66.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF00571CBS 66.04
PF02515CoA_transf_3 4.72
PF00561Abhydrolase_1 4.72
PF01019G_glu_transpept 2.83
PF00296Bac_luciferase 1.89
PF03453MoeA_N 0.94
PF07228SpoIIE 0.94
PF01315Ald_Xan_dh_C 0.94
PF06094GGACT 0.94
PF01381HTH_3 0.94
PF07813LTXXQ 0.94
PF13733Glyco_transf_7N 0.94
PF07332Phage_holin_3_6 0.94
PF00027cNMP_binding 0.94
PF00106adh_short 0.94
PF10067DUF2306 0.94
PF03972MmgE_PrpD 0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 4.72
COG3678Periplasmic chaperone Spy, Spy/CpxP familyPosttranslational modification, protein turnover, chaperones [O] 3.77
COG0405Gamma-glutamyltranspeptidaseAmino acid transport and metabolism [E] 2.83
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 1.89
COG0303Molybdopterin Mo-transferase (molybdopterin biosynthesis)Coenzyme transport and metabolism [H] 0.94
COG20792-methylcitrate dehydratase PrpDCarbohydrate transport and metabolism [G] 0.94


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.23 %
UnclassifiedrootN/A3.77 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003351|JGI26346J50198_1024948All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria591Open in IMG/M
3300005175|Ga0066673_10281097All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales968Open in IMG/M
3300005187|Ga0066675_10124876All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium1736Open in IMG/M
3300005332|Ga0066388_101186796All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1303Open in IMG/M
3300005363|Ga0008090_14838646All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales652Open in IMG/M
3300005557|Ga0066704_10373312All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300005560|Ga0066670_11025570All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300005610|Ga0070763_10552151All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales664Open in IMG/M
3300006175|Ga0070712_100772725All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales823Open in IMG/M
3300009038|Ga0099829_10149660All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1862Open in IMG/M
3300009090|Ga0099827_10864178All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium783Open in IMG/M
3300009143|Ga0099792_10304080All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales948Open in IMG/M
3300010047|Ga0126382_10220281All Organisms → cellular organisms → Bacteria → Proteobacteria1366Open in IMG/M
3300010048|Ga0126373_10350767All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium1487Open in IMG/M
3300010359|Ga0126376_11541369All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium695Open in IMG/M
3300010360|Ga0126372_10422597All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1225Open in IMG/M
3300010376|Ga0126381_102302266All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300010398|Ga0126383_13372473All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium522Open in IMG/M
3300012207|Ga0137381_11287847All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300012208|Ga0137376_11762270All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300012363|Ga0137390_11403242All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium642Open in IMG/M
3300016270|Ga0182036_10612768Not Available874Open in IMG/M
3300016294|Ga0182041_10161302All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881743Open in IMG/M
3300016294|Ga0182041_10198598All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1595Open in IMG/M
3300016341|Ga0182035_10508278All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881030Open in IMG/M
3300016357|Ga0182032_10047180All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2769Open in IMG/M
3300016371|Ga0182034_10377295All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881158Open in IMG/M
3300016371|Ga0182034_10979821All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300016422|Ga0182039_11953849All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium539Open in IMG/M
3300016445|Ga0182038_10553277All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088988Open in IMG/M
3300016445|Ga0182038_11598254All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium586Open in IMG/M
3300016445|Ga0182038_11674774All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium573Open in IMG/M
3300017972|Ga0187781_10825343All Organisms → cellular organisms → Bacteria → Proteobacteria674Open in IMG/M
3300018060|Ga0187765_10459767All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300018085|Ga0187772_11140748All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium573Open in IMG/M
3300018482|Ga0066669_11457511All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria621Open in IMG/M
3300021168|Ga0210406_11006590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium620Open in IMG/M
3300021170|Ga0210400_11020247All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium672Open in IMG/M
3300021178|Ga0210408_10255945All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881394Open in IMG/M
3300021178|Ga0210408_10410176All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1079Open in IMG/M
3300021358|Ga0213873_10085270Not Available890Open in IMG/M
3300021361|Ga0213872_10415471All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium544Open in IMG/M
3300022712|Ga0242653_1060791All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium632Open in IMG/M
3300025906|Ga0207699_10247065All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1228Open in IMG/M
3300025928|Ga0207700_10439532All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1148Open in IMG/M
3300025929|Ga0207664_10380158All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881254Open in IMG/M
3300026316|Ga0209155_1130140All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria864Open in IMG/M
3300026490|Ga0257153_1115208All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria529Open in IMG/M
3300026527|Ga0209059_1316012All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales529Open in IMG/M
3300027069|Ga0208859_1003829All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881571Open in IMG/M
3300027603|Ga0209331_1149816All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium553Open in IMG/M
3300027651|Ga0209217_1109020All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria786Open in IMG/M
3300027783|Ga0209448_10257796All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300027882|Ga0209590_11042872All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium508Open in IMG/M
3300027903|Ga0209488_10141234All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1817Open in IMG/M
3300027908|Ga0209006_10831128All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria746Open in IMG/M
3300028047|Ga0209526_10692750All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium642Open in IMG/M
3300029951|Ga0311371_10591225All Organisms → cellular organisms → Bacteria1430Open in IMG/M
3300031543|Ga0318516_10730751All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium561Open in IMG/M
3300031544|Ga0318534_10464464All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300031546|Ga0318538_10093902All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881540Open in IMG/M
3300031564|Ga0318573_10297502All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088864Open in IMG/M
3300031564|Ga0318573_10807809All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium504Open in IMG/M
3300031572|Ga0318515_10689843All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium541Open in IMG/M
3300031573|Ga0310915_10020180All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4041Open in IMG/M
3300031573|Ga0310915_10540644All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300031640|Ga0318555_10059463All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881957Open in IMG/M
3300031681|Ga0318572_10266493All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881009Open in IMG/M
3300031681|Ga0318572_10611000All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300031719|Ga0306917_10041717All Organisms → cellular organisms → Bacteria → Proteobacteria3033Open in IMG/M
3300031724|Ga0318500_10363286All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300031736|Ga0318501_10064212All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881757Open in IMG/M
3300031747|Ga0318502_10025956All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2902Open in IMG/M
3300031748|Ga0318492_10054134All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881882Open in IMG/M
3300031754|Ga0307475_10222325All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881511Open in IMG/M
3300031763|Ga0318537_10193397All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria757Open in IMG/M
3300031764|Ga0318535_10075542All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881447Open in IMG/M
3300031764|Ga0318535_10119407All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881164Open in IMG/M
3300031765|Ga0318554_10513368All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300031782|Ga0318552_10679007All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300031796|Ga0318576_10009169All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3580Open in IMG/M
3300031798|Ga0318523_10019195All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales2949Open in IMG/M
3300031798|Ga0318523_10148942All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881163Open in IMG/M
3300031799|Ga0318565_10210738All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088945Open in IMG/M
3300031819|Ga0318568_10342313All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria930Open in IMG/M
3300031833|Ga0310917_10041230All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales2788Open in IMG/M
3300031833|Ga0310917_10890400All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium599Open in IMG/M
3300031835|Ga0318517_10023426All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales2408Open in IMG/M
3300031845|Ga0318511_10013148All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2863Open in IMG/M
3300031890|Ga0306925_11923009Not Available561Open in IMG/M
3300031896|Ga0318551_10171790All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881191Open in IMG/M
3300031897|Ga0318520_10408947All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300031912|Ga0306921_10551015All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881337Open in IMG/M
3300031941|Ga0310912_10139281All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881822Open in IMG/M
3300031945|Ga0310913_10496465All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium867Open in IMG/M
3300031981|Ga0318531_10341782All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales676Open in IMG/M
3300032042|Ga0318545_10329626All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium549Open in IMG/M
3300032052|Ga0318506_10078036All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881385Open in IMG/M
3300032060|Ga0318505_10095418All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881340Open in IMG/M
3300032065|Ga0318513_10277491All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales813Open in IMG/M
3300032066|Ga0318514_10069094All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881744Open in IMG/M
3300032090|Ga0318518_10387890All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300032094|Ga0318540_10176330All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881028Open in IMG/M
3300032205|Ga0307472_100813479All Organisms → cellular organisms → Bacteria → Proteobacteria855Open in IMG/M
3300033290|Ga0318519_10700528All Organisms → cellular organisms → Bacteria619Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil46.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil13.21%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.55%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.66%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.77%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.83%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.83%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.89%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.89%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.94%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.94%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.94%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.94%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003351Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021358Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3Host-AssociatedOpen in IMG/M
3300021361Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2Host-AssociatedOpen in IMG/M
3300022712Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300026490Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-AEnvironmentalOpen in IMG/M
3300026527Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)EnvironmentalOpen in IMG/M
3300027069Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF002 (SPAdes)EnvironmentalOpen in IMG/M
3300027603Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027651Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI26346J50198_102494813300003351Bog Forest SoilMTRIVVGEVSLEISLAGEGPPLLFLHGGDYFAQNQDFLDKLARRWRVLIPRH
Ga0066673_1028109733300005175SoilMERIQIGEVSIELLTAGDGPPLLFLHGGDYFAQHQEFFDRLARHWR
Ga0066675_1012487633300005187SoilMERIQINEVSLELLTAGDGPPLLFLHGGDYFAQHREFFDRL
Ga0066388_10118679613300005332Tropical Forest SoilMQRIEIGQVSLEIAIAGAGRPLLFLHGGDYFVQNRVFLDRLA
Ga0008090_1483864613300005363Tropical Rainforest SoilMERIEVGGYSLEVRSVGEGPPLLFLHGGDYFAQHRDFFETLARR
Ga0066704_1037331213300005557SoilMERIQINELSFEVLTAGDGPPLLFLHGGDYFAQHREFFDR
Ga0066670_1102557013300005560SoilMERIQINEVSLDLLTAGDGPLLLFLHGGDYFAQHQEFFEKLA
Ga0070763_1055215123300005610SoilMERMRINEISLELLTAGDGPPLLFLHGGDYFAQHREFFDRLARHWR
Ga0070712_10077272513300006175Corn, Switchgrass And Miscanthus RhizosphereMERAEIGEISLEVLTAGEDRTLLFLHGGDYFAQHREFFERLARRWR
Ga0099829_1014966033300009038Vadose Zone SoilMQRIDIGEVSLEASIAGDGRPLLFLHGGDYFAQNRAFL
Ga0099827_1086417823300009090Vadose Zone SoilMQRIDIGEVSLEASIAGDGRPLLFLHGGDYFVQNRAFLDRMAQRRRVFA
Ga0099792_1030408013300009143Vadose Zone SoilMERIAIGEISLEVLMAGEGPPLLFLHGGDYFLQNRQFIEELA
Ga0126382_1022028133300010047Tropical Forest SoilMERIQIGNVSLDVSIAGDGPPLLFLHGGDYFVQHREFFDRLARQ
Ga0126373_1035076733300010048Tropical Forest SoilMARIDIAEVSLEVSLAGEGPPLLFLHGGDYFAQNQGFLE
Ga0126376_1154136913300010359Tropical Forest SoilMERIQIGNVSLDVSLAGDGPQLLFLHGGDYFVQHREFFDR
Ga0126372_1042259743300010360Tropical Forest SoilMERIEVGGVSLEVTSVGEGPPLLFLHGGDYFAQHRD
Ga0126381_10230226613300010376Tropical Forest SoilMGVIQIGDVRLEVSTAGTGRPLLFLHGGDYFAQNRGFFERLARHWRVLIP
Ga0126383_1337247323300010398Tropical Forest SoilMQRIVIGGVTLEGSVAGEGPPLLFLHGGDYFQQNRVFLDK
Ga0137381_1128784713300012207Vadose Zone SoilMERIQIGDVSLEMLMAGAGPPLLFLHGGDYFAQHRE
Ga0137376_1176227013300012208Vadose Zone SoilMERIQIGDVSLEMLTVGHGEPLLFLHGGDYFGQHREFFDRLARQFR
Ga0137390_1140324213300012363Vadose Zone SoilMQRIDIGEVSLEASIAGDGRPLLFLHGGDYFVQNRAFLDRMAQ
Ga0182036_1061276823300016270SoilMGDVSLEMRTTGEGPPLLFLHGGDYFTQNQGFLERLAQRWRVVIPRH
Ga0182041_1016130213300016294SoilMERIQIADLSLQVGTAGEGRPLLFLHGGDYFAQNRTFLERLA
Ga0182041_1019859813300016294SoilMERINIAGVSLEMLTAGDGPPLLFLHGGDYFAQHRDFFGKLARRWR
Ga0182035_1050827833300016341SoilMERIQIGDVSLEMRTAGEGPPLLFLHGGDYFAQNQGLLERLARRWQVLIP
Ga0182032_1004718013300016357SoilMARIGVGEVSLEISLAGEGQPLLFLHGGDHFAQNQDF
Ga0182034_1037729533300016371SoilMERIQIADLSLQVETAGEGRPLLFLHGGDYFAQNRGFLDR
Ga0182034_1097982123300016371SoilMARIDVGEVSLEISLAGEGQPLLFLHGGDYFAQNQEFLDRLARR
Ga0182039_1195384913300016422SoilMARIGVGEVSLEISLAGEGQPLLFLHGGDYFAQNQDFLDRLARHW
Ga0182038_1055327713300016445SoilMARIGVGEVSLEISLAGEGQPLLFLHGGDYFAQNQDFLDRLAR
Ga0182038_1159825423300016445SoilMGDVSLEMRTAGEGPPLLFLHGGDYFTQTRAFLERLAQRWRVMIP
Ga0182038_1167477423300016445SoilMERIQIGDVSLKMRTAGEGPPLLFLHGGDYVAQNQGFLAT
Ga0187781_1082534323300017972Tropical PeatlandMTRIAIGQVSLEGFTAGDGPPLLFLHGGDYVRQNRAFLDRLAG
Ga0187765_1045976713300018060Tropical PeatlandMERIQIGDVALEVRTSGEGKPMLFLHGGDYFAQNRAFLD
Ga0187772_1114074813300018085Tropical PeatlandMQRIEIGQVSLEIAIAGDGRPLLFLHGGDYFAQNRAFLDKLAQRLRVL
Ga0066669_1145751123300018482Grasslands SoilMERTQINEPTFKVLTAGDGPPPLFLHGGDYIAEHPAFFDRLPRH
Ga0210399_1063860333300020581SoilMERIDIGEISLEAHIAGSGPPLLFLHGLDYFAQHRHFLDR
Ga0210406_1100659023300021168SoilMARVDIAEVSLDLSLAGEGPPLLFLHGGDYFAQNRGFLE
Ga0210400_1102024713300021170SoilMQRIAIGEVSLEVAIAGDGAPLLFLHGGDYLAQNRAFLERLAG
Ga0210408_1025594533300021178SoilMERIQINELSLDLLTAGDGPPLLFLHGGDYFAQHQEFFDRLARHWRIV
Ga0210408_1041017613300021178SoilMERIAIGEISLEVLMAGEGPPLLFLHGGDYFLQNRQFIEELARH
Ga0213873_1008527023300021358RhizosphereMQRIDIGGVPLEIAIAGAGRPLLFLHAGDFFAQNQ
Ga0213872_1041547123300021361RhizosphereMERIEIGGISLEASIIGEGPPLLFLHGGDYFAQHRGFFDLVARRWRV
Ga0242653_106079113300022712SoilMERIQINEVSLELLTAGGGPPLLFLHGGDYFAQHREFFDKLARHW
Ga0207699_1024706513300025906Corn, Switchgrass And Miscanthus RhizosphereMERIKVGEVSLEALTAGDGPSLLFLHGGDYFAQHRGFFDRLAQQFRVFAPR
Ga0207700_1043953233300025928Corn, Switchgrass And Miscanthus RhizosphereMERIKVGEVSLEALTAGDGPSLLFLHGGDYFAQHRGLFDRL
Ga0207664_1038015813300025929Agricultural SoilMERIQINELSLDLLTAGDGPPLLFLHAGDYFEEHREF
Ga0209155_113014023300026316SoilMERIQIGEVSIELLTAGDGPPLLFLHGGDYFAQHQEFFDRLARHWRVIVP
Ga0257153_111520823300026490SoilMGRIQINELSLDLLTAGDGPPLLFLHGGDYFAQHREFFDR
Ga0209059_131601213300026527SoilMERIQIGDVSLEMLTAGAGPPLLLLHGEDYFAQHQEFFDRLARRWRVVVPRH
Ga0208859_100382913300027069Forest SoilMERIQINTLSLDLLTAGDGPPLLFLHGGEYFAQHREFFDRLARHWRVVVPRHP
Ga0209331_114981623300027603Forest SoilMERIQINELSLDLLTAGDGAPLLFLHGGDYFAQHREFFDRLARHWRVVV
Ga0209217_110902013300027651Forest SoilMERIQINELSLDLVTAGDGPPLLFLHGGDYFAQHREFFDRLARHWRV
Ga0209448_1025779623300027783Bog Forest SoilMGSMDPQRGTEMERIQINEVSLELLTAGDGPPLLFLHGGDNFAQHREFFDKLARR
Ga0209590_1104287223300027882Vadose Zone SoilMQRIDIGEVSLEASIAGDGRPLLFLHGGDYFVQNRAFLDRMAQRRRV
Ga0209488_1014123413300027903Vadose Zone SoilMERIAIGEISLEVLMAGEGPPLLFLHGGDYFQQNRQFIEELARDW
Ga0209006_1083112813300027908Forest SoilMERIQINELSLDLLTSGDGPPLLFLHGGDYFAQHR
Ga0209526_1069275023300028047Forest SoilMQRIAIGEVSLEVAIAADGAPLLFLHGGDYFAQNRAFLDGLAQ
Ga0311371_1059122543300029951PalsaMERIDIGETSIELLIAGDGPPLLFLHGIDYFAQHNAFFDLLSRR
Ga0318516_1073075123300031543SoilMAQIDIAEVSLELSLAGEGPPLLFLHGGDYFAQNQGF
Ga0318534_1046446413300031544SoilMERIQIGDVSLGVSSAGVGRPLLFLHGGDYFTQHQGFLQILARRWRV
Ga0318538_1009390233300031546SoilMERIQIADLSLQVETAGEGRPLLFLHGGDYFAQNRTFLERLAQRWQVLI
Ga0318573_1029750213300031564SoilMERIQINEVSVELVTTGDGPPLLFLHGGDYFAQHGEFFDR
Ga0318573_1080780913300031564SoilMARIGVGEVSLEISLAGEGQPLLFLHGGDHFAQNQDFLDRLARRW
Ga0318515_1068984313300031572SoilMHRTEIGDISLETLTAGDGRPLLFLHGGDYFAQHRDFFESLARRWRVM
Ga0310915_1002018073300031573SoilMARIGVGEVSLEISLAGEGQPLLFLHGGDYFAQNQ
Ga0310915_1054064423300031573SoilMAQIDIAEVSLELSLAGEGPPLLFLHGGDYFAQNQGFLERLARCWQVTIP
Ga0318555_1005946333300031640SoilMARIGVGEVSLEISLAGEGQPLLFLHGGDYFAQNQEFLDRLARRWRVLI
Ga0318572_1026649313300031681SoilMQRIQIGDVLLEMRTTGEGPPLLFLHGGDYFAQNQGFLERL
Ga0318572_1061100013300031681SoilMERIQIGDVSLELRTAGEGPPLLFLHGGDYVAQNQGFLERLARRWQVLIP
Ga0306917_1004171713300031719SoilMERIQIGEVSLEVLTAGEGPPLLFLHGGDYFLQNRG
Ga0318500_1036328623300031724SoilMHRTEIGDISLETLTAGDGRPLLFLHGGDYFAQHRDFFESLARRW
Ga0318501_1006421233300031736SoilMARIGVGEVSLEISLAGEGQPLLFLHGGDYFAQNQEF
Ga0318502_1002595613300031747SoilMARIGVGEVSLEISLAGEGQPLLFLHGGDYFAQNQEFLDRLA
Ga0318492_1005413433300031748SoilMARIDVGEVSLEISLAGEGQPLLFLHGGDYFAQNQEFLDRLARRWRVL
Ga0307475_1022232513300031754Hardwood Forest SoilMARIDVGEVSLEISLAGEGQPLLFLHGGDYFAQNQEFLDRLARRWRVLIPRHP
Ga0318537_1019339723300031763SoilMERIQIGDVSLEMLTAGAGPPLLFLHPGDYFAQHREFFDKLARHWRVVV
Ga0318535_1007554233300031764SoilMERIQIGDVSLGVSTAGVGRPLLFLHGGDYFTQHRGFLE
Ga0318535_1011940733300031764SoilMARIDVGEVSLEISLAGEGQPLLFLHGGDYFAQNQEFL
Ga0318554_1051336823300031765SoilMERIQIGDVSLELRTAGEGPPLLFLHGGDYVAQNQGFLERLARRWQVLI
Ga0318552_1067900713300031782SoilMERIQIGDVSLEMLTAGAGPPLLFLHPGDYFAQHCEFFDKLARHWRVV
Ga0318576_1000916913300031796SoilMARIGVGEVSLEISLAGEGQPLLFLHGGDYFAQNQDFLDRLARHWRVLI
Ga0318523_1001919513300031798SoilMQRIQIGDVLLEMRTTGEGPPLLFLHGGDYFAQNQGFLE
Ga0318523_1014894233300031798SoilMARIGVGEVSLEISLAGEGQPLLFLHGGDYFAQNQDF
Ga0318565_1021073813300031799SoilMQRIQIGDVLLEMRTTGEGPPLLFLHGGDYFAQNQGFL
Ga0318568_1034231333300031819SoilMHRTEIGDISLETLTAGDGRPLLFLHGGDYFAQHR
Ga0310917_1004123013300031833SoilMERIQIGEVSLEVLTAGEGPPLLFLHGDDYFLQNRGFIEKLARHWRVIVPRH
Ga0310917_1089040013300031833SoilMERIQIGDVSLELRTAGEGPPLLFLHGGDYVAQNQGFLERLARRWQVL
Ga0318517_1002342643300031835SoilMQRIQIGDVLLEMRTTGEGPPLLFLHGGDYFAQNQGFLVRLARRRQVLIPRH
Ga0318511_1001314853300031845SoilMARIGVGEVSLEISLAGEGQPLLFLHGGDYFAQNQDFLDRLA
Ga0306925_1192300913300031890SoilMARIGVGEVSLEISLAGEGQPLLFLHGGDHFAQNQD
Ga0318551_1017179033300031896SoilMARIDVGEVSLEISLAGEGQPLLFLHGGDYFAQNQEFLNRLARR
Ga0318520_1040894713300031897SoilMERIQIGAVSLEVLTAGEGPPLLFLHGGDYFLQNRD
Ga0306921_1055101533300031912SoilMGVIQIGDVRLEVSMAGTGRPLLFLHGGDYFAQNRGFLE
Ga0310912_1013928133300031941SoilMGVIQIGDVRLEVSMAGTGRPLLFLHGGDYFAQNRGFLER
Ga0310913_1049646523300031945SoilMQRIEIGQVSLEIAIAGAGRPLLFLHGGDYFVQNRAFLDKVAQRW
Ga0318531_1034178223300031981SoilMERIQIGDVSLELRTAGQGPPLLFLHAGDYFAQNRTFLEKLARRWRVLIP
Ga0318545_1032962613300032042SoilMARIGVGEVSLEISLAGEGQPLLFLHGGDYFAQNQDFLD
Ga0318506_1007803613300032052SoilMARIDISEVSLEVLLSGEGRPLLFLHGGDYFAQNR
Ga0318505_1009541813300032060SoilMARIGVGEVSLEISLAGEGQPLLFLHGGDHFAQNQDFLDRLARR
Ga0318513_1027749113300032065SoilMERIQIGDVSLELRTAGQGPPLLFLHAGDYFAQNRTFLEKLARRWRVLI
Ga0318514_1006909413300032066SoilMARIDISEVSLEVLLSGEGRPLLFLHGGDYFAQNRSFLERLARRW
Ga0318518_1038789023300032090SoilMERIQIGDVSLQMGTAGEGRPLLFLHGGDYFAQNRTFLER
Ga0318540_1017633033300032094SoilMERIQIGDVSLEVLIAGDGPPLLFLHGGDYFAQHRVCF
Ga0307472_10081347913300032205Hardwood Forest SoilMERIQINEVSLELLTAGDGPPLLFLHGGDYFAQHREFFDKLAR
Ga0318519_1070052813300033290SoilMERIQIGDVSLEVLIAGDGPPLLFLHGGDYFAQHRVFFDRLARRWRVVA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.