| Basic Information | |
|---|---|
| Family ID | F094202 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MERIQINEVSLELLTAGDGPPLLFLHGGDYFAQHREFFDRL |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.17 % |
| % of genes from short scaffolds (< 2000 bps) | 90.57 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.226 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (46.226 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.830 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.340 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.84% β-sheet: 14.49% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF00571 | CBS | 66.04 |
| PF02515 | CoA_transf_3 | 4.72 |
| PF00561 | Abhydrolase_1 | 4.72 |
| PF01019 | G_glu_transpept | 2.83 |
| PF00296 | Bac_luciferase | 1.89 |
| PF03453 | MoeA_N | 0.94 |
| PF07228 | SpoIIE | 0.94 |
| PF01315 | Ald_Xan_dh_C | 0.94 |
| PF06094 | GGACT | 0.94 |
| PF01381 | HTH_3 | 0.94 |
| PF07813 | LTXXQ | 0.94 |
| PF13733 | Glyco_transf_7N | 0.94 |
| PF07332 | Phage_holin_3_6 | 0.94 |
| PF00027 | cNMP_binding | 0.94 |
| PF00106 | adh_short | 0.94 |
| PF10067 | DUF2306 | 0.94 |
| PF03972 | MmgE_PrpD | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 4.72 |
| COG3678 | Periplasmic chaperone Spy, Spy/CpxP family | Posttranslational modification, protein turnover, chaperones [O] | 3.77 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 2.83 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.89 |
| COG0303 | Molybdopterin Mo-transferase (molybdopterin biosynthesis) | Coenzyme transport and metabolism [H] | 0.94 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.23 % |
| Unclassified | root | N/A | 3.77 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003351|JGI26346J50198_1024948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 591 | Open in IMG/M |
| 3300005175|Ga0066673_10281097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 968 | Open in IMG/M |
| 3300005187|Ga0066675_10124876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1736 | Open in IMG/M |
| 3300005332|Ga0066388_101186796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1303 | Open in IMG/M |
| 3300005363|Ga0008090_14838646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 652 | Open in IMG/M |
| 3300005557|Ga0066704_10373312 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300005560|Ga0066670_11025570 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300005610|Ga0070763_10552151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 664 | Open in IMG/M |
| 3300006175|Ga0070712_100772725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 823 | Open in IMG/M |
| 3300009038|Ga0099829_10149660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1862 | Open in IMG/M |
| 3300009090|Ga0099827_10864178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 783 | Open in IMG/M |
| 3300009143|Ga0099792_10304080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 948 | Open in IMG/M |
| 3300010047|Ga0126382_10220281 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1366 | Open in IMG/M |
| 3300010048|Ga0126373_10350767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1487 | Open in IMG/M |
| 3300010359|Ga0126376_11541369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 695 | Open in IMG/M |
| 3300010360|Ga0126372_10422597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1225 | Open in IMG/M |
| 3300010376|Ga0126381_102302266 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300010398|Ga0126383_13372473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300012207|Ga0137381_11287847 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300012208|Ga0137376_11762270 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300012363|Ga0137390_11403242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 642 | Open in IMG/M |
| 3300016270|Ga0182036_10612768 | Not Available | 874 | Open in IMG/M |
| 3300016294|Ga0182041_10161302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1743 | Open in IMG/M |
| 3300016294|Ga0182041_10198598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1595 | Open in IMG/M |
| 3300016341|Ga0182035_10508278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1030 | Open in IMG/M |
| 3300016357|Ga0182032_10047180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2769 | Open in IMG/M |
| 3300016371|Ga0182034_10377295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1158 | Open in IMG/M |
| 3300016371|Ga0182034_10979821 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300016422|Ga0182039_11953849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 539 | Open in IMG/M |
| 3300016445|Ga0182038_10553277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 988 | Open in IMG/M |
| 3300016445|Ga0182038_11598254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300016445|Ga0182038_11674774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 573 | Open in IMG/M |
| 3300017972|Ga0187781_10825343 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 674 | Open in IMG/M |
| 3300018060|Ga0187765_10459767 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300018085|Ga0187772_11140748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 573 | Open in IMG/M |
| 3300018482|Ga0066669_11457511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 621 | Open in IMG/M |
| 3300021168|Ga0210406_11006590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 620 | Open in IMG/M |
| 3300021170|Ga0210400_11020247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 672 | Open in IMG/M |
| 3300021178|Ga0210408_10255945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1394 | Open in IMG/M |
| 3300021178|Ga0210408_10410176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1079 | Open in IMG/M |
| 3300021358|Ga0213873_10085270 | Not Available | 890 | Open in IMG/M |
| 3300021361|Ga0213872_10415471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 544 | Open in IMG/M |
| 3300022712|Ga0242653_1060791 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 632 | Open in IMG/M |
| 3300025906|Ga0207699_10247065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1228 | Open in IMG/M |
| 3300025928|Ga0207700_10439532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1148 | Open in IMG/M |
| 3300025929|Ga0207664_10380158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1254 | Open in IMG/M |
| 3300026316|Ga0209155_1130140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 864 | Open in IMG/M |
| 3300026490|Ga0257153_1115208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 529 | Open in IMG/M |
| 3300026527|Ga0209059_1316012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 529 | Open in IMG/M |
| 3300027069|Ga0208859_1003829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1571 | Open in IMG/M |
| 3300027603|Ga0209331_1149816 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 553 | Open in IMG/M |
| 3300027651|Ga0209217_1109020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 786 | Open in IMG/M |
| 3300027783|Ga0209448_10257796 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300027882|Ga0209590_11042872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300027903|Ga0209488_10141234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1817 | Open in IMG/M |
| 3300027908|Ga0209006_10831128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 746 | Open in IMG/M |
| 3300028047|Ga0209526_10692750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 642 | Open in IMG/M |
| 3300029951|Ga0311371_10591225 | All Organisms → cellular organisms → Bacteria | 1430 | Open in IMG/M |
| 3300031543|Ga0318516_10730751 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 561 | Open in IMG/M |
| 3300031544|Ga0318534_10464464 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300031546|Ga0318538_10093902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1540 | Open in IMG/M |
| 3300031564|Ga0318573_10297502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 864 | Open in IMG/M |
| 3300031564|Ga0318573_10807809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300031572|Ga0318515_10689843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300031573|Ga0310915_10020180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4041 | Open in IMG/M |
| 3300031573|Ga0310915_10540644 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300031640|Ga0318555_10059463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1957 | Open in IMG/M |
| 3300031681|Ga0318572_10266493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1009 | Open in IMG/M |
| 3300031681|Ga0318572_10611000 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300031719|Ga0306917_10041717 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3033 | Open in IMG/M |
| 3300031724|Ga0318500_10363286 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300031736|Ga0318501_10064212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1757 | Open in IMG/M |
| 3300031747|Ga0318502_10025956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2902 | Open in IMG/M |
| 3300031748|Ga0318492_10054134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1882 | Open in IMG/M |
| 3300031754|Ga0307475_10222325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1511 | Open in IMG/M |
| 3300031763|Ga0318537_10193397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 757 | Open in IMG/M |
| 3300031764|Ga0318535_10075542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1447 | Open in IMG/M |
| 3300031764|Ga0318535_10119407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1164 | Open in IMG/M |
| 3300031765|Ga0318554_10513368 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300031782|Ga0318552_10679007 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300031796|Ga0318576_10009169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3580 | Open in IMG/M |
| 3300031798|Ga0318523_10019195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2949 | Open in IMG/M |
| 3300031798|Ga0318523_10148942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1163 | Open in IMG/M |
| 3300031799|Ga0318565_10210738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 945 | Open in IMG/M |
| 3300031819|Ga0318568_10342313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 930 | Open in IMG/M |
| 3300031833|Ga0310917_10041230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2788 | Open in IMG/M |
| 3300031833|Ga0310917_10890400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300031835|Ga0318517_10023426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2408 | Open in IMG/M |
| 3300031845|Ga0318511_10013148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2863 | Open in IMG/M |
| 3300031890|Ga0306925_11923009 | Not Available | 561 | Open in IMG/M |
| 3300031896|Ga0318551_10171790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1191 | Open in IMG/M |
| 3300031897|Ga0318520_10408947 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300031912|Ga0306921_10551015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1337 | Open in IMG/M |
| 3300031941|Ga0310912_10139281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1822 | Open in IMG/M |
| 3300031945|Ga0310913_10496465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 867 | Open in IMG/M |
| 3300031981|Ga0318531_10341782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 676 | Open in IMG/M |
| 3300032042|Ga0318545_10329626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 549 | Open in IMG/M |
| 3300032052|Ga0318506_10078036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1385 | Open in IMG/M |
| 3300032060|Ga0318505_10095418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1340 | Open in IMG/M |
| 3300032065|Ga0318513_10277491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 813 | Open in IMG/M |
| 3300032066|Ga0318514_10069094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1744 | Open in IMG/M |
| 3300032090|Ga0318518_10387890 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300032094|Ga0318540_10176330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1028 | Open in IMG/M |
| 3300032205|Ga0307472_100813479 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 855 | Open in IMG/M |
| 3300033290|Ga0318519_10700528 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 46.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.21% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.66% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.77% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.83% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.94% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.94% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003351 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
| 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
| 3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300027069 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF002 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI26346J50198_10249481 | 3300003351 | Bog Forest Soil | MTRIVVGEVSLEISLAGEGPPLLFLHGGDYFAQNQDFLDKLARRWRVLIPRH |
| Ga0066673_102810973 | 3300005175 | Soil | MERIQIGEVSIELLTAGDGPPLLFLHGGDYFAQHQEFFDRLARHWR |
| Ga0066675_101248763 | 3300005187 | Soil | MERIQINEVSLELLTAGDGPPLLFLHGGDYFAQHREFFDRL |
| Ga0066388_1011867961 | 3300005332 | Tropical Forest Soil | MQRIEIGQVSLEIAIAGAGRPLLFLHGGDYFVQNRVFLDRLA |
| Ga0008090_148386461 | 3300005363 | Tropical Rainforest Soil | MERIEVGGYSLEVRSVGEGPPLLFLHGGDYFAQHRDFFETLARR |
| Ga0066704_103733121 | 3300005557 | Soil | MERIQINELSFEVLTAGDGPPLLFLHGGDYFAQHREFFDR |
| Ga0066670_110255701 | 3300005560 | Soil | MERIQINEVSLDLLTAGDGPLLLFLHGGDYFAQHQEFFEKLA |
| Ga0070763_105521512 | 3300005610 | Soil | MERMRINEISLELLTAGDGPPLLFLHGGDYFAQHREFFDRLARHWR |
| Ga0070712_1007727251 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MERAEIGEISLEVLTAGEDRTLLFLHGGDYFAQHREFFERLARRWR |
| Ga0099829_101496603 | 3300009038 | Vadose Zone Soil | MQRIDIGEVSLEASIAGDGRPLLFLHGGDYFAQNRAFL |
| Ga0099827_108641782 | 3300009090 | Vadose Zone Soil | MQRIDIGEVSLEASIAGDGRPLLFLHGGDYFVQNRAFLDRMAQRRRVFA |
| Ga0099792_103040801 | 3300009143 | Vadose Zone Soil | MERIAIGEISLEVLMAGEGPPLLFLHGGDYFLQNRQFIEELA |
| Ga0126382_102202813 | 3300010047 | Tropical Forest Soil | MERIQIGNVSLDVSIAGDGPPLLFLHGGDYFVQHREFFDRLARQ |
| Ga0126373_103507673 | 3300010048 | Tropical Forest Soil | MARIDIAEVSLEVSLAGEGPPLLFLHGGDYFAQNQGFLE |
| Ga0126376_115413691 | 3300010359 | Tropical Forest Soil | MERIQIGNVSLDVSLAGDGPQLLFLHGGDYFVQHREFFDR |
| Ga0126372_104225974 | 3300010360 | Tropical Forest Soil | MERIEVGGVSLEVTSVGEGPPLLFLHGGDYFAQHRD |
| Ga0126381_1023022661 | 3300010376 | Tropical Forest Soil | MGVIQIGDVRLEVSTAGTGRPLLFLHGGDYFAQNRGFFERLARHWRVLIP |
| Ga0126383_133724732 | 3300010398 | Tropical Forest Soil | MQRIVIGGVTLEGSVAGEGPPLLFLHGGDYFQQNRVFLDK |
| Ga0137381_112878471 | 3300012207 | Vadose Zone Soil | MERIQIGDVSLEMLMAGAGPPLLFLHGGDYFAQHRE |
| Ga0137376_117622701 | 3300012208 | Vadose Zone Soil | MERIQIGDVSLEMLTVGHGEPLLFLHGGDYFGQHREFFDRLARQFR |
| Ga0137390_114032421 | 3300012363 | Vadose Zone Soil | MQRIDIGEVSLEASIAGDGRPLLFLHGGDYFVQNRAFLDRMAQ |
| Ga0182036_106127682 | 3300016270 | Soil | MGDVSLEMRTTGEGPPLLFLHGGDYFTQNQGFLERLAQRWRVVIPRH |
| Ga0182041_101613021 | 3300016294 | Soil | MERIQIADLSLQVGTAGEGRPLLFLHGGDYFAQNRTFLERLA |
| Ga0182041_101985981 | 3300016294 | Soil | MERINIAGVSLEMLTAGDGPPLLFLHGGDYFAQHRDFFGKLARRWR |
| Ga0182035_105082783 | 3300016341 | Soil | MERIQIGDVSLEMRTAGEGPPLLFLHGGDYFAQNQGLLERLARRWQVLIP |
| Ga0182032_100471801 | 3300016357 | Soil | MARIGVGEVSLEISLAGEGQPLLFLHGGDHFAQNQDF |
| Ga0182034_103772953 | 3300016371 | Soil | MERIQIADLSLQVETAGEGRPLLFLHGGDYFAQNRGFLDR |
| Ga0182034_109798212 | 3300016371 | Soil | MARIDVGEVSLEISLAGEGQPLLFLHGGDYFAQNQEFLDRLARR |
| Ga0182039_119538491 | 3300016422 | Soil | MARIGVGEVSLEISLAGEGQPLLFLHGGDYFAQNQDFLDRLARHW |
| Ga0182038_105532771 | 3300016445 | Soil | MARIGVGEVSLEISLAGEGQPLLFLHGGDYFAQNQDFLDRLAR |
| Ga0182038_115982542 | 3300016445 | Soil | MGDVSLEMRTAGEGPPLLFLHGGDYFTQTRAFLERLAQRWRVMIP |
| Ga0182038_116747742 | 3300016445 | Soil | MERIQIGDVSLKMRTAGEGPPLLFLHGGDYVAQNQGFLAT |
| Ga0187781_108253432 | 3300017972 | Tropical Peatland | MTRIAIGQVSLEGFTAGDGPPLLFLHGGDYVRQNRAFLDRLAG |
| Ga0187765_104597671 | 3300018060 | Tropical Peatland | MERIQIGDVALEVRTSGEGKPMLFLHGGDYFAQNRAFLD |
| Ga0187772_111407481 | 3300018085 | Tropical Peatland | MQRIEIGQVSLEIAIAGDGRPLLFLHGGDYFAQNRAFLDKLAQRLRVL |
| Ga0066669_114575112 | 3300018482 | Grasslands Soil | MERTQINEPTFKVLTAGDGPPPLFLHGGDYIAEHPAFFDRLPRH |
| Ga0210399_106386033 | 3300020581 | Soil | MERIDIGEISLEAHIAGSGPPLLFLHGLDYFAQHRHFLDR |
| Ga0210406_110065902 | 3300021168 | Soil | MARVDIAEVSLDLSLAGEGPPLLFLHGGDYFAQNRGFLE |
| Ga0210400_110202471 | 3300021170 | Soil | MQRIAIGEVSLEVAIAGDGAPLLFLHGGDYLAQNRAFLERLAG |
| Ga0210408_102559453 | 3300021178 | Soil | MERIQINELSLDLLTAGDGPPLLFLHGGDYFAQHQEFFDRLARHWRIV |
| Ga0210408_104101761 | 3300021178 | Soil | MERIAIGEISLEVLMAGEGPPLLFLHGGDYFLQNRQFIEELARH |
| Ga0213873_100852702 | 3300021358 | Rhizosphere | MQRIDIGGVPLEIAIAGAGRPLLFLHAGDFFAQNQ |
| Ga0213872_104154712 | 3300021361 | Rhizosphere | MERIEIGGISLEASIIGEGPPLLFLHGGDYFAQHRGFFDLVARRWRV |
| Ga0242653_10607911 | 3300022712 | Soil | MERIQINEVSLELLTAGGGPPLLFLHGGDYFAQHREFFDKLARHW |
| Ga0207699_102470651 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MERIKVGEVSLEALTAGDGPSLLFLHGGDYFAQHRGFFDRLAQQFRVFAPR |
| Ga0207700_104395323 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MERIKVGEVSLEALTAGDGPSLLFLHGGDYFAQHRGLFDRL |
| Ga0207664_103801581 | 3300025929 | Agricultural Soil | MERIQINELSLDLLTAGDGPPLLFLHAGDYFEEHREF |
| Ga0209155_11301402 | 3300026316 | Soil | MERIQIGEVSIELLTAGDGPPLLFLHGGDYFAQHQEFFDRLARHWRVIVP |
| Ga0257153_11152082 | 3300026490 | Soil | MGRIQINELSLDLLTAGDGPPLLFLHGGDYFAQHREFFDR |
| Ga0209059_13160121 | 3300026527 | Soil | MERIQIGDVSLEMLTAGAGPPLLLLHGEDYFAQHQEFFDRLARRWRVVVPRH |
| Ga0208859_10038291 | 3300027069 | Forest Soil | MERIQINTLSLDLLTAGDGPPLLFLHGGEYFAQHREFFDRLARHWRVVVPRHP |
| Ga0209331_11498162 | 3300027603 | Forest Soil | MERIQINELSLDLLTAGDGAPLLFLHGGDYFAQHREFFDRLARHWRVVV |
| Ga0209217_11090201 | 3300027651 | Forest Soil | MERIQINELSLDLVTAGDGPPLLFLHGGDYFAQHREFFDRLARHWRV |
| Ga0209448_102577962 | 3300027783 | Bog Forest Soil | MGSMDPQRGTEMERIQINEVSLELLTAGDGPPLLFLHGGDNFAQHREFFDKLARR |
| Ga0209590_110428722 | 3300027882 | Vadose Zone Soil | MQRIDIGEVSLEASIAGDGRPLLFLHGGDYFVQNRAFLDRMAQRRRV |
| Ga0209488_101412341 | 3300027903 | Vadose Zone Soil | MERIAIGEISLEVLMAGEGPPLLFLHGGDYFQQNRQFIEELARDW |
| Ga0209006_108311281 | 3300027908 | Forest Soil | MERIQINELSLDLLTSGDGPPLLFLHGGDYFAQHR |
| Ga0209526_106927502 | 3300028047 | Forest Soil | MQRIAIGEVSLEVAIAADGAPLLFLHGGDYFAQNRAFLDGLAQ |
| Ga0311371_105912254 | 3300029951 | Palsa | MERIDIGETSIELLIAGDGPPLLFLHGIDYFAQHNAFFDLLSRR |
| Ga0318516_107307512 | 3300031543 | Soil | MAQIDIAEVSLELSLAGEGPPLLFLHGGDYFAQNQGF |
| Ga0318534_104644641 | 3300031544 | Soil | MERIQIGDVSLGVSSAGVGRPLLFLHGGDYFTQHQGFLQILARRWRV |
| Ga0318538_100939023 | 3300031546 | Soil | MERIQIADLSLQVETAGEGRPLLFLHGGDYFAQNRTFLERLAQRWQVLI |
| Ga0318573_102975021 | 3300031564 | Soil | MERIQINEVSVELVTTGDGPPLLFLHGGDYFAQHGEFFDR |
| Ga0318573_108078091 | 3300031564 | Soil | MARIGVGEVSLEISLAGEGQPLLFLHGGDHFAQNQDFLDRLARRW |
| Ga0318515_106898431 | 3300031572 | Soil | MHRTEIGDISLETLTAGDGRPLLFLHGGDYFAQHRDFFESLARRWRVM |
| Ga0310915_100201807 | 3300031573 | Soil | MARIGVGEVSLEISLAGEGQPLLFLHGGDYFAQNQ |
| Ga0310915_105406442 | 3300031573 | Soil | MAQIDIAEVSLELSLAGEGPPLLFLHGGDYFAQNQGFLERLARCWQVTIP |
| Ga0318555_100594633 | 3300031640 | Soil | MARIGVGEVSLEISLAGEGQPLLFLHGGDYFAQNQEFLDRLARRWRVLI |
| Ga0318572_102664931 | 3300031681 | Soil | MQRIQIGDVLLEMRTTGEGPPLLFLHGGDYFAQNQGFLERL |
| Ga0318572_106110001 | 3300031681 | Soil | MERIQIGDVSLELRTAGEGPPLLFLHGGDYVAQNQGFLERLARRWQVLIP |
| Ga0306917_100417171 | 3300031719 | Soil | MERIQIGEVSLEVLTAGEGPPLLFLHGGDYFLQNRG |
| Ga0318500_103632862 | 3300031724 | Soil | MHRTEIGDISLETLTAGDGRPLLFLHGGDYFAQHRDFFESLARRW |
| Ga0318501_100642123 | 3300031736 | Soil | MARIGVGEVSLEISLAGEGQPLLFLHGGDYFAQNQEF |
| Ga0318502_100259561 | 3300031747 | Soil | MARIGVGEVSLEISLAGEGQPLLFLHGGDYFAQNQEFLDRLA |
| Ga0318492_100541343 | 3300031748 | Soil | MARIDVGEVSLEISLAGEGQPLLFLHGGDYFAQNQEFLDRLARRWRVL |
| Ga0307475_102223251 | 3300031754 | Hardwood Forest Soil | MARIDVGEVSLEISLAGEGQPLLFLHGGDYFAQNQEFLDRLARRWRVLIPRHP |
| Ga0318537_101933972 | 3300031763 | Soil | MERIQIGDVSLEMLTAGAGPPLLFLHPGDYFAQHREFFDKLARHWRVVV |
| Ga0318535_100755423 | 3300031764 | Soil | MERIQIGDVSLGVSTAGVGRPLLFLHGGDYFTQHRGFLE |
| Ga0318535_101194073 | 3300031764 | Soil | MARIDVGEVSLEISLAGEGQPLLFLHGGDYFAQNQEFL |
| Ga0318554_105133682 | 3300031765 | Soil | MERIQIGDVSLELRTAGEGPPLLFLHGGDYVAQNQGFLERLARRWQVLI |
| Ga0318552_106790071 | 3300031782 | Soil | MERIQIGDVSLEMLTAGAGPPLLFLHPGDYFAQHCEFFDKLARHWRVV |
| Ga0318576_100091691 | 3300031796 | Soil | MARIGVGEVSLEISLAGEGQPLLFLHGGDYFAQNQDFLDRLARHWRVLI |
| Ga0318523_100191951 | 3300031798 | Soil | MQRIQIGDVLLEMRTTGEGPPLLFLHGGDYFAQNQGFLE |
| Ga0318523_101489423 | 3300031798 | Soil | MARIGVGEVSLEISLAGEGQPLLFLHGGDYFAQNQDF |
| Ga0318565_102107381 | 3300031799 | Soil | MQRIQIGDVLLEMRTTGEGPPLLFLHGGDYFAQNQGFL |
| Ga0318568_103423133 | 3300031819 | Soil | MHRTEIGDISLETLTAGDGRPLLFLHGGDYFAQHR |
| Ga0310917_100412301 | 3300031833 | Soil | MERIQIGEVSLEVLTAGEGPPLLFLHGDDYFLQNRGFIEKLARHWRVIVPRH |
| Ga0310917_108904001 | 3300031833 | Soil | MERIQIGDVSLELRTAGEGPPLLFLHGGDYVAQNQGFLERLARRWQVL |
| Ga0318517_100234264 | 3300031835 | Soil | MQRIQIGDVLLEMRTTGEGPPLLFLHGGDYFAQNQGFLVRLARRRQVLIPRH |
| Ga0318511_100131485 | 3300031845 | Soil | MARIGVGEVSLEISLAGEGQPLLFLHGGDYFAQNQDFLDRLA |
| Ga0306925_119230091 | 3300031890 | Soil | MARIGVGEVSLEISLAGEGQPLLFLHGGDHFAQNQD |
| Ga0318551_101717903 | 3300031896 | Soil | MARIDVGEVSLEISLAGEGQPLLFLHGGDYFAQNQEFLNRLARR |
| Ga0318520_104089471 | 3300031897 | Soil | MERIQIGAVSLEVLTAGEGPPLLFLHGGDYFLQNRD |
| Ga0306921_105510153 | 3300031912 | Soil | MGVIQIGDVRLEVSMAGTGRPLLFLHGGDYFAQNRGFLE |
| Ga0310912_101392813 | 3300031941 | Soil | MGVIQIGDVRLEVSMAGTGRPLLFLHGGDYFAQNRGFLER |
| Ga0310913_104964652 | 3300031945 | Soil | MQRIEIGQVSLEIAIAGAGRPLLFLHGGDYFVQNRAFLDKVAQRW |
| Ga0318531_103417822 | 3300031981 | Soil | MERIQIGDVSLELRTAGQGPPLLFLHAGDYFAQNRTFLEKLARRWRVLIP |
| Ga0318545_103296261 | 3300032042 | Soil | MARIGVGEVSLEISLAGEGQPLLFLHGGDYFAQNQDFLD |
| Ga0318506_100780361 | 3300032052 | Soil | MARIDISEVSLEVLLSGEGRPLLFLHGGDYFAQNR |
| Ga0318505_100954181 | 3300032060 | Soil | MARIGVGEVSLEISLAGEGQPLLFLHGGDHFAQNQDFLDRLARR |
| Ga0318513_102774911 | 3300032065 | Soil | MERIQIGDVSLELRTAGQGPPLLFLHAGDYFAQNRTFLEKLARRWRVLI |
| Ga0318514_100690941 | 3300032066 | Soil | MARIDISEVSLEVLLSGEGRPLLFLHGGDYFAQNRSFLERLARRW |
| Ga0318518_103878902 | 3300032090 | Soil | MERIQIGDVSLQMGTAGEGRPLLFLHGGDYFAQNRTFLER |
| Ga0318540_101763303 | 3300032094 | Soil | MERIQIGDVSLEVLIAGDGPPLLFLHGGDYFAQHRVCF |
| Ga0307472_1008134791 | 3300032205 | Hardwood Forest Soil | MERIQINEVSLELLTAGDGPPLLFLHGGDYFAQHREFFDKLAR |
| Ga0318519_107005281 | 3300033290 | Soil | MERIQIGDVSLEVLIAGDGPPLLFLHGGDYFAQHRVFFDRLARRWRVVA |
| ⦗Top⦘ |