NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F094158

Metagenome / Metatranscriptome Family F094158

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F094158
Family Type Metagenome / Metatranscriptome
Number of Sequences 106
Average Sequence Length 45 residues
Representative Sequence MVQLPKLSRRARWAVPAGALVVTGGVLAGSLISVAQAAPGLPAR
Number of Associated Samples 102
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 97.17 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 90.57 %
Associated GOLD sequencing projects 102
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.453 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(24.528 % of family members)
Environment Ontology (ENVO) Unclassified
(27.358 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(39.623 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: Yes Secondary Structure distribution: α-helix: 38.89%    β-sheet: 0.00%    Coil/Unstructured: 61.11%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF00072Response_reg 43.40
PF00486Trans_reg_C 33.02
PF00106adh_short 4.72
PF01040UbiA 4.72
PF02518HATPase_c 4.72
PF00672HAMP 0.94
PF11706zf-CGNR 0.94
PF01751Toprim 0.94
PF14559TPR_19 0.94
PF02965Met_synt_B12 0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG1410Methionine synthase I, cobalamin-binding domainAmino acid transport and metabolism [E] 0.94


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.45 %
UnclassifiedrootN/A7.55 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001593|JGI12635J15846_10355003Not Available898Open in IMG/M
3300001991|JGI24743J22301_10152065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces519Open in IMG/M
3300003505|JGIcombinedJ51221_10295043All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300003505|JGIcombinedJ51221_10308450All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300005168|Ga0066809_10226446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia514Open in IMG/M
3300005187|Ga0066675_10324550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1119Open in IMG/M
3300005332|Ga0066388_105064534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia669Open in IMG/M
3300005436|Ga0070713_102403743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia509Open in IMG/M
3300005445|Ga0070708_101674266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia591Open in IMG/M
3300005536|Ga0070697_100120785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2192Open in IMG/M
3300005537|Ga0070730_10867804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia566Open in IMG/M
3300005548|Ga0070665_100131567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2504Open in IMG/M
3300005563|Ga0068855_101318571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium roseum746Open in IMG/M
3300005586|Ga0066691_10757987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium roseum573Open in IMG/M
3300006028|Ga0070717_12113929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces506Open in IMG/M
3300006032|Ga0066696_10289591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1063Open in IMG/M
3300006046|Ga0066652_100886826All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia851Open in IMG/M
3300006052|Ga0075029_100916507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces602Open in IMG/M
3300006102|Ga0075015_100233985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia990Open in IMG/M
3300006176|Ga0070765_101000051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae791Open in IMG/M
3300006577|Ga0074050_11299473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia534Open in IMG/M
3300006881|Ga0068865_100092769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2194Open in IMG/M
3300007076|Ga0075435_101020319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia722Open in IMG/M
3300009623|Ga0116133_1049895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1037Open in IMG/M
3300010159|Ga0099796_10337449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces647Open in IMG/M
3300010398|Ga0126383_10678916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1107Open in IMG/M
3300012189|Ga0137388_12048498Not Available500Open in IMG/M
3300012198|Ga0137364_10502507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces911Open in IMG/M
3300012203|Ga0137399_10188048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1670Open in IMG/M
3300012205|Ga0137362_10778980All Organisms → cellular organisms → Bacteria → Terrabacteria group820Open in IMG/M
3300012491|Ga0157329_1047703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → Jiangella alba500Open in IMG/M
3300012948|Ga0126375_12094768All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300015357|Ga0134072_10215251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces673Open in IMG/M
3300016270|Ga0182036_10527790All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces938Open in IMG/M
3300016341|Ga0182035_11744684All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300016357|Ga0182032_10335317All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1205Open in IMG/M
3300017972|Ga0187781_10962085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces623Open in IMG/M
3300017995|Ga0187816_10556017Not Available517Open in IMG/M
3300017999|Ga0187767_10203799Not Available626Open in IMG/M
3300018468|Ga0066662_10824589Not Available903Open in IMG/M
3300020199|Ga0179592_10075287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1547Open in IMG/M
3300021362|Ga0213882_10184556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → Jiangella alba859Open in IMG/M
3300021384|Ga0213876_10359195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces775Open in IMG/M
3300021433|Ga0210391_10288166All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1289Open in IMG/M
3300021439|Ga0213879_10269451All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300021478|Ga0210402_10344779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1381Open in IMG/M
3300022840|Ga0224549_1010547Not Available1344Open in IMG/M
3300024271|Ga0224564_1011039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1529Open in IMG/M
3300024288|Ga0179589_10328781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces691Open in IMG/M
3300025905|Ga0207685_10078898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1357Open in IMG/M
3300025907|Ga0207645_10682968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces698Open in IMG/M
3300025912|Ga0207707_10815961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces776Open in IMG/M
3300025913|Ga0207695_11023385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces706Open in IMG/M
3300025915|Ga0207693_10150983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1827Open in IMG/M
3300025916|Ga0207663_10930281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces696Open in IMG/M
3300026023|Ga0207677_10922592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces788Open in IMG/M
3300026075|Ga0207708_10026496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4388Open in IMG/M
3300026277|Ga0209350_1051448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1193Open in IMG/M
3300026494|Ga0257159_1100650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces507Open in IMG/M
3300026551|Ga0209648_10080762All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2715Open in IMG/M
3300027173|Ga0208097_1004404Not Available1430Open in IMG/M
3300027824|Ga0209040_10541110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces508Open in IMG/M
3300028717|Ga0307298_10118966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces757Open in IMG/M
3300028718|Ga0307307_10090361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces926Open in IMG/M
3300028759|Ga0302224_10056814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1469Open in IMG/M
3300028808|Ga0302228_10339277Not Available670Open in IMG/M
3300028881|Ga0307277_10005749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4771Open in IMG/M
3300029943|Ga0311340_10207767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1963Open in IMG/M
3300029951|Ga0311371_12145761All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia585Open in IMG/M
3300030007|Ga0311338_10573589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1166Open in IMG/M
3300030524|Ga0311357_10400545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1295Open in IMG/M
3300030706|Ga0310039_10081627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1376Open in IMG/M
3300031236|Ga0302324_101697716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia808Open in IMG/M
3300031236|Ga0302324_101771553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia786Open in IMG/M
3300031543|Ga0318516_10171330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1249Open in IMG/M
3300031572|Ga0318515_10695450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces538Open in IMG/M
3300031640|Ga0318555_10112694All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1440Open in IMG/M
3300031640|Ga0318555_10277061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces907Open in IMG/M
3300031679|Ga0318561_10788849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces522Open in IMG/M
3300031681|Ga0318572_10364055All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia858Open in IMG/M
3300031708|Ga0310686_119218785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia886Open in IMG/M
3300031723|Ga0318493_10208970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1032Open in IMG/M
3300031724|Ga0318500_10708515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces513Open in IMG/M
3300031747|Ga0318502_10065373All Organisms → cellular organisms → Bacteria1949Open in IMG/M
3300031748|Ga0318492_10196753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1030Open in IMG/M
3300031770|Ga0318521_10350798All Organisms → cellular organisms → Bacteria → Terrabacteria group874Open in IMG/M
3300031777|Ga0318543_10284431All Organisms → cellular organisms → Bacteria → Terrabacteria group739Open in IMG/M
3300031781|Ga0318547_11049389All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300031795|Ga0318557_10363617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces665Open in IMG/M
3300031797|Ga0318550_10205464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces953Open in IMG/M
3300031797|Ga0318550_10657895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces502Open in IMG/M
3300031805|Ga0318497_10448263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria723Open in IMG/M
3300031890|Ga0306925_10036637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5047Open in IMG/M
3300031910|Ga0306923_10425573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1509Open in IMG/M
3300031947|Ga0310909_11200529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces613Open in IMG/M
3300032009|Ga0318563_10706771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces541Open in IMG/M
3300032039|Ga0318559_10115141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1202Open in IMG/M
3300032043|Ga0318556_10753477All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces506Open in IMG/M
3300032060|Ga0318505_10496394All Organisms → cellular organisms → Bacteria → Terrabacteria group576Open in IMG/M
3300032066|Ga0318514_10751738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces518Open in IMG/M
3300032076|Ga0306924_11485332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia719Open in IMG/M
3300032160|Ga0311301_10094911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5908Open in IMG/M
3300032174|Ga0307470_11791106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces519Open in IMG/M
3300032805|Ga0335078_10044608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. NRRL S-17776571Open in IMG/M
3300032895|Ga0335074_10254695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora2061Open in IMG/M
3300032954|Ga0335083_11395713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces535Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil24.53%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.55%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa7.55%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.77%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.77%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.83%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.83%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.89%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.89%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.89%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.94%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.94%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.94%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.94%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.94%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.94%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.94%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.94%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.94%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.94%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.94%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.94%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.94%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.94%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001991Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2Host-AssociatedOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300005168Soil and rhizosphere microbial communities from Laval, Canada - mgLPCEnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006577Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012491Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610Host-AssociatedOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021362Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09EnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021439Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03EnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022840Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5EnvironmentalOpen in IMG/M
3300024271Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026277Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026494Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-AEnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027173Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028759Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1EnvironmentalOpen in IMG/M
3300028808Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12635J15846_1035500313300001593Forest SoilMFAIPRRARWAVPAGALVITGAIMAGSLISVAQAAPALPSRTPAQ
JGI24743J22301_1015206513300001991Corn, Switchgrass And Miscanthus RhizosphereMIQAPKLSRRARWAIPAGALVITGGVLAGSLITAAQA
JGIcombinedJ51221_1029504323300003505Forest SoilMVAGAKLPRRARWAVPAAALVITGGVLAGSLISAAQAAPG
JGIcombinedJ51221_1030845013300003505Forest SoilMAGVPKLSRRARWAVPVGALVVTGAVMAGSLISVAQASPGLPPR
Ga0066809_1022644623300005168SoilMIQAPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPGLP
Ga0066675_1032455033300005187SoilMIQASKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPGLP
Ga0066388_10506453423300005332Tropical Forest SoilMVQVPKLSRRARWALPAGALVITGGVLAGSLISAAQAAPGLPPRTAAQ
Ga0070713_10240374313300005436Corn, Switchgrass And Miscanthus RhizosphereMIQAPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPGLPARTAAQL
Ga0070708_10167426623300005445Corn, Switchgrass And Miscanthus RhizosphereMIQAPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPGLPAR
Ga0070697_10012078533300005536Corn, Switchgrass And Miscanthus RhizosphereMIQAPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPGLPARTAAQLLAEVADSTPPPLT
Ga0070730_1086780413300005537Surface SoilMSSRRARWAVPAGALVVTGGVLAGTLISSAQATPGLPARTAAQLLAEVADS
Ga0070665_10013156713300005548Switchgrass RhizosphereMIQAPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPGLPARTA
Ga0068855_10131857123300005563Corn RhizosphereMTQVPKLSRRARWAIPAGALVVTGGVLAGTLISSAQAAPGLPARTAAQLLAEVADST
Ga0066691_1075798713300005586SoilMTQVPKLSRRSRWAIPAGALVVTGGILAGTLISSAQAAPGLPARTAAQLLAEVADSTTPP
Ga0070717_1211392923300006028Corn, Switchgrass And Miscanthus RhizosphereMSSRRARWAVPAGALVVTGGVLAGSLISSASAAPGLPT
Ga0066696_1028959113300006032SoilMTQVPKLSRRSRWAIPAGALVVTGGILAGTLISSAQAAP
Ga0066652_10088682613300006046SoilMIQAPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPGLPARTAAQ
Ga0075029_10091650713300006052WatershedsMAGVPKLSRRARWAVPVGVLVITGAVMAGSLISVAQASP
Ga0075015_10023398513300006102WatershedsMVQVPRLSRRARWAVPAGVLVITGGVMAGSLISVAQAAPGLPA
Ga0070765_10100005113300006176SoilMVGVPRLSRRARWAVPAGALVITGGVIAGSVISVAQAAPGLPAKTAAQLLAE
Ga0074050_1129947313300006577SoilMIQAPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPGLPAHTAAQLLAEVA
Ga0068865_10009276933300006881Miscanthus RhizosphereMIQAPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPGLPARTAAQLLAEVADST
Ga0075435_10102031913300007076Populus RhizosphereMIQAPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPGLPA
Ga0116133_104989513300009623PeatlandMVQVPRLSSRRARWAVPAGALVVTGGILAGSLISAAQATPGLPARTSAQLLAQVA
Ga0099796_1033744913300010159Vadose Zone SoilMTQVPKLSRRARWAIPAGALVVTGGVLAGTLISSAQAAPGLPARTAAQLLAEV
Ga0126383_1067891623300010398Tropical Forest SoilMSRRARWAVPAAALVVTGGVLAGSLISVAQAAPGLPA
Ga0137388_1204849813300012189Vadose Zone SoilMNPMLRLSRRARWAVPGGVLAVTAAITAGSMITIAQ
Ga0137364_1050250723300012198Vadose Zone SoilMIQAPKLSRRARWAIPAGALVVTGGVLAGTLISSAQAAPGLPAR
Ga0137399_1018804833300012203Vadose Zone SoilMTQVPKLSRRARWAIPAGALVVTGGVLAGTLISSAQA
Ga0137362_1077898023300012205Vadose Zone SoilMFGVPKLSRRAHWAVPVGVLTVTGGVMAASLISVAQAAPALPPRTPA
Ga0157329_104770323300012491Arabidopsis RhizosphereMIQAPKLSRRARWAIPAGAVVITGGVLAGSLITAAQAAPGLPVRTAAQLLAEVA
Ga0126375_1209476823300012948Tropical Forest SoilMIQAPKLSRRARWAIPGGALVITGGVLAGSLITAAQAAPGLPARTAAQLLAEVADSTPPPLTG
Ga0134072_1021525113300015357Grasslands SoilMTQVPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPGLPARTAA
Ga0182036_1052779013300016270SoilMVQVPKLSRRARWAIPAGVLVVTGGLMAGSLITAAQAAPGLPSRTA
Ga0182035_1174468423300016341SoilMVQIPKLSKRARWAVPAGVLVIVGGVLAGSLISVAQAAPGLPART
Ga0182032_1033531713300016357SoilMAGVPKLSRRARWAVPAGALAIIGAVLAGSLISVAQASPGLP
Ga0187781_1096208513300017972Tropical PeatlandMVQVPRLSRRARWAVPAGALVVVGGVMAGSLLSVAQA
Ga0187816_1055601713300017995Freshwater SedimentMVQVPRLSRRARWAVPVGALVVVGGVMAGSLISVAQAAPGLPAR
Ga0187767_1020379913300017999Tropical PeatlandMVQLPKLSRRARWAIPAGALVVTGGVMAGSLITAAQAAPGLPARTAAQLLAEVAD
Ga0066662_1082458913300018468Grasslands SoilMGFWLSRRARWAVPGAALAVTGAVMAGSLISVAQAAPALP
Ga0179592_1007528733300020199Vadose Zone SoilMTQVPKLSRRARWAIPAGALVVTGGVLAGTLISSAQAAPGLPARTAAQLLAEVADSTPP
Ga0213882_1018455613300021362Exposed RockMVRIPRLSRRARWLVPAGALVITGACLAGSLISVAQAAPGLPARSPAQLLAQVADSPPPP
Ga0213876_1035919513300021384Plant RootsMVRIPSLSRRARWLVPAGALVITGACLAGSLISVAQAAPGLPARSPAQLLAQVAD
Ga0210391_1028816633300021433SoilMAGDPMMLVTKLSRRARWAVPVGALVVTGAVMAGSLMSAAQAAP
Ga0213879_1026945113300021439Bulk SoilMVQVPRFSRRARWAVPVAALVVTGGVLAGSLISVAQ
Ga0210402_1034477933300021478SoilMIQSPKLSRRARWAIPAGALVITGGVLAGSLISSAQAAPGLPARTAAQLLAEVADS
Ga0224549_101054713300022840SoilMARVPKLSRRIRWAIPVGALVVTSAVMAGSLISVAQASPGLPSRTP
Ga0224564_101103933300024271SoilMVQVSRLSRRARWAVPAGALVITGGVMAGALISVAQAAPGLPAR
Ga0179589_1032878113300024288Vadose Zone SoilMTQVPKLSRRARWAIPAGALVVTGGVLAGTLISSAQAAPGLPARTAAELL
Ga0207685_1007889833300025905Corn, Switchgrass And Miscanthus RhizosphereMIQAPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPGLPARTAAQLLA
Ga0207645_1068296823300025907Miscanthus RhizosphereMIQAPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPG
Ga0207707_1081596113300025912Corn RhizosphereMIQAPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPGLPVRTAAQL
Ga0207695_1102338523300025913Corn RhizosphereMIQAPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPGLPARTAAQLLAEVAD
Ga0207693_1015098313300025915Corn, Switchgrass And Miscanthus RhizosphereMSSRRMRWAVPAGALVVTGGVLAGSLISSASAAPGLPTRPPAQLLAEVARA
Ga0207663_1093028123300025916Corn, Switchgrass And Miscanthus RhizosphereMVAKPKLSRRARWAVPAGALVVVGGVLAGSLISVAQAAPGLAPR
Ga0207677_1092259223300026023Miscanthus RhizosphereMIQAPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPGLPARTAAQLLAEVADSTPPP
Ga0207708_1002649653300026075Corn, Switchgrass And Miscanthus RhizosphereMIQAPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPGLPARTAAQLLAE
Ga0209350_105144813300026277Grasslands SoilMTQVPKLSRRARWAIPAGALVLTGGVLAGTLISSA
Ga0257159_110065013300026494SoilMAGVPKLSRRARWAIPAGALVITGAVIGGSLITVAQASPGL
Ga0209648_1008076243300026551Grasslands SoilMAGVPKLSRRTRWAIPVGALVITGAVLAGSLISVAQASP
Ga0208097_100440413300027173Forest SoilMVQIPKLSRRARWAVPAAALVITGGVIAGSLISVAQAAP
Ga0209040_1054111013300027824Bog Forest SoilMAGVPKLSRRARWAVPVGVLVITGAVMAGSLISVAQ
Ga0307298_1011896613300028717SoilMIQAPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPGLPARTAAQLLAEV
Ga0307307_1009036113300028718SoilMIQSPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAPGLPARTAAQLL
Ga0302224_1005681413300028759PalsaMARVPKLSRRIRWAIPVGALVVTSAVMAGSLISVAQASPG
Ga0302228_1033927723300028808PalsaMARVPKLSRRIRWAIPVGALVVTSAVMAGSLISVA
Ga0307277_1000574913300028881SoilMIQAPKLSRRARWAIPAGALVITGGVLAGSLITAAQAAP
Ga0311340_1020776733300029943PalsaMSGFPKLSRRARWAVPVAALVVTGGVMAGSLISVAQAAPA
Ga0311371_1214576123300029951PalsaMSGFPKLSRRARWAVPVGALVVTGGVMAGSLISVAQAAPALPSRTPA
Ga0311338_1057358923300030007PalsaMSGFPKLSRRARWAVPVAALVVTGGVMAGSLISVAQAAPALPSR
Ga0311357_1040054533300030524PalsaMSGFPKLSRRARWAVPVAALVVTGGVLAGSLISVAQAAPALPSRSPAQ
Ga0310039_1008162733300030706Peatlands SoilMAGVPKLSRRTRWAVPVGVLAITGAVTAGSLISVA
Ga0302324_10169771613300031236PalsaMVAVPKLSRRARWAVPAGALVITGAVLAGSLIPAAQAAPGLPSRT
Ga0302324_10177155323300031236PalsaMSGSPKLSRRARWAVPVGALVVTGGVMAGSLISVAQAAPALPSRTP
Ga0318516_1017133013300031543SoilMVQVPKLSRRARWAIPAGALVITGGVLAGSLISSA
Ga0318515_1069545023300031572SoilMAGVPKLSRRARWAVPIGALIITGAVMAGSLISVAQASPG
Ga0318555_1011269433300031640SoilMAGVPKLSRRTRWAVPAGALAIIGAVIAGSLISVAQAS
Ga0318555_1027706123300031640SoilMVHVPKLSRRARWAVPAGVLVIVGGVLAGSLISVAQAAPGL
Ga0318561_1078884923300031679SoilMAGVPKLSRRARWAVPIGALIITGAVMAGSLISVAQ
Ga0318572_1036405513300031681SoilMVQLPKLSRRARWAIPAGALVVTGAVLAGSLITTAQAAPGLPAR
Ga0310686_11921878513300031708SoilMIAVPKLSRRARWAVPAGALVITGAVLAGSLLPAAQAAPGLPSQTP
Ga0318493_1020897013300031723SoilMAGVPKLSRRTRWAVPAGALAIIGAVIAGSLISVAQA
Ga0318500_1070851513300031724SoilMVQLPKLSRRARWAIPAGALVVTGAVLAGSLITTAQAAPSLPAR
Ga0318502_1006537313300031747SoilMVQLPKLSRRARWAVPAGALVVTGGVLAGSLISVAQA
Ga0318492_1019675333300031748SoilMVHVPKLSRRARWAVPAGVLVIVGGVLAGSLISVAQAAPGLPAR
Ga0318521_1035079813300031770SoilMVQLPKLSRRARWAVPAGALVVTGGVLAGSLISVAQAAPGLPA
Ga0318543_1028443123300031777SoilMVQLPKLSRRARWAVPAGALVVTGGVLAGSLISVAQAAPGLP
Ga0318547_1104938913300031781SoilMVQVPRLSRRARWAVPAGALVITGGILAGSLISVAQAAPGLPAKTPAQLLVEVADST
Ga0318557_1036361723300031795SoilMAGVPKLSRRARWAVPAGALAVTGAVLAGSLISVAQA
Ga0318550_1020546423300031797SoilMAGVPKLSRRARWAVPVGALAIAGAVLAGSLISVA
Ga0318550_1065789513300031797SoilMVQVPKLSRRARWAIPAGALVITGGVLAGSLFSSAQAAPGLPPRTA
Ga0318497_1044826333300031805SoilMVQVPTLSRRARWAVPAGALVITGGVMAGSLISVAQATPGLPAVTPA
Ga0306925_1003663713300031890SoilMAGVPKLSRRARWAVPVGALAIAGAVLAGSLISVAQASPGLPP
Ga0306923_1042557313300031910SoilMVQVPRLSRRARWAVPAGALVITGGILAGSLISVAQAAPGLPAKTPA
Ga0310909_1120052923300031947SoilMVQLPKLSRRARWAIPAGALVVTGAVLAGSLITTAQAAPGLPARTAAQLLAE
Ga0318563_1070677113300032009SoilMSRRARWAVPAGALVVTGGILAGTLISAAQAAPGLPARSPAQLLAEV
Ga0318559_1011514113300032039SoilMVQVPKLSRRARWAIPAGALVITGGVLAGSLISSAQAAPGL
Ga0318556_1075347713300032043SoilMVQLPKLSRRARWAIPAGALVVTGAVLAGSLITTAQAAPGLPARTAA
Ga0318505_1049639413300032060SoilMVQLPKLSRRARWAVPAGALVVTGGVLAGSLISVAQAAPGLPAR
Ga0318514_1075173813300032066SoilMAGVPKLSRRARWAVPAGALAIIGAVLAGSLISVA
Ga0306924_1148533213300032076SoilMVQVPRLSRRARWAVPAGALVITGGILAGSLISVAQAAPGLPAKTPAQLLV
Ga0311301_1009491113300032160Peatlands SoilMVQVPRLSRRARWAVPAGALVITGGVIAGSVISVAQAAPGLPARTAAELLAEV
Ga0307470_1179110623300032174Hardwood Forest SoilMTQVPKLSRRARWAIPAGALVVTGGVLAGTLISSAQAAPGL
Ga0335078_1004460813300032805SoilMLSVPKLSRRARWAVPVGALVVTGAVMAGSLISVAQG
Ga0335074_1025469533300032895SoilVTGVLKLSRRARWAVPVGALVITGAVMAGSLISVAQASPGLPP
Ga0335083_1139571313300032954SoilMVQLPKLSRRARWAIPAGALVVTGGVLAGSLITAAQATPGL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.