| Basic Information | |
|---|---|
| Family ID | F094189 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 42 residues |
| Representative Sequence | TVPAEIDLKGKHARVADGQKCPRCGSSLEVAVVVHIPEAA |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 33.33 % |
| % of genes near scaffold ends (potentially truncated) | 0.94 % |
| % of genes from short scaffolds (< 2000 bps) | 0.94 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (97.170 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (16.981 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.698 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.170 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 5.88% Coil/Unstructured: 94.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF00005 | ABC_tran | 7.55 |
| PF11950 | DUF3467 | 5.66 |
| PF02423 | OCD_Mu_crystall | 5.66 |
| PF12848 | ABC_tran_Xtn | 2.83 |
| PF13545 | HTH_Crp_2 | 0.94 |
| PF13180 | PDZ_2 | 0.94 |
| PF03544 | TonB_C | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 5.66 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 97.17 % |
| All Organisms | root | All Organisms | 2.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300011120|Ga0150983_10835262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter | 561 | Open in IMG/M |
| 3300014199|Ga0181535_10060690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2556 | Open in IMG/M |
| 3300014492|Ga0182013_10073713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2429 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.55% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.72% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.72% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.77% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.83% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.83% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 2.83% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.83% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.89% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.89% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.89% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.89% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.89% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.89% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.94% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 0.94% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.94% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.94% |
| Wetland | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland | 0.94% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.94% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.94% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.94% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.94% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.94% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.94% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005650 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_055 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006949 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B | Environmental | Open in IMG/M |
| 3300009175 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009587 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011340 | Combined Assembly of Wetland Metatranscriptomes | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012398 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300019187 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019189 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019256 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019270 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300022511 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022711 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022720 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
| 3300025548 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025650 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes) | Environmental | Open in IMG/M |
| 3300025829 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300030937 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031590 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031866 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033826 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 1-5 | Environmental | Open in IMG/M |
| 3300034065 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5 | Environmental | Open in IMG/M |
| 3300034653 | Metatranscriptome of peat soil microbial communities from wetland fen in Alaska, United States - Frozen_pond_03R_16 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1058037042 | 3300000364 | Soil | MCTHTVPAQIDLKGKHARVAAGQKCPRCGSSLEVAVVIHIPEAA* |
| JGI1027J12803_1056588931 | 3300000955 | Soil | VPAEIDLKGKVPRVAKGQKCPRCGSSLEVAVVVQVPEAA* |
| JGI26339J46600_100649971 | 3300003218 | Bog Forest Soil | ICTRTVPADIDLRGKYARVEQGQRCPRCGSSLDVAAVVQIPEAA* |
| Ga0070674_1005429871 | 3300005356 | Miscanthus Rhizosphere | MAHCPMCTHTVPTEVDLRGKYARVAAGQKCSRCGSSLEVAVVIHV |
| Ga0070673_1002949561 | 3300005364 | Switchgrass Rhizosphere | THTVPAEVDLKGKYARVAAGQKCPRCGSSLEVAVVIHVPEAA* |
| Ga0070665_1010141381 | 3300005548 | Switchgrass Rhizosphere | PICTHTVPADIDIKGKIPRVTKGSKCPRCGSSLEVAVVVQVPEAA* |
| Ga0066700_109633523 | 3300005559 | Soil | HTVPADIDLKGKFPRVAAGQKCSRCGSSLDVAAVIQIPEAA* |
| Ga0068857_1014908273 | 3300005577 | Corn Rhizosphere | PMCTHTVPAQIDLKGKHARVAAGQKCPRCGSSLEVAVVIHIPEAA* |
| Ga0068859_1021590681 | 3300005617 | Switchgrass Rhizosphere | AEIDLKGKHARVAAGQKCPRCGSSLEVAVVIHIPEAA* |
| Ga0068864_1015391761 | 3300005618 | Switchgrass Rhizosphere | VPADIDIKGKIPRVARGAICPRCGSSLEVAVVVQVPEAA* |
| Ga0075038_111709231 | 3300005650 | Permafrost Soil | TVPADIDLKGKRPRVAAGQKCVRCGSSLDVAAVIQIPEAA* |
| Ga0075038_114344432 | 3300005650 | Permafrost Soil | MCTHTVAAEIDLKGKRARVAAGQKCSRCGSSLEVAVVIQIPEAA* |
| Ga0070717_100719575 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | IDLKGKFPRVEPGQKCARCGSSLDVAIVIQIPEAA* |
| Ga0070712_1018610933 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | PAEIDLKGKHARVAAGQKCPRCGSSLEVAVVIHIPEAA* |
| Ga0068865_1007279773 | 3300006881 | Miscanthus Rhizosphere | VDLRGKYARVAAGQKCPRCGSSLEVAVVIHVPEAA* |
| Ga0075528_102028851 | 3300006949 | Arctic Peat Soil | THTVQAQIDLKGKYARVAAGQKCARCGSSLEVAVVIQIPEAA* |
| Ga0073936_103312691 | 3300009175 | Freshwater Lake Hypolimnion | THTVPAEVDVKGKKPHVIKGSKCPRCGSSLEVAVVVQVPEAA* |
| Ga0105242_124549783 | 3300009176 | Miscanthus Rhizosphere | VPADIDIKGKIPRVARGAKCPRCGSSLEVAVVVQVPEAA* |
| Ga0116214_14016112 | 3300009520 | Peatlands Soil | DIDLRGKYPRVTAGQKCPRCRSSLDVAVVVQIPEAA* |
| Ga0115602_12323281 | 3300009587 | Wetland | CPICTHTVPAEVDLRGKRPRVAPGQRCPRCASSLDVAVIVQLPEAA* |
| Ga0116121_11507621 | 3300009644 | Peatland | HCPICTHTVPADIDLRGKYPRVTSGQKCPRCGSALDVAAVVQIPEAA* |
| Ga0126372_111076863 | 3300010360 | Tropical Forest Soil | ICTHTVPAEIDLKGKVPRVAKGQKCPRCGSSLEVAVVVQVPEAA* |
| Ga0136449_1010750451 | 3300010379 | Peatlands Soil | DLKGRYARVASGQRCPRCSSSLDVAVVVQIPEAA* |
| Ga0126344_10938921 | 3300010866 | Boreal Forest Soil | EVDIKGRIKIARVSPGQRCPRCGASLDVAVVVEIPQAA* |
| Ga0150983_108352622 | 3300011120 | Forest Soil | AHCPICTHTVPAEIDLKGKYPRVASGQKCQRCGSSLEVAVVVQIPEAA* |
| Ga0150983_112919901 | 3300011120 | Forest Soil | ICTHNVPADIDLKGKFARVTPGQRCPRCKSSLDVAVVIQIPEAA* |
| Ga0126317_103012701 | 3300011332 | Soil | HCPMCTHTVPAEVDLRGKYARVAAGQKCPRCGSSLEVAVVIHVPEAA* |
| Ga0151652_135357862 | 3300011340 | Wetland | MCTHTVPADVDLRGKYARVAAGQKCPRCGSSLEVAVVIHVPEAA* |
| Ga0137379_112884871 | 3300012209 | Vadose Zone Soil | TVPAEIDFAGKKVRVAAGQKCPRCGSSLEVAVVVQIPEAA* |
| Ga0134051_12645731 | 3300012398 | Grasslands Soil | PICTHTVPAEIDLKRKYPKVEPGQRCPRCSSSLDVAVVIQIPEAA* |
| Ga0150984_1084335201 | 3300012469 | Avena Fatua Rhizosphere | DIDLRGKYPRVEAGQKCPRCGSALDVAAVIQIPEAA* |
| Ga0150984_1110813403 | 3300012469 | Avena Fatua Rhizosphere | HTVPADLDLKRKFPRVEPGQRCPRCSSSLDVAVVIQIPEAA* |
| Ga0157369_105868071 | 3300013105 | Corn Rhizosphere | DLKGKHARVAAGQKCPRCGSSLEVAVVIHIPEAA* |
| Ga0163162_102660843 | 3300013306 | Switchgrass Rhizosphere | MCTHTVPAEVDLKGKYARVAAGQKCPRCGSSLEVAVVIHVPEAA* |
| Ga0181539_12988412 | 3300014151 | Bog | MCTHTVPAEIEVKGKLARTAPGQTCARCGSSLDVAVVVQIPEAA* |
| Ga0181535_100606903 | 3300014199 | Bog | MCTHTVPADVDVKGKAVRTAPGQDCPRCGSSLDVAVVVQFQEAA* |
| Ga0181535_102884161 | 3300014199 | Bog | HCPICTHTVPAEIDLRGKYPRVMSGQKCPRCGSALDVAAVVQIPEAA* |
| Ga0182013_100737132 | 3300014492 | Bog | MCTHTVPAEIDVKAKYVRTAPGQNCPRCGSSLDVAVVVQIPEAT* |
| Ga0182013_102998501 | 3300014492 | Bog | DIDLRGKYPRVTSGQKCPRCRSALDVAAVVQIPEAA* |
| Ga0182019_105196751 | 3300014498 | Fen | PICTHTVPAEIDLKGRYARVAPGQRCPRCSSSLDVAVVVQIPEAA* |
| Ga0182030_104687503 | 3300014838 | Bog | MCTHTVPADVDVKGKFVRTAPGQTCPRCGSSLDVAVVVQIPEAA* |
| Ga0157376_120489001 | 3300014969 | Miscanthus Rhizosphere | ADIDLTGSRPRVTKGSKCPRCGSSLEVAVVVQVPEAA* |
| Ga0157376_124858601 | 3300014969 | Miscanthus Rhizosphere | HTVPADLDLKRKYPRVEPGQRCPRCSSSLDVAVVIQIPEAA* |
| Ga0132256_1016957911 | 3300015372 | Arabidopsis Rhizosphere | MCTHTVPAEIDLKGKHARVAAGQKCPRCGSSLEVAVVIHIPE |
| Ga0187854_103165323 | 3300017938 | Peatland | KGRYARVAPGQRCPRCSSSLDVAVVVQIPEAAQPGTYQH |
| Ga0187865_12320581 | 3300018004 | Peatland | IDLKGRYARVAPGQRCPRCSSSLDVAVVVQIPEAA |
| Ga0187871_106666383 | 3300018042 | Peatland | ADIDLRGKYPRVTSGQKCPRCGSALDVAAVVQIPEAA |
| Ga0184584_1439601 | 3300019187 | Soil | ALCPICTHTVPAEVDLKGKLKFARVSPGQRCPRCGASLDVAVVIEVPQAA |
| Ga0184585_1002631 | 3300019189 | Soil | EVDLKGKARIARVSPGQRCPRCGASLDVAVVVEIPQAA |
| Ga0181508_14203491 | 3300019256 | Peatland | TVPAEIDLRGKYPRVLTGQKCPRCGSALDVAAVVQIPEAA |
| Ga0181512_15918512 | 3300019270 | Peatland | CPICTHTVPAEVELKGKFKVARVSPGQRCTRCGSSLDVAVVVEIPQAA |
| Ga0187798_18438281 | 3300019275 | Peatland | PAEIDLRGKYPKVSTGQTYPRCHSPLYVAAVIQIQEAA |
| Ga0187800_10222403 | 3300019278 | Peatland | THTVPADIDLRGKYPRVSTGQKCPRCGSALDVAAVVQIPEAA |
| Ga0206353_113938732 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MCTHTVPAQIDLKGKHARVAAGQKCPRCGSSLEVAVVIHIPEAA |
| Ga0210407_105739143 | 3300020579 | Soil | ICTHTVPADIDLKGKNPRVATGQRCTRCGASLDVAVIVQVPEAA |
| Ga0210401_108303481 | 3300020583 | Soil | PLCTHNVPADIDLRGKYARVEQGQRCPRCNSSLDVAVVIQIPEAA |
| Ga0187846_100096294 | 3300021476 | Biofilm | MGQVHCPICTHTVPAEIDLRGKRPLVVAGQKCMRCGSSLDVAVVVQIPEAA |
| Ga0242651_10379872 | 3300022511 | Soil | VTASVDWKNKMKAARVTAGQRCPRCGSSLDVAVVVQLPQAA |
| Ga0242669_11216992 | 3300022528 | Soil | HCPICTHTVPAEIDLRGKYPRVTSGQKCPRCGSPLDVAAVVQIPEAA |
| Ga0242658_10661813 | 3300022530 | Soil | CTHNVEAEIDLKGKYPRVVPGQRCARCRSSLDVAVVFQYSQAA |
| Ga0242660_11355623 | 3300022531 | Soil | CPICTHTVPAEIDFKGKFPRVARGQKCARCGSSLEVAVVVQVPEAA |
| Ga0242660_11565761 | 3300022531 | Soil | THNVPADIELKGKFARVAPGQRCPRCKSSLDVAVVIQIPQAA |
| Ga0242660_12337603 | 3300022531 | Soil | HTVPAEIDLKVKHARVAAGQKCPRCGSSLEVAVVIHILEAA |
| Ga0242655_101170031 | 3300022532 | Soil | PICTHTVTAEIDLRGKYPRVASGQKCPRCGSALDVAAVIQIPEAA |
| Ga0242655_101858451 | 3300022532 | Soil | HCPICTHNVLADIELKGKYPRVAAGQKCPRCGSSLDVAVVVQFSEAA |
| Ga0242674_10474142 | 3300022711 | Soil | LCPICTHTVPAEVDLKGKLKFARVSPGQRCPRCGASLDVAVVIEVPQAA |
| Ga0242672_11162441 | 3300022720 | Soil | PICTHTVAAEIDLRGKFPRVMNGQKCPRCGSALDVAAVVQIPEAA |
| Ga0242672_11475341 | 3300022720 | Soil | ELDLRGKFPRVAEGQKCSRCGSSLDVAAVVQIPEAA |
| Ga0242654_103728491 | 3300022726 | Soil | ADIELKGKYPRVAAGQKCPRCGSSLDVAVVVQFSEAA |
| Ga0224557_12905843 | 3300023101 | Soil | IYLKGRRARVAPGQRCPRCSSSLDVAVVVQIPEAA |
| Ga0208716_10357483 | 3300025548 | Arctic Peat Soil | PMCTHTVPAEIDLKGKYARTAPGQTCPRCRSSLDVAAVVQIPEAA |
| Ga0209385_12145791 | 3300025650 | Arctic Peat Soil | MCTHTVPADLDLKGKHARVAAGQKCPRCGSSLEVAVVIHIPEAA |
| Ga0209484_101679833 | 3300025829 | Arctic Peat Soil | THTVQAQIDLKGKYARVAAGQKCARCGSSLEVAVVIQIPEAA |
| Ga0207651_102033293 | 3300025960 | Switchgrass Rhizosphere | THTVPAEVDLKGKYARVAAGQKCPRCGSSLEVAVVIHVPEAA |
| Ga0207703_122676732 | 3300026035 | Switchgrass Rhizosphere | VDLRGKYARVAAGQKCPHCGSSLEVAVVILVPEAA |
| Ga0209689_13462073 | 3300027748 | Soil | HTVPADIDLKGKFPRVAAGQKCSRCGSSLDVAAVIQIPEAA |
| Ga0311355_118712361 | 3300030580 | Palsa | AEVDLKGKLKFARVSPGQRCPRCGASLDVAVVIEVPQAA |
| Ga0311354_102109231 | 3300030618 | Palsa | PICTHTVPAEVDLKGKLKFARVSPGQRCPRCGASLDVAVVIEVPQAA |
| Ga0265461_113353301 | 3300030743 | Soil | VPAEVDLKGKLKFARVSPGQRCPRCGAPLDVAVVIEIPQAA |
| Ga0138302_16659131 | 3300030937 | Soil | HTVPAEIDLRGKYARVAAGQKCPRCHSALDVAAVVQIPEAA |
| Ga0308189_103069613 | 3300031058 | Soil | AEVNLKGKTARVAPGQKCPRCTASLDVAVVVEVPEAA |
| Ga0170823_139435312 | 3300031128 | Forest Soil | VTASVDWKNKMKAARVTQGQRCPRCGSSLDVAVVVQLPQAA |
| Ga0308194_103857672 | 3300031421 | Soil | ICTHTVPADVELKGKVARVATGTKCPRCGSSLEVAVVV |
| Ga0170820_134314181 | 3300031446 | Forest Soil | PICTHNVLADIELKGKYPRVAAGQKCPRCGSSLDVAVVVQYSEAA |
| Ga0170818_1032979173 | 3300031474 | Forest Soil | AQIDLKGKHARVAAGQKCPRCGSSLEVAVVIHIPEAA |
| Ga0318541_106373333 | 3300031545 | Soil | VPADIDLRGKFARVAPGQRCPRCLSSLDVAVVVQIPEAA |
| Ga0307483_10120351 | 3300031590 | Hardwood Forest Soil | TVPAEIDLKGKHARVADGQKCPRCGSSLEVAVVVHIPEAA |
| Ga0310686_1074423151 | 3300031708 | Soil | VPAEVDLKGKLKFARVSPGQRCTRCGASLDVAVVIEVPQAA |
| Ga0310686_1161288111 | 3300031708 | Soil | LCPICTHTVPAEVDLKGKARIARVSPGQRCPRCGASLDVAVVVEIPQAA |
| Ga0310686_1166620922 | 3300031708 | Soil | PAEIDLKGKLKFARVSPGQRCSRCGASLDVAVVIEIPQAA |
| Ga0316049_1061703 | 3300031866 | Soil | ALCPICTHTVPAEVDLKGKLKFARVSPGQRCTRCGASLDVAVVIEVPQAA |
| Ga0308174_102199631 | 3300031939 | Soil | HCPMCTHTVPAEVDLRGKYARVAAGQKCPRCGSSLEVAVVIHVPEAA |
| Ga0308174_105304811 | 3300031939 | Soil | TVPADIDLKRKYPRVEPGQRCPRCSSSLDVAVVIQIPEAA |
| Ga0306920_1024523641 | 3300032261 | Soil | CTHTVPAEIDFNGKKVRVAAGQKCPRCGSSLEVAVVVQIPEAA |
| Ga0348332_134748812 | 3300032515 | Plant Litter | EVDLKGKQKIARVSVGQRCPRCGSSLDVAVVVEIPQAA |
| Ga0335079_122611892 | 3300032783 | Soil | PAEIDLRGRRAKVAAGQRCPRCLSSLDVAVVVQIPEAA |
| Ga0335078_113764683 | 3300032805 | Soil | TVPAEIDLRGKYPRVMSGQKCPRCGSALDVAAVVQIPEAA |
| Ga0335078_127381351 | 3300032805 | Soil | ICTHTVPAEIDLRGKFPRVMRGQKCPRCGSALDVAAVVQIPEAA |
| Ga0335081_121586881 | 3300032892 | Soil | ICTHTVPADVDYKGKGKYPRVVPGQKCPRCGSSLDVAVVVQIPEAA |
| Ga0335072_105517811 | 3300032898 | Soil | THTVPAEIDLRGKSPRVASGQKCPRCGSALDVAAVVQIPEAA |
| Ga0310914_102819841 | 3300033289 | Soil | VPAEIDFNGKKVRVAAGQKCPRCGSSLEVAVVVQIPEAA |
| Ga0326728_106220531 | 3300033402 | Peat Soil | GHVHCPMCTHTVPAEIEVKGKLARTAPGQTCARCGSSLDVAVVVQIPEAA |
| Ga0326728_109622423 | 3300033402 | Peat Soil | ADIDLKGRYARVAPGQRCPRCSSSLDVAVVVQIPEAA |
| Ga0334847_036790_98_217 | 3300033826 | Soil | VQAEIDLKGKYARVAAGQKCARCGSSLEVAVIIQIPEAA |
| Ga0334827_153203_2_109 | 3300034065 | Soil | IDLRGKYPRVTSGQKCPRCGSALDVAAVVQIPEAA |
| Ga0316599_141999_488_634 | 3300034653 | Untreated Peat Soil | AHCPMCTHTVPAEIDLRGKHARVASGQKCPRCGSSLEVAVVIHIPEAA |
| ⦗Top⦘ |