| Basic Information | |
|---|---|
| Family ID | F094158 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MVQLPKLSRRARWAVPAGALVVTGGVLAGSLISVAQAAPGLPAR |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 97.17 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.57 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.453 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (24.528 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.358 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.623 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 38.89% β-sheet: 0.00% Coil/Unstructured: 61.11% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 43.40 |
| PF00486 | Trans_reg_C | 33.02 |
| PF00106 | adh_short | 4.72 |
| PF01040 | UbiA | 4.72 |
| PF02518 | HATPase_c | 4.72 |
| PF00672 | HAMP | 0.94 |
| PF11706 | zf-CGNR | 0.94 |
| PF01751 | Toprim | 0.94 |
| PF14559 | TPR_19 | 0.94 |
| PF02965 | Met_synt_B12 | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG1410 | Methionine synthase I, cobalamin-binding domain | Amino acid transport and metabolism [E] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.45 % |
| Unclassified | root | N/A | 7.55 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10355003 | Not Available | 898 | Open in IMG/M |
| 3300001991|JGI24743J22301_10152065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 519 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10295043 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10308450 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300005168|Ga0066809_10226446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 514 | Open in IMG/M |
| 3300005187|Ga0066675_10324550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1119 | Open in IMG/M |
| 3300005332|Ga0066388_105064534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 669 | Open in IMG/M |
| 3300005436|Ga0070713_102403743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 509 | Open in IMG/M |
| 3300005445|Ga0070708_101674266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 591 | Open in IMG/M |
| 3300005536|Ga0070697_100120785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2192 | Open in IMG/M |
| 3300005537|Ga0070730_10867804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 566 | Open in IMG/M |
| 3300005548|Ga0070665_100131567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2504 | Open in IMG/M |
| 3300005563|Ga0068855_101318571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium roseum | 746 | Open in IMG/M |
| 3300005586|Ga0066691_10757987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium roseum | 573 | Open in IMG/M |
| 3300006028|Ga0070717_12113929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 506 | Open in IMG/M |
| 3300006032|Ga0066696_10289591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1063 | Open in IMG/M |
| 3300006046|Ga0066652_100886826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 851 | Open in IMG/M |
| 3300006052|Ga0075029_100916507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 602 | Open in IMG/M |
| 3300006102|Ga0075015_100233985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 990 | Open in IMG/M |
| 3300006176|Ga0070765_101000051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 791 | Open in IMG/M |
| 3300006577|Ga0074050_11299473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 534 | Open in IMG/M |
| 3300006881|Ga0068865_100092769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2194 | Open in IMG/M |
| 3300007076|Ga0075435_101020319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 722 | Open in IMG/M |
| 3300009623|Ga0116133_1049895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1037 | Open in IMG/M |
| 3300010159|Ga0099796_10337449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 647 | Open in IMG/M |
| 3300010398|Ga0126383_10678916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1107 | Open in IMG/M |
| 3300012189|Ga0137388_12048498 | Not Available | 500 | Open in IMG/M |
| 3300012198|Ga0137364_10502507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 911 | Open in IMG/M |
| 3300012203|Ga0137399_10188048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1670 | Open in IMG/M |
| 3300012205|Ga0137362_10778980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 820 | Open in IMG/M |
| 3300012491|Ga0157329_1047703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → Jiangella alba | 500 | Open in IMG/M |
| 3300012948|Ga0126375_12094768 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300015357|Ga0134072_10215251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 673 | Open in IMG/M |
| 3300016270|Ga0182036_10527790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 938 | Open in IMG/M |
| 3300016341|Ga0182035_11744684 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300016357|Ga0182032_10335317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1205 | Open in IMG/M |
| 3300017972|Ga0187781_10962085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 623 | Open in IMG/M |
| 3300017995|Ga0187816_10556017 | Not Available | 517 | Open in IMG/M |
| 3300017999|Ga0187767_10203799 | Not Available | 626 | Open in IMG/M |
| 3300018468|Ga0066662_10824589 | Not Available | 903 | Open in IMG/M |
| 3300020199|Ga0179592_10075287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1547 | Open in IMG/M |
| 3300021362|Ga0213882_10184556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → Jiangella alba | 859 | Open in IMG/M |
| 3300021384|Ga0213876_10359195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 775 | Open in IMG/M |
| 3300021433|Ga0210391_10288166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1289 | Open in IMG/M |
| 3300021439|Ga0213879_10269451 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300021478|Ga0210402_10344779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1381 | Open in IMG/M |
| 3300022840|Ga0224549_1010547 | Not Available | 1344 | Open in IMG/M |
| 3300024271|Ga0224564_1011039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1529 | Open in IMG/M |
| 3300024288|Ga0179589_10328781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 691 | Open in IMG/M |
| 3300025905|Ga0207685_10078898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1357 | Open in IMG/M |
| 3300025907|Ga0207645_10682968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 698 | Open in IMG/M |
| 3300025912|Ga0207707_10815961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 776 | Open in IMG/M |
| 3300025913|Ga0207695_11023385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 706 | Open in IMG/M |
| 3300025915|Ga0207693_10150983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1827 | Open in IMG/M |
| 3300025916|Ga0207663_10930281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 696 | Open in IMG/M |
| 3300026023|Ga0207677_10922592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 788 | Open in IMG/M |
| 3300026075|Ga0207708_10026496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4388 | Open in IMG/M |
| 3300026277|Ga0209350_1051448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1193 | Open in IMG/M |
| 3300026494|Ga0257159_1100650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 507 | Open in IMG/M |
| 3300026551|Ga0209648_10080762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2715 | Open in IMG/M |
| 3300027173|Ga0208097_1004404 | Not Available | 1430 | Open in IMG/M |
| 3300027824|Ga0209040_10541110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 508 | Open in IMG/M |
| 3300028717|Ga0307298_10118966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 757 | Open in IMG/M |
| 3300028718|Ga0307307_10090361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 926 | Open in IMG/M |
| 3300028759|Ga0302224_10056814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1469 | Open in IMG/M |
| 3300028808|Ga0302228_10339277 | Not Available | 670 | Open in IMG/M |
| 3300028881|Ga0307277_10005749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4771 | Open in IMG/M |
| 3300029943|Ga0311340_10207767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1963 | Open in IMG/M |
| 3300029951|Ga0311371_12145761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 585 | Open in IMG/M |
| 3300030007|Ga0311338_10573589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1166 | Open in IMG/M |
| 3300030524|Ga0311357_10400545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1295 | Open in IMG/M |
| 3300030706|Ga0310039_10081627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1376 | Open in IMG/M |
| 3300031236|Ga0302324_101697716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 808 | Open in IMG/M |
| 3300031236|Ga0302324_101771553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 786 | Open in IMG/M |
| 3300031543|Ga0318516_10171330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1249 | Open in IMG/M |
| 3300031572|Ga0318515_10695450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 538 | Open in IMG/M |
| 3300031640|Ga0318555_10112694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1440 | Open in IMG/M |
| 3300031640|Ga0318555_10277061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 907 | Open in IMG/M |
| 3300031679|Ga0318561_10788849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 522 | Open in IMG/M |
| 3300031681|Ga0318572_10364055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 858 | Open in IMG/M |
| 3300031708|Ga0310686_119218785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 886 | Open in IMG/M |
| 3300031723|Ga0318493_10208970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1032 | Open in IMG/M |
| 3300031724|Ga0318500_10708515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 513 | Open in IMG/M |
| 3300031747|Ga0318502_10065373 | All Organisms → cellular organisms → Bacteria | 1949 | Open in IMG/M |
| 3300031748|Ga0318492_10196753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1030 | Open in IMG/M |
| 3300031770|Ga0318521_10350798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 874 | Open in IMG/M |
| 3300031777|Ga0318543_10284431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 739 | Open in IMG/M |
| 3300031781|Ga0318547_11049389 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300031795|Ga0318557_10363617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 665 | Open in IMG/M |
| 3300031797|Ga0318550_10205464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 953 | Open in IMG/M |
| 3300031797|Ga0318550_10657895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 502 | Open in IMG/M |
| 3300031805|Ga0318497_10448263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 723 | Open in IMG/M |
| 3300031890|Ga0306925_10036637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5047 | Open in IMG/M |
| 3300031910|Ga0306923_10425573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1509 | Open in IMG/M |
| 3300031947|Ga0310909_11200529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 613 | Open in IMG/M |
| 3300032009|Ga0318563_10706771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 541 | Open in IMG/M |
| 3300032039|Ga0318559_10115141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1202 | Open in IMG/M |
| 3300032043|Ga0318556_10753477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 506 | Open in IMG/M |
| 3300032060|Ga0318505_10496394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 576 | Open in IMG/M |
| 3300032066|Ga0318514_10751738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 518 | Open in IMG/M |
| 3300032076|Ga0306924_11485332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 719 | Open in IMG/M |
| 3300032160|Ga0311301_10094911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5908 | Open in IMG/M |
| 3300032174|Ga0307470_11791106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 519 | Open in IMG/M |
| 3300032805|Ga0335078_10044608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. NRRL S-1777 | 6571 | Open in IMG/M |
| 3300032895|Ga0335074_10254695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora | 2061 | Open in IMG/M |
| 3300032954|Ga0335083_11395713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 535 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.53% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.55% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.55% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.77% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.83% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.83% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.89% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.89% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.89% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.94% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.94% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.94% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.94% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.94% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.94% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.94% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.94% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.94% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Host-Associated | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027173 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_103550031 | 3300001593 | Forest Soil | MFAIPRRARWAVPAGALVITGAIMAGSLISVAQAAPALPSRTPAQ |
| JGI24743J22301_101520651 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | MIQAPKLSRRARWAIPAGALVITGGVLAGSLITAAQA |
| JGIcombinedJ51221_102950432 | 3300003505 | Forest Soil | MVAGAKLPRRARWAVPAAALVITGGVLAGSLISAAQAAPG |
| JGIcombinedJ51221_103084501 | 3300003505 | Forest Soil | MAGVPKLSRRARWAVPVGALVVTGAVMAGSLISVAQASPGLPPR |
| Ga0066809_102264462 | 3300005168 | Soil | MIQAPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPGLP |
| Ga0066675_103245503 | 3300005187 | Soil | MIQASKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPGLP |
| Ga0066388_1050645342 | 3300005332 | Tropical Forest Soil | MVQVPKLSRRARWALPAGALVITGGVLAGSLISAAQAAPGLPPRTAAQ |
| Ga0070713_1024037431 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MIQAPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPGLPARTAAQL |
| Ga0070708_1016742662 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MIQAPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPGLPAR |
| Ga0070697_1001207853 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MIQAPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPGLPARTAAQLLAEVADSTPPPLT |
| Ga0070730_108678041 | 3300005537 | Surface Soil | MSSRRARWAVPAGALVVTGGVLAGTLISSAQATPGLPARTAAQLLAEVADS |
| Ga0070665_1001315671 | 3300005548 | Switchgrass Rhizosphere | MIQAPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPGLPARTA |
| Ga0068855_1013185712 | 3300005563 | Corn Rhizosphere | MTQVPKLSRRARWAIPAGALVVTGGVLAGTLISSAQAAPGLPARTAAQLLAEVADST |
| Ga0066691_107579871 | 3300005586 | Soil | MTQVPKLSRRSRWAIPAGALVVTGGILAGTLISSAQAAPGLPARTAAQLLAEVADSTTPP |
| Ga0070717_121139292 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSRRARWAVPAGALVVTGGVLAGSLISSASAAPGLPT |
| Ga0066696_102895911 | 3300006032 | Soil | MTQVPKLSRRSRWAIPAGALVVTGGILAGTLISSAQAAP |
| Ga0066652_1008868261 | 3300006046 | Soil | MIQAPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPGLPARTAAQ |
| Ga0075029_1009165071 | 3300006052 | Watersheds | MAGVPKLSRRARWAVPVGVLVITGAVMAGSLISVAQASP |
| Ga0075015_1002339851 | 3300006102 | Watersheds | MVQVPRLSRRARWAVPAGVLVITGGVMAGSLISVAQAAPGLPA |
| Ga0070765_1010000511 | 3300006176 | Soil | MVGVPRLSRRARWAVPAGALVITGGVIAGSVISVAQAAPGLPAKTAAQLLAE |
| Ga0074050_112994731 | 3300006577 | Soil | MIQAPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPGLPAHTAAQLLAEVA |
| Ga0068865_1000927693 | 3300006881 | Miscanthus Rhizosphere | MIQAPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPGLPARTAAQLLAEVADST |
| Ga0075435_1010203191 | 3300007076 | Populus Rhizosphere | MIQAPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPGLPA |
| Ga0116133_10498951 | 3300009623 | Peatland | MVQVPRLSSRRARWAVPAGALVVTGGILAGSLISAAQATPGLPARTSAQLLAQVA |
| Ga0099796_103374491 | 3300010159 | Vadose Zone Soil | MTQVPKLSRRARWAIPAGALVVTGGVLAGTLISSAQAAPGLPARTAAQLLAEV |
| Ga0126383_106789162 | 3300010398 | Tropical Forest Soil | MSRRARWAVPAAALVVTGGVLAGSLISVAQAAPGLPA |
| Ga0137388_120484981 | 3300012189 | Vadose Zone Soil | MNPMLRLSRRARWAVPGGVLAVTAAITAGSMITIAQ |
| Ga0137364_105025072 | 3300012198 | Vadose Zone Soil | MIQAPKLSRRARWAIPAGALVVTGGVLAGTLISSAQAAPGLPAR |
| Ga0137399_101880483 | 3300012203 | Vadose Zone Soil | MTQVPKLSRRARWAIPAGALVVTGGVLAGTLISSAQA |
| Ga0137362_107789802 | 3300012205 | Vadose Zone Soil | MFGVPKLSRRAHWAVPVGVLTVTGGVMAASLISVAQAAPALPPRTPA |
| Ga0157329_10477032 | 3300012491 | Arabidopsis Rhizosphere | MIQAPKLSRRARWAIPAGAVVITGGVLAGSLITAAQAAPGLPVRTAAQLLAEVA |
| Ga0126375_120947682 | 3300012948 | Tropical Forest Soil | MIQAPKLSRRARWAIPGGALVITGGVLAGSLITAAQAAPGLPARTAAQLLAEVADSTPPPLTG |
| Ga0134072_102152511 | 3300015357 | Grasslands Soil | MTQVPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPGLPARTAA |
| Ga0182036_105277901 | 3300016270 | Soil | MVQVPKLSRRARWAIPAGVLVVTGGLMAGSLITAAQAAPGLPSRTA |
| Ga0182035_117446842 | 3300016341 | Soil | MVQIPKLSKRARWAVPAGVLVIVGGVLAGSLISVAQAAPGLPART |
| Ga0182032_103353171 | 3300016357 | Soil | MAGVPKLSRRARWAVPAGALAIIGAVLAGSLISVAQASPGLP |
| Ga0187781_109620851 | 3300017972 | Tropical Peatland | MVQVPRLSRRARWAVPAGALVVVGGVMAGSLLSVAQA |
| Ga0187816_105560171 | 3300017995 | Freshwater Sediment | MVQVPRLSRRARWAVPVGALVVVGGVMAGSLISVAQAAPGLPAR |
| Ga0187767_102037991 | 3300017999 | Tropical Peatland | MVQLPKLSRRARWAIPAGALVVTGGVMAGSLITAAQAAPGLPARTAAQLLAEVAD |
| Ga0066662_108245891 | 3300018468 | Grasslands Soil | MGFWLSRRARWAVPGAALAVTGAVMAGSLISVAQAAPALP |
| Ga0179592_100752873 | 3300020199 | Vadose Zone Soil | MTQVPKLSRRARWAIPAGALVVTGGVLAGTLISSAQAAPGLPARTAAQLLAEVADSTPP |
| Ga0213882_101845561 | 3300021362 | Exposed Rock | MVRIPRLSRRARWLVPAGALVITGACLAGSLISVAQAAPGLPARSPAQLLAQVADSPPPP |
| Ga0213876_103591951 | 3300021384 | Plant Roots | MVRIPSLSRRARWLVPAGALVITGACLAGSLISVAQAAPGLPARSPAQLLAQVAD |
| Ga0210391_102881663 | 3300021433 | Soil | MAGDPMMLVTKLSRRARWAVPVGALVVTGAVMAGSLMSAAQAAP |
| Ga0213879_102694511 | 3300021439 | Bulk Soil | MVQVPRFSRRARWAVPVAALVVTGGVLAGSLISVAQ |
| Ga0210402_103447793 | 3300021478 | Soil | MIQSPKLSRRARWAIPAGALVITGGVLAGSLISSAQAAPGLPARTAAQLLAEVADS |
| Ga0224549_10105471 | 3300022840 | Soil | MARVPKLSRRIRWAIPVGALVVTSAVMAGSLISVAQASPGLPSRTP |
| Ga0224564_10110393 | 3300024271 | Soil | MVQVSRLSRRARWAVPAGALVITGGVMAGALISVAQAAPGLPAR |
| Ga0179589_103287811 | 3300024288 | Vadose Zone Soil | MTQVPKLSRRARWAIPAGALVVTGGVLAGTLISSAQAAPGLPARTAAELL |
| Ga0207685_100788983 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MIQAPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPGLPARTAAQLLA |
| Ga0207645_106829682 | 3300025907 | Miscanthus Rhizosphere | MIQAPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPG |
| Ga0207707_108159611 | 3300025912 | Corn Rhizosphere | MIQAPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPGLPVRTAAQL |
| Ga0207695_110233852 | 3300025913 | Corn Rhizosphere | MIQAPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPGLPARTAAQLLAEVAD |
| Ga0207693_101509831 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSRRMRWAVPAGALVVTGGVLAGSLISSASAAPGLPTRPPAQLLAEVARA |
| Ga0207663_109302812 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MVAKPKLSRRARWAVPAGALVVVGGVLAGSLISVAQAAPGLAPR |
| Ga0207677_109225922 | 3300026023 | Miscanthus Rhizosphere | MIQAPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPGLPARTAAQLLAEVADSTPPP |
| Ga0207708_100264965 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MIQAPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPGLPARTAAQLLAE |
| Ga0209350_10514481 | 3300026277 | Grasslands Soil | MTQVPKLSRRARWAIPAGALVLTGGVLAGTLISSA |
| Ga0257159_11006501 | 3300026494 | Soil | MAGVPKLSRRARWAIPAGALVITGAVIGGSLITVAQASPGL |
| Ga0209648_100807624 | 3300026551 | Grasslands Soil | MAGVPKLSRRTRWAIPVGALVITGAVLAGSLISVAQASP |
| Ga0208097_10044041 | 3300027173 | Forest Soil | MVQIPKLSRRARWAVPAAALVITGGVIAGSLISVAQAAP |
| Ga0209040_105411101 | 3300027824 | Bog Forest Soil | MAGVPKLSRRARWAVPVGVLVITGAVMAGSLISVAQ |
| Ga0307298_101189661 | 3300028717 | Soil | MIQAPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPGLPARTAAQLLAEV |
| Ga0307307_100903611 | 3300028718 | Soil | MIQSPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPGLPARTAAQLL |
| Ga0302224_100568141 | 3300028759 | Palsa | MARVPKLSRRIRWAIPVGALVVTSAVMAGSLISVAQASPG |
| Ga0302228_103392772 | 3300028808 | Palsa | MARVPKLSRRIRWAIPVGALVVTSAVMAGSLISVA |
| Ga0307277_100057491 | 3300028881 | Soil | MIQAPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAP |
| Ga0311340_102077673 | 3300029943 | Palsa | MSGFPKLSRRARWAVPVAALVVTGGVMAGSLISVAQAAPA |
| Ga0311371_121457612 | 3300029951 | Palsa | MSGFPKLSRRARWAVPVGALVVTGGVMAGSLISVAQAAPALPSRTPA |
| Ga0311338_105735892 | 3300030007 | Palsa | MSGFPKLSRRARWAVPVAALVVTGGVMAGSLISVAQAAPALPSR |
| Ga0311357_104005453 | 3300030524 | Palsa | MSGFPKLSRRARWAVPVAALVVTGGVLAGSLISVAQAAPALPSRSPAQ |
| Ga0310039_100816273 | 3300030706 | Peatlands Soil | MAGVPKLSRRTRWAVPVGVLAITGAVTAGSLISVA |
| Ga0302324_1016977161 | 3300031236 | Palsa | MVAVPKLSRRARWAVPAGALVITGAVLAGSLIPAAQAAPGLPSRT |
| Ga0302324_1017715532 | 3300031236 | Palsa | MSGSPKLSRRARWAVPVGALVVTGGVMAGSLISVAQAAPALPSRTP |
| Ga0318516_101713301 | 3300031543 | Soil | MVQVPKLSRRARWAIPAGALVITGGVLAGSLISSA |
| Ga0318515_106954502 | 3300031572 | Soil | MAGVPKLSRRARWAVPIGALIITGAVMAGSLISVAQASPG |
| Ga0318555_101126943 | 3300031640 | Soil | MAGVPKLSRRTRWAVPAGALAIIGAVIAGSLISVAQAS |
| Ga0318555_102770612 | 3300031640 | Soil | MVHVPKLSRRARWAVPAGVLVIVGGVLAGSLISVAQAAPGL |
| Ga0318561_107888492 | 3300031679 | Soil | MAGVPKLSRRARWAVPIGALIITGAVMAGSLISVAQ |
| Ga0318572_103640551 | 3300031681 | Soil | MVQLPKLSRRARWAIPAGALVVTGAVLAGSLITTAQAAPGLPAR |
| Ga0310686_1192187851 | 3300031708 | Soil | MIAVPKLSRRARWAVPAGALVITGAVLAGSLLPAAQAAPGLPSQTP |
| Ga0318493_102089701 | 3300031723 | Soil | MAGVPKLSRRTRWAVPAGALAIIGAVIAGSLISVAQA |
| Ga0318500_107085151 | 3300031724 | Soil | MVQLPKLSRRARWAIPAGALVVTGAVLAGSLITTAQAAPSLPAR |
| Ga0318502_100653731 | 3300031747 | Soil | MVQLPKLSRRARWAVPAGALVVTGGVLAGSLISVAQA |
| Ga0318492_101967533 | 3300031748 | Soil | MVHVPKLSRRARWAVPAGVLVIVGGVLAGSLISVAQAAPGLPAR |
| Ga0318521_103507981 | 3300031770 | Soil | MVQLPKLSRRARWAVPAGALVVTGGVLAGSLISVAQAAPGLPA |
| Ga0318543_102844312 | 3300031777 | Soil | MVQLPKLSRRARWAVPAGALVVTGGVLAGSLISVAQAAPGLP |
| Ga0318547_110493891 | 3300031781 | Soil | MVQVPRLSRRARWAVPAGALVITGGILAGSLISVAQAAPGLPAKTPAQLLVEVADST |
| Ga0318557_103636172 | 3300031795 | Soil | MAGVPKLSRRARWAVPAGALAVTGAVLAGSLISVAQA |
| Ga0318550_102054642 | 3300031797 | Soil | MAGVPKLSRRARWAVPVGALAIAGAVLAGSLISVA |
| Ga0318550_106578951 | 3300031797 | Soil | MVQVPKLSRRARWAIPAGALVITGGVLAGSLFSSAQAAPGLPPRTA |
| Ga0318497_104482633 | 3300031805 | Soil | MVQVPTLSRRARWAVPAGALVITGGVMAGSLISVAQATPGLPAVTPA |
| Ga0306925_100366371 | 3300031890 | Soil | MAGVPKLSRRARWAVPVGALAIAGAVLAGSLISVAQASPGLPP |
| Ga0306923_104255731 | 3300031910 | Soil | MVQVPRLSRRARWAVPAGALVITGGILAGSLISVAQAAPGLPAKTPA |
| Ga0310909_112005292 | 3300031947 | Soil | MVQLPKLSRRARWAIPAGALVVTGAVLAGSLITTAQAAPGLPARTAAQLLAE |
| Ga0318563_107067711 | 3300032009 | Soil | MSRRARWAVPAGALVVTGGILAGTLISAAQAAPGLPARSPAQLLAEV |
| Ga0318559_101151411 | 3300032039 | Soil | MVQVPKLSRRARWAIPAGALVITGGVLAGSLISSAQAAPGL |
| Ga0318556_107534771 | 3300032043 | Soil | MVQLPKLSRRARWAIPAGALVVTGAVLAGSLITTAQAAPGLPARTAA |
| Ga0318505_104963941 | 3300032060 | Soil | MVQLPKLSRRARWAVPAGALVVTGGVLAGSLISVAQAAPGLPAR |
| Ga0318514_107517381 | 3300032066 | Soil | MAGVPKLSRRARWAVPAGALAIIGAVLAGSLISVA |
| Ga0306924_114853321 | 3300032076 | Soil | MVQVPRLSRRARWAVPAGALVITGGILAGSLISVAQAAPGLPAKTPAQLLV |
| Ga0311301_100949111 | 3300032160 | Peatlands Soil | MVQVPRLSRRARWAVPAGALVITGGVIAGSVISVAQAAPGLPARTAAELLAEV |
| Ga0307470_117911062 | 3300032174 | Hardwood Forest Soil | MTQVPKLSRRARWAIPAGALVVTGGVLAGTLISSAQAAPGL |
| Ga0335078_100446081 | 3300032805 | Soil | MLSVPKLSRRARWAVPVGALVVTGAVMAGSLISVAQG |
| Ga0335074_102546953 | 3300032895 | Soil | VTGVLKLSRRARWAVPVGALVITGAVMAGSLISVAQASPGLPP |
| Ga0335083_113957131 | 3300032954 | Soil | MVQLPKLSRRARWAIPAGALVVTGGVLAGSLITAAQATPGL |
| ⦗Top⦘ |