| Basic Information | |
|---|---|
| Family ID | F094142 |
| Family Type | Metagenome |
| Number of Sequences | 106 |
| Average Sequence Length | 45 residues |
| Representative Sequence | EPGRIYMAAIYAKSRKETLSAADRNVLAKLAANIKKAAKGGR |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 40.57 % |
| % of genes near scaffold ends (potentially truncated) | 62.26 % |
| % of genes from short scaffolds (< 2000 bps) | 87.74 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.113 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog (9.434 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.962 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (32.075 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF01381 | HTH_3 | 69.81 |
| PF12543 | DUF3738 | 2.83 |
| PF13560 | HTH_31 | 2.83 |
| PF02687 | FtsX | 0.94 |
| PF10459 | Peptidase_S46 | 0.94 |
| PF00011 | HSP20 | 0.94 |
| PF04107 | GCS2 | 0.94 |
| PF13519 | VWA_2 | 0.94 |
| PF13360 | PQQ_2 | 0.94 |
| PF05163 | DinB | 0.94 |
| PF01171 | ATP_bind_3 | 0.94 |
| PF00480 | ROK | 0.94 |
| PF04093 | MreD | 0.94 |
| PF07021 | MetW | 0.94 |
| PF03050 | DDE_Tnp_IS66 | 0.94 |
| PF15919 | HicB_lk_antitox | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.89 |
| COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 0.94 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.94 |
| COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.94 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 0.94 |
| COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 0.94 |
| COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.94 |
| COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 0.94 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.94 |
| COG2891 | Cell shape-determining protein MreD | Cell wall/membrane/envelope biogenesis [M] | 0.94 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.11 % |
| Unclassified | root | N/A | 1.89 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001546|JGI12659J15293_10108548 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300002066|JGIcombinedJ21911_10172497 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300004635|Ga0062388_100049935 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2719 | Open in IMG/M |
| 3300005340|Ga0070689_100209362 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1595 | Open in IMG/M |
| 3300005365|Ga0070688_100154224 | All Organisms → cellular organisms → Bacteria | 1572 | Open in IMG/M |
| 3300005467|Ga0070706_100932610 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 801 | Open in IMG/M |
| 3300005542|Ga0070732_10867440 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 551 | Open in IMG/M |
| 3300006086|Ga0075019_10252835 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1052 | Open in IMG/M |
| 3300006176|Ga0070765_101530754 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300006640|Ga0075527_10059029 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300006854|Ga0075425_102234626 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 609 | Open in IMG/M |
| 3300006854|Ga0075425_102982377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 518 | Open in IMG/M |
| 3300006871|Ga0075434_100790726 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300007076|Ga0075435_100341634 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
| 3300009089|Ga0099828_11456123 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300009090|Ga0099827_11381277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 613 | Open in IMG/M |
| 3300009518|Ga0116128_1220751 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300009525|Ga0116220_10458971 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300009548|Ga0116107_1197400 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300009762|Ga0116130_1161702 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300009764|Ga0116134_1195292 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 705 | Open in IMG/M |
| 3300010336|Ga0134071_10711573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 532 | Open in IMG/M |
| 3300010361|Ga0126378_12019427 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300010379|Ga0136449_101352100 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| 3300010397|Ga0134124_11095594 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300011120|Ga0150983_14857418 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300012211|Ga0137377_10853106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 843 | Open in IMG/M |
| 3300012532|Ga0137373_10746317 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300012685|Ga0137397_10919810 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300012925|Ga0137419_11598299 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300012925|Ga0137419_11927896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 507 | Open in IMG/M |
| 3300012930|Ga0137407_12335672 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300012944|Ga0137410_11043925 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300014151|Ga0181539_1022022 | All Organisms → cellular organisms → Bacteria | 3536 | Open in IMG/M |
| 3300014151|Ga0181539_1053143 | All Organisms → cellular organisms → Bacteria | 1889 | Open in IMG/M |
| 3300014151|Ga0181539_1234907 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300014152|Ga0181533_1078573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 1552 | Open in IMG/M |
| 3300014153|Ga0181527_1028696 | All Organisms → cellular organisms → Bacteria | 3369 | Open in IMG/M |
| 3300014156|Ga0181518_10260153 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300014156|Ga0181518_10486682 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300014169|Ga0181531_10485610 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300014490|Ga0182010_10689591 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 574 | Open in IMG/M |
| 3300014496|Ga0182011_10599422 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300014501|Ga0182024_10000395 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 112674 | Open in IMG/M |
| 3300014502|Ga0182021_12755093 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300014638|Ga0181536_10251691 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 845 | Open in IMG/M |
| 3300014655|Ga0181516_10519331 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300014839|Ga0182027_10084026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3876 | Open in IMG/M |
| 3300014839|Ga0182027_10110113 | All Organisms → cellular organisms → Bacteria | 3303 | Open in IMG/M |
| 3300014839|Ga0182027_11944109 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300014839|Ga0182027_12166012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 528 | Open in IMG/M |
| 3300017929|Ga0187849_1393711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 506 | Open in IMG/M |
| 3300017935|Ga0187848_10055751 | All Organisms → cellular organisms → Bacteria | 1887 | Open in IMG/M |
| 3300017940|Ga0187853_10097810 | All Organisms → cellular organisms → Bacteria | 1447 | Open in IMG/M |
| 3300017955|Ga0187817_10085823 | All Organisms → cellular organisms → Bacteria | 1971 | Open in IMG/M |
| 3300017970|Ga0187783_10690022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 737 | Open in IMG/M |
| 3300018007|Ga0187805_10260827 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300018017|Ga0187872_10318783 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300018025|Ga0187885_10453366 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300018025|Ga0187885_10457295 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300018035|Ga0187875_10152761 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
| 3300018040|Ga0187862_10063220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2650 | Open in IMG/M |
| 3300018046|Ga0187851_10861539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 509 | Open in IMG/M |
| 3300018057|Ga0187858_10246132 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300019788|Ga0182028_1288586 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300020083|Ga0194111_10191940 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
| 3300021090|Ga0210377_10757786 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300021406|Ga0210386_11075225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 684 | Open in IMG/M |
| 3300021474|Ga0210390_10135778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 2068 | Open in IMG/M |
| 3300023091|Ga0224559_1051669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1623 | Open in IMG/M |
| 3300023258|Ga0224535_1133439 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300025936|Ga0207670_10085658 | All Organisms → cellular organisms → Bacteria | 2215 | Open in IMG/M |
| 3300025942|Ga0207689_11064503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 682 | Open in IMG/M |
| 3300025949|Ga0207667_11844367 | Not Available | 568 | Open in IMG/M |
| 3300026273|Ga0209881_1023658 | All Organisms → cellular organisms → Bacteria | 1471 | Open in IMG/M |
| 3300027565|Ga0209219_1162176 | Not Available | 534 | Open in IMG/M |
| 3300027829|Ga0209773_10265324 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 717 | Open in IMG/M |
| 3300027842|Ga0209580_10567721 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300027895|Ga0209624_10187680 | All Organisms → cellular organisms → Bacteria | 1372 | Open in IMG/M |
| 3300027898|Ga0209067_10211026 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300029943|Ga0311340_10874296 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300029990|Ga0311336_10439866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1098 | Open in IMG/M |
| 3300030688|Ga0311345_10178316 | All Organisms → cellular organisms → Bacteria | 2204 | Open in IMG/M |
| 3300031057|Ga0170834_107213078 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300031234|Ga0302325_11089769 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300031234|Ga0302325_11867784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 749 | Open in IMG/M |
| 3300031236|Ga0302324_100974907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1156 | Open in IMG/M |
| 3300031344|Ga0265316_11117123 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300031525|Ga0302326_10567077 | All Organisms → cellular organisms → Bacteria | 1699 | Open in IMG/M |
| 3300031708|Ga0310686_113031154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1211 | Open in IMG/M |
| 3300031712|Ga0265342_10680360 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300031726|Ga0302321_101149173 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300032069|Ga0315282_10397607 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300032782|Ga0335082_11448853 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300032783|Ga0335079_10020970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 7485 | Open in IMG/M |
| 3300032783|Ga0335079_10294222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1773 | Open in IMG/M |
| 3300032805|Ga0335078_10277103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2270 | Open in IMG/M |
| 3300032805|Ga0335078_11450487 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300032892|Ga0335081_12485593 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300033158|Ga0335077_10605721 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300033402|Ga0326728_10423349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1123 | Open in IMG/M |
| 3300033402|Ga0326728_10507220 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 978 | Open in IMG/M |
| 3300033483|Ga0316629_11463881 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300033822|Ga0334828_092680 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300033888|Ga0334792_082250 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300033977|Ga0314861_0062870 | All Organisms → cellular organisms → Bacteria | 2005 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 9.43% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 9.43% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.49% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 7.55% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 7.55% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.72% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.77% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.77% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 3.77% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.77% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.83% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.89% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.89% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.89% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.89% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.89% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.89% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.89% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.89% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.94% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.94% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.94% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.94% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.94% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.94% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.94% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
| 3300002066 | Barrow Graham LP Ref core NGADG0002-211 (Barrow Graham LP Ref core NGADG0002-211,NGADG0004-311, ASSEMBLY_DATE=20131004) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006640 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
| 3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300023091 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34 | Environmental | Open in IMG/M |
| 3300023258 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 30-34 | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026273 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300032069 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033822 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 5-9 | Environmental | Open in IMG/M |
| 3300033888 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1 | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12659J15293_101085482 | 3300001546 | Forest Soil | GYRVIYFFLAEPGRIYMAAIYAKARKETLSAADQKILAKLAAQIKITTKGKQ* |
| JGIcombinedJ21911_101724972 | 3300002066 | Arctic Peat Soil | GFRVVYFFLSEPGRIYMAAIYAKSRKETLSAADRNVLARLAAQIKKAAKGGR* |
| Ga0062388_1000499352 | 3300004635 | Bog Forest Soil | VVYFLLPEPGRIYMAAIYAKSRKDTLSGADHNVLAKLAGQIKKAAKGRR* |
| Ga0070689_1002093623 | 3300005340 | Switchgrass Rhizosphere | VIYFFVVEPGRIYIASVFAKSRRQNLSAADQNVLAKIDAQIKAAAKGGRL* |
| Ga0070688_1001542241 | 3300005365 | Switchgrass Rhizosphere | IYIASVFAKSRRQNLSAADQNVLAKIDAQIKAAAKGGRL* |
| Ga0070706_1009326102 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VVYFFLAKPGRIYMAAIYAKSRIDALSAADQNVLARLAAEIKKAGRGGRK* |
| Ga0070732_108674402 | 3300005542 | Surface Soil | RIFMAAIYAKSRKETLSGADQNVLTKLAAEIKKAVKGGR* |
| Ga0075019_102528351 | 3300006086 | Watersheds | FFVVEPGRIYMASIYAKSRKANLSADDQGVLAKIAAHLKKAAK* |
| Ga0070765_1015307541 | 3300006176 | Soil | VIYYFLREPGQIFMAAIYAKSRKETLSRDDQNVLAKLAAQIKKAAKGGR* |
| Ga0075527_100590293 | 3300006640 | Arctic Peat Soil | VVYFFLGEPGRIYMAAIYAKSRKETLSAADRNVLARLAAQIKKAAKGWR* |
| Ga0075425_1022346262 | 3300006854 | Populus Rhizosphere | PGRIYMAAIYAKSRMDALSAADQNVLARLAAEIKKAGRGGRK* |
| Ga0075425_1029823772 | 3300006854 | Populus Rhizosphere | MASIYAKSGKATLSAADQNVLAKLAAQIKKAAKGGQ* |
| Ga0075434_1007907263 | 3300006871 | Populus Rhizosphere | YFLLAKPGRIYMAAIYAKSRQETLSAADQNVLAKLGAQIKRASKGGK* |
| Ga0075435_1003416341 | 3300007076 | Populus Rhizosphere | VKSGGFRVVYFFLAKPGRIYMAAIYAKSRMDALSAADQNVLARLAAEIKKAGRGGRK* |
| Ga0099828_114561231 | 3300009089 | Vadose Zone Soil | LLYSGTGRIYMASIYAKSRKQTLSAADQNVLAKLAAKIKVAVKGDRRT* |
| Ga0099827_113812772 | 3300009090 | Vadose Zone Soil | VVYFFLPSRGGFYMAAIYAKSRKDTLSAADQNVLAKLAAQIKKAAKGGR* |
| Ga0116128_12207512 | 3300009518 | Peatland | AGPGCVYMAAAYAKSRKQTLSAADQNVLAKLAAQIKRAAKGGH* |
| Ga0116220_104589712 | 3300009525 | Peatlands Soil | AIYAKSRRETLSAADRNVLAKLAAQIKKTGKGGRYS* |
| Ga0116107_11974002 | 3300009548 | Peatland | FFLAGPGCVYMAAAYAKSRKQTLSAADQNVLAKLAAQIKRAAKGGH* |
| Ga0116130_11617021 | 3300009762 | Peatland | SIDAKSRKETLSAADRNVLAKLAARIKRAVKGGR* |
| Ga0116134_11952922 | 3300009764 | Peatland | VVYFFLAEPGRIYMAAIYAKSRKETLSAADQNVLAKLAAQIKKAARGGQ* |
| Ga0134071_107115731 | 3300010336 | Grasslands Soil | MAAIYAKSRKDTLSAADQNVLARLAAQIKKAAKAGR* |
| Ga0126378_120194272 | 3300010361 | Tropical Forest Soil | MAAIYAKSRQETLSMADQSVLAKLATEIKRTVRKGR* |
| Ga0136449_1013521001 | 3300010379 | Peatlands Soil | VFMAAIYAKSRMENLSAADQNVLAKLAAQIKKTTKGRR* |
| Ga0134124_110955941 | 3300010397 | Terrestrial Soil | AAASASSYYFVAEPGQIFMAAIYAKSRKETLSAADQNVLIKLAAQIKKAAKGGR* |
| Ga0150983_148574181 | 3300011120 | Forest Soil | AAIYAKSRMDNLSAADQNVLAKIAAQIKKATRGGR* |
| Ga0137377_108531062 | 3300012211 | Vadose Zone Soil | VVYFFRAEPGTLYMAGIYAKSRKDTLSAADQNVLAKLAAQIKKAAKGGQ* |
| Ga0137373_107463171 | 3300012532 | Vadose Zone Soil | IYYFTAEPGRIYLASIYAKSQRENLSAADQNVLAKLAAQIKRASKGGR* |
| Ga0137397_109198102 | 3300012685 | Vadose Zone Soil | FMAAIYAKSRKDTLSASDRNVLAKLAAQIKRAAKGGQ* |
| Ga0137419_115982991 | 3300012925 | Vadose Zone Soil | EPGRIYMASIYAKSRKQTLSAADQNVLAKLATQIKGALKGDRKT* |
| Ga0137419_119278962 | 3300012925 | Vadose Zone Soil | MAAIYAKSRKETLSAADQNVLAKLAAQINKAAKGAR* |
| Ga0137407_123356722 | 3300012930 | Vadose Zone Soil | FFLAEPGRIYMAGIYAKSRQASLSAADQNVLAKLAAQLKKAAKGA* |
| Ga0137410_110439253 | 3300012944 | Vadose Zone Soil | YFFLTEPGQIFMAAIYAKLRKETLSAADQNVLAKLAAQIKKAAKGAR* |
| Ga0181539_10220222 | 3300014151 | Bog | VIYFFMAEPGRIFMAAIYAKSRKENLSAANQNVLAKLAAQIKKAAKGGR* |
| Ga0181539_10531432 | 3300014151 | Bog | VAPKSGGLRVIYFFLAQPERVFMASIYAKSRKETLSAADQNVLAKLAAQIKKAAEGGR* |
| Ga0181539_12349071 | 3300014151 | Bog | VVYFFLAEPERVFMASIYAKSRKETLSAADRNVLAELAAQIKKAAKGGR* |
| Ga0181533_10785735 | 3300014152 | Bog | VAPKSGGLRVIYFFLAQPERVFMASIYAKSRKETLSAADQNVLAKLAAQIKKAA |
| Ga0181527_10286963 | 3300014153 | Bog | VAPKSGGLRVIYFFLAQPERVFMASIYAKSRKETLSAADQNVLAKLAAQIKKAAKGGR* |
| Ga0181518_102601533 | 3300014156 | Bog | YMASIDAKSRKETLSAAVRNVLAKLAARIKRAVKGGR* |
| Ga0181518_104866822 | 3300014156 | Bog | FLAEPGRIYMAAIYAKSRMETLSAADRNVLAKLAAQIKKAAKGR* |
| Ga0181531_104856102 | 3300014169 | Bog | MAAIYAKSRMETLSAADRNVLAKLAAQIKKAAKGG* |
| Ga0182010_106895911 | 3300014490 | Fen | GFRVIYFFLAEPGRIYMAAIYAKSRKETLSATDRNVLAKLAASIKKAAKGGR* |
| Ga0182011_105994222 | 3300014496 | Fen | RVHMATIYAKSRKETLSAADRNVLARLAAQIKRAAKGGRRS* |
| Ga0182024_1000039565 | 3300014501 | Permafrost | VIYFFLAEPGRIYMAAIYAKAQKESLSAADQKVLAKLAVQIKNAAKGG* |
| Ga0182021_127550932 | 3300014502 | Fen | FMAAIYAKSRKETLSAADRNVLAKLAVQIKKAAKGGR* |
| Ga0181536_102516913 | 3300014638 | Bog | VIYFFMAEPGRIFMAAIYAKSRKENLSAANQNVLAKLAAQ |
| Ga0181516_105193311 | 3300014655 | Bog | LAEPGRIYMAAIYAKSRMETLSAADRNVLAKLAAQIKKAAKGG* |
| Ga0182027_100840265 | 3300014839 | Fen | VIYFFLAEPGRIYMAAIYAKSRKETLSAADRNVLAKLAASIKKVAKGGR* |
| Ga0182027_101101131 | 3300014839 | Fen | EPGRIYMAAIYAKSRKETLSAADRNVLAKLAANIKKAAKGGR* |
| Ga0182027_119441092 | 3300014839 | Fen | MASIYAKSRRENLSAADRNVLAKLAARIKRAVKGGR* |
| Ga0182027_121660122 | 3300014839 | Fen | LRVVYFFLAEPERVYMASIYAKSRKETLSAADRNVLAKLAAQIKK |
| Ga0187849_13937111 | 3300017929 | Peatland | MASIYAKSRKETLSAADRNVLAKLAAQIKKAAKGGR |
| Ga0187848_100557513 | 3300017935 | Peatland | MAAIYAKSRKENLSAANQNVLAKLAAQIKKAAKGGR |
| Ga0187853_100978103 | 3300017940 | Peatland | VAPKSGNLRVIYFFLAEPERVFMASIYAKSRKETLSAADQNVLAKLAAQIKKAAKGGR |
| Ga0187817_100858232 | 3300017955 | Freshwater Sediment | MAAIYAKTSKQNLSAADQNILVKLAAQIKKASKKGS |
| Ga0187783_106900221 | 3300017970 | Tropical Peatland | IYLFLPAPQRIYMAMIYHKSRKETLSAADKKVLATLAGQIKTAAKKG |
| Ga0187805_102608271 | 3300018007 | Freshwater Sediment | LAEPGRIYMAAIYAKTSKQNLSAADQNILVKLAAQIKKASKKGS |
| Ga0187872_103187832 | 3300018017 | Peatland | AAPGRIYMAAIYAKSRKETLSSADRNVLAKLAAQIKRAAKGGR |
| Ga0187885_104533661 | 3300018025 | Peatland | IYMALIYAKSRMETLSDADRNVLAKIAAQIKKAAKGGR |
| Ga0187885_104572952 | 3300018025 | Peatland | RVVYFFLAEPERVFMASIYAKSRKETLSAADQNVLAKLATQIKKAARGGR |
| Ga0187875_101527613 | 3300018035 | Peatland | VIYYFLAEPGRIYMAAIYAKSRMETLSAADRNVLAKLAAQIKKAVKGG |
| Ga0187862_100632206 | 3300018040 | Peatland | YFFLTEPGRIYMALIYAKSRMETLSDADRNVLAKIAAQIKKAAKGGR |
| Ga0187851_108615392 | 3300018046 | Peatland | VIYFFLAEPGRIYMAGIYAKSRKETLPQADQNVLVKIAAQIKRAAKEGRQT |
| Ga0187858_102461323 | 3300018057 | Peatland | LRLVYFFLAEPERVYMASIYAKSRKETLSAADRNVLARLATQIKKAAKGGR |
| Ga0182028_12885862 | 3300019788 | Fen | VIYFFLAEPGRIYMAAIYAKSRKETLSAADRNVLAKLAASIKKVAKGGR |
| Ga0194111_101919401 | 3300020083 | Freshwater Lake | MAAIYAKSRKDTLSAADQNVLLKIAAEIKKAAKGGR |
| Ga0210377_107577862 | 3300021090 | Groundwater Sediment | MAAIYAKSRKDTLTAADQNVLAKLAAQIEKAAKGGR |
| Ga0210386_110752253 | 3300021406 | Soil | FLSEPRIYIAAIYAKSRKEMLSMAHQNVLAKLASQIKKAAKK |
| Ga0210390_101357784 | 3300021474 | Soil | EPGRIYIAAIYAKSRKETLSKADQNVLAKLASQIKKAAKK |
| Ga0224559_10516693 | 3300023091 | Soil | FRVIYFLLAEPGRVYMAGIYAKSRKDALSGADQNVLARLAAQIKKAAKGGR |
| Ga0224535_11334393 | 3300023258 | Soil | AGPGQVYMASIYAKSRKETLSAADQNVLAKLAAEIKRAVKGGR |
| Ga0207670_100856583 | 3300025936 | Switchgrass Rhizosphere | VIYFFVVEPGRIYIASVFAKSRRQNLSAADQNVLAKIDAQIKAAAKGGRL |
| Ga0207689_110645031 | 3300025942 | Miscanthus Rhizosphere | YMSAIYAKSQKENLSAADRHVLAKLAAQIKKAAKRGRH |
| Ga0207667_118443672 | 3300025949 | Corn Rhizosphere | MAAIYAKSQKENLSPADQKLLATLAAQIKRAAKGEG |
| Ga0209881_10236583 | 3300026273 | Soil | LSEPGRIYMAAIYAKSRKDTLSAADRNVLARLAAQIKKAAKGRR |
| Ga0209219_11621761 | 3300027565 | Forest Soil | VIYFFLTEPGRIYMASIYAKSQRETLSAADQNVLA |
| Ga0209773_102653241 | 3300027829 | Bog Forest Soil | GLRVVYFLLPEPGRIYMAAIYAKSRKDTLSGADHNVLAKLAGQIKKAAKGRR |
| Ga0209580_105677212 | 3300027842 | Surface Soil | GRIFMAAIYAKSRKETLSGADQNVLTKLAAEIKKAVKGGR |
| Ga0209624_101876803 | 3300027895 | Forest Soil | VVYFFLAEPGRIYMAAIYAKSQKDTLSAADQNVLAKLAAQIKKAAKGGR |
| Ga0209067_102110263 | 3300027898 | Watersheds | FFVVEPGRIYMASIYAKSRKANLSADDQGVLAKIAAHLKKAAK |
| Ga0311340_108742961 | 3300029943 | Palsa | MAAIHAKSRKETLSGSDQNLLAKLAAQIKKAARGER |
| Ga0311336_104398663 | 3300029990 | Fen | VYFFVAELGRIYMAAIYAKSRKETLSAADRNVLARLAAQIKKAAKGGR |
| Ga0311345_101783167 | 3300030688 | Bog | FFLAEPGRIYMAAIYAKSRVDSLSAADNNVLAKIAAQIKKAAKEGE |
| Ga0170834_1072130781 | 3300031057 | Forest Soil | GFRAVYFFLAGPGRIYMAAIYAKSRKETLSGADQNALAKLAAQIKKAVKGGV |
| Ga0302325_110897691 | 3300031234 | Palsa | VIYFFLSAPGRIYMADIYAKSRKETLSAADQHALARLAAQIKRAAKEGNNHGYAHCEYGNQGPDQARHS |
| Ga0302325_118677841 | 3300031234 | Palsa | VIYFFLVSPGTLYMAGAYAKARKETLSGADQNVLAKLAARIKK |
| Ga0302324_1009749073 | 3300031236 | Palsa | MAAIYAKSRVDSLSAADNNLLAKIAAQIKQGAKEGERS |
| Ga0265316_111171233 | 3300031344 | Rhizosphere | RVIYFFLSPPGLIYMASVYAKSRKETLSAADRNVLAKLASEIKRAAQGGR |
| Ga0302326_105670771 | 3300031525 | Palsa | VIYFFLSAPGRIYMADIYAKSRKETLSAADQHALARLAAQIKRAAKEGSNHGYAHCEYGN |
| Ga0310686_1130311543 | 3300031708 | Soil | YMAAIYEKSRMENLSAADQNVLAKLAAQIKKAAKGEP |
| Ga0265342_106803601 | 3300031712 | Rhizosphere | SGPGSIYMASVYAKSRKETLSAADRNVLAKLASQIKRAARGGR |
| Ga0302321_1011491732 | 3300031726 | Fen | MAAIYAKSRMETLSAADRNVLAKLAAQIKKAAKGGG |
| Ga0315282_103976071 | 3300032069 | Sediment | VVYFFLPELGRIYMAAIYAKSRKGTLSAADQNVLAKLAAQIKKAAKGGR |
| Ga0335082_114488532 | 3300032782 | Soil | FRTVYFFLAQPGRIYMAAIYAKSRKETLSGADQNVLAKLAAQIKKAAKGGQ |
| Ga0335079_100209709 | 3300032783 | Soil | VRGVVYFFLAEPGRIYMAAIYAKSQKETLSAADQNVLAKLAAQIKKAARGGQ |
| Ga0335079_102942221 | 3300032783 | Soil | RIYMAAIYAKSRKDTLSAADRNVLAKLAAQIKKAAKGRG |
| Ga0335078_102771035 | 3300032805 | Soil | MAAIYAKSRKDTLSAADRNVLAKLAAQIKKAAKGRG |
| Ga0335078_114504872 | 3300032805 | Soil | VIYVFLAEPGRIYMAAIYAKSRKGTLSAADQHVLAKLAAQIKKAAKGGR |
| Ga0335081_124855931 | 3300032892 | Soil | PGQVFMAAIYAKSRMENLSAADQNVLAKLAAQIKQTTKGRR |
| Ga0335077_106057211 | 3300033158 | Soil | AEPGRIYMAAIYAKSRKDTLSAADRNVLAKLAAQIKKAAKGRG |
| Ga0326728_104233491 | 3300033402 | Peat Soil | VAPKSGGLRVIYFFLAQPERVFMASIYAKSRKETLSAADQNVLAKLAAQIKKAAKGGR |
| Ga0326728_105072203 | 3300033402 | Peat Soil | GFRVIYFFLAEPGRIYMAAIYAKSRKESLSAADRNVLAKLAASIKKVAKGGR |
| Ga0316629_114638811 | 3300033483 | Soil | LTGPGCIYMAGINAKSRQKELSMADQNVLAKLAAQIKKTTKGGQ |
| Ga0334828_092680_106_261 | 3300033822 | Soil | VVYFFLAEPGRIYMAAIYAKSRKDTLSAADRNVLAKLAAQIKKESKGGRQS |
| Ga0334792_082250_50_205 | 3300033888 | Soil | LRVVYFFLAEPERVYMASIYAKSRKETLSAADRNVLAKLAAQIKKVTKGGR |
| Ga0314861_0062870_274_396 | 3300033977 | Peatland | VKRAQLAAVYAKSRRETLSAADRNTLAKLAAEIKKAAKGG |
| ⦗Top⦘ |