NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F094142

Metagenome Family F094142

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F094142
Family Type Metagenome
Number of Sequences 106
Average Sequence Length 45 residues
Representative Sequence EPGRIYMAAIYAKSRKETLSAADRNVLAKLAANIKKAAKGGR
Number of Associated Samples 93
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 40.57 %
% of genes near scaffold ends (potentially truncated) 62.26 %
% of genes from short scaffolds (< 2000 bps) 87.74 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.113 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog
(9.434 % of family members)
Environment Ontology (ENVO) Unclassified
(33.962 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(32.075 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 50.00%    β-sheet: 0.00%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF01381HTH_3 69.81
PF12543DUF3738 2.83
PF13560HTH_31 2.83
PF02687FtsX 0.94
PF10459Peptidase_S46 0.94
PF00011HSP20 0.94
PF04107GCS2 0.94
PF13519VWA_2 0.94
PF13360PQQ_2 0.94
PF05163DinB 0.94
PF01171ATP_bind_3 0.94
PF00480ROK 0.94
PF04093MreD 0.94
PF07021MetW 0.94
PF03050DDE_Tnp_IS66 0.94
PF15919HicB_lk_antitox 0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG1940Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domainTranscription [K] 1.89
COG0037tRNA(Ile)-lysidine synthase TilS/MesJTranslation, ribosomal structure and biogenesis [J] 0.94
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 0.94
COG0301Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis)Translation, ribosomal structure and biogenesis [J] 0.94
COG0482tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domainTranslation, ribosomal structure and biogenesis [J] 0.94
COG0519GMP synthase, PP-ATPase domain/subunitNucleotide transport and metabolism [F] 0.94
COG06037-cyano-7-deazaguanine synthase (queuosine biosynthesis)Translation, ribosomal structure and biogenesis [J] 0.94
COG1606ATP-utilizing enzyme, PP-loop superfamilyGeneral function prediction only [R] 0.94
COG2318Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB)Secondary metabolites biosynthesis, transport and catabolism [Q] 0.94
COG2891Cell shape-determining protein MreDCell wall/membrane/envelope biogenesis [M] 0.94
COG3436TransposaseMobilome: prophages, transposons [X] 0.94

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.11 %
UnclassifiedrootN/A1.89 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001546|JGI12659J15293_10108548All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300002066|JGIcombinedJ21911_10172497All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300004635|Ga0062388_100049935All Organisms → cellular organisms → Bacteria → Proteobacteria2719Open in IMG/M
3300005340|Ga0070689_100209362All Organisms → cellular organisms → Bacteria → Proteobacteria1595Open in IMG/M
3300005365|Ga0070688_100154224All Organisms → cellular organisms → Bacteria1572Open in IMG/M
3300005467|Ga0070706_100932610All Organisms → cellular organisms → Bacteria → Proteobacteria801Open in IMG/M
3300005542|Ga0070732_10867440All Organisms → cellular organisms → Bacteria → Proteobacteria551Open in IMG/M
3300006086|Ga0075019_10252835All Organisms → cellular organisms → Bacteria → Proteobacteria1052Open in IMG/M
3300006176|Ga0070765_101530754All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300006640|Ga0075527_10059029All Organisms → cellular organisms → Bacteria1038Open in IMG/M
3300006854|Ga0075425_102234626All Organisms → cellular organisms → Bacteria → Proteobacteria609Open in IMG/M
3300006854|Ga0075425_102982377All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4518Open in IMG/M
3300006871|Ga0075434_100790726All Organisms → cellular organisms → Bacteria965Open in IMG/M
3300007076|Ga0075435_100341634All Organisms → cellular organisms → Bacteria1283Open in IMG/M
3300009089|Ga0099828_11456123All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300009090|Ga0099827_11381277All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4613Open in IMG/M
3300009518|Ga0116128_1220751All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300009525|Ga0116220_10458971All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300009548|Ga0116107_1197400All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300009762|Ga0116130_1161702All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300009764|Ga0116134_1195292All Organisms → cellular organisms → Bacteria → Proteobacteria705Open in IMG/M
3300010336|Ga0134071_10711573All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4532Open in IMG/M
3300010361|Ga0126378_12019427All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300010379|Ga0136449_101352100All Organisms → cellular organisms → Bacteria1105Open in IMG/M
3300010397|Ga0134124_11095594All Organisms → cellular organisms → Bacteria813Open in IMG/M
3300011120|Ga0150983_14857418All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300012211|Ga0137377_10853106All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria843Open in IMG/M
3300012532|Ga0137373_10746317All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300012685|Ga0137397_10919810All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300012925|Ga0137419_11598299All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300012925|Ga0137419_11927896All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4507Open in IMG/M
3300012930|Ga0137407_12335672All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300012944|Ga0137410_11043925All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300014151|Ga0181539_1022022All Organisms → cellular organisms → Bacteria3536Open in IMG/M
3300014151|Ga0181539_1053143All Organisms → cellular organisms → Bacteria1889Open in IMG/M
3300014151|Ga0181539_1234907All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300014152|Ga0181533_1078573All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium1552Open in IMG/M
3300014153|Ga0181527_1028696All Organisms → cellular organisms → Bacteria3369Open in IMG/M
3300014156|Ga0181518_10260153All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300014156|Ga0181518_10486682All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300014169|Ga0181531_10485610All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300014490|Ga0182010_10689591All Organisms → cellular organisms → Bacteria → Proteobacteria574Open in IMG/M
3300014496|Ga0182011_10599422All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300014501|Ga0182024_10000395All Organisms → cellular organisms → Bacteria → Acidobacteria112674Open in IMG/M
3300014502|Ga0182021_12755093All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300014638|Ga0181536_10251691All Organisms → cellular organisms → Bacteria → Acidobacteria845Open in IMG/M
3300014655|Ga0181516_10519331All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300014839|Ga0182027_10084026All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3876Open in IMG/M
3300014839|Ga0182027_10110113All Organisms → cellular organisms → Bacteria3303Open in IMG/M
3300014839|Ga0182027_11944109All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300014839|Ga0182027_12166012All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4528Open in IMG/M
3300017929|Ga0187849_1393711All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4506Open in IMG/M
3300017935|Ga0187848_10055751All Organisms → cellular organisms → Bacteria1887Open in IMG/M
3300017940|Ga0187853_10097810All Organisms → cellular organisms → Bacteria1447Open in IMG/M
3300017955|Ga0187817_10085823All Organisms → cellular organisms → Bacteria1971Open in IMG/M
3300017970|Ga0187783_10690022All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus737Open in IMG/M
3300018007|Ga0187805_10260827All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300018017|Ga0187872_10318783All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300018025|Ga0187885_10453366All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300018025|Ga0187885_10457295All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300018035|Ga0187875_10152761All Organisms → cellular organisms → Bacteria1291Open in IMG/M
3300018040|Ga0187862_10063220All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2650Open in IMG/M
3300018046|Ga0187851_10861539All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4509Open in IMG/M
3300018057|Ga0187858_10246132All Organisms → cellular organisms → Bacteria1149Open in IMG/M
3300019788|Ga0182028_1288586All Organisms → cellular organisms → Bacteria1091Open in IMG/M
3300020083|Ga0194111_10191940All Organisms → cellular organisms → Bacteria1504Open in IMG/M
3300021090|Ga0210377_10757786All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300021406|Ga0210386_11075225All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales684Open in IMG/M
3300021474|Ga0210390_10135778All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales2068Open in IMG/M
3300023091|Ga0224559_1051669All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter1623Open in IMG/M
3300023258|Ga0224535_1133439All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300025936|Ga0207670_10085658All Organisms → cellular organisms → Bacteria2215Open in IMG/M
3300025942|Ga0207689_11064503All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae682Open in IMG/M
3300025949|Ga0207667_11844367Not Available568Open in IMG/M
3300026273|Ga0209881_1023658All Organisms → cellular organisms → Bacteria1471Open in IMG/M
3300027565|Ga0209219_1162176Not Available534Open in IMG/M
3300027829|Ga0209773_10265324All Organisms → cellular organisms → Bacteria → Proteobacteria717Open in IMG/M
3300027842|Ga0209580_10567721All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300027895|Ga0209624_10187680All Organisms → cellular organisms → Bacteria1372Open in IMG/M
3300027898|Ga0209067_10211026All Organisms → cellular organisms → Bacteria1046Open in IMG/M
3300029943|Ga0311340_10874296All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300029990|Ga0311336_10439866All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1098Open in IMG/M
3300030688|Ga0311345_10178316All Organisms → cellular organisms → Bacteria2204Open in IMG/M
3300031057|Ga0170834_107213078All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300031234|Ga0302325_11089769All Organisms → cellular organisms → Bacteria1078Open in IMG/M
3300031234|Ga0302325_11867784All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4749Open in IMG/M
3300031236|Ga0302324_100974907All Organisms → cellular organisms → Bacteria → Acidobacteria1156Open in IMG/M
3300031344|Ga0265316_11117123All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300031525|Ga0302326_10567077All Organisms → cellular organisms → Bacteria1699Open in IMG/M
3300031708|Ga0310686_113031154All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1211Open in IMG/M
3300031712|Ga0265342_10680360All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300031726|Ga0302321_101149173All Organisms → cellular organisms → Bacteria888Open in IMG/M
3300032069|Ga0315282_10397607All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300032782|Ga0335082_11448853All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300032783|Ga0335079_10020970All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus7485Open in IMG/M
3300032783|Ga0335079_10294222All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1773Open in IMG/M
3300032805|Ga0335078_10277103All Organisms → cellular organisms → Bacteria → Acidobacteria2270Open in IMG/M
3300032805|Ga0335078_11450487All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300032892|Ga0335081_12485593All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300033158|Ga0335077_10605721All Organisms → cellular organisms → Bacteria1142Open in IMG/M
3300033402|Ga0326728_10423349All Organisms → cellular organisms → Bacteria → Acidobacteria1123Open in IMG/M
3300033402|Ga0326728_10507220All Organisms → cellular organisms → Bacteria → Proteobacteria978Open in IMG/M
3300033483|Ga0316629_11463881All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300033822|Ga0334828_092680All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300033888|Ga0334792_082250All Organisms → cellular organisms → Bacteria923Open in IMG/M
3300033977|Ga0314861_0062870All Organisms → cellular organisms → Bacteria2005Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland9.43%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog9.43%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.49%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil7.55%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen7.55%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.72%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.77%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.77%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil3.77%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.77%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.83%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.89%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.89%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.89%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.89%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.89%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.89%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.89%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.89%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.89%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.94%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.94%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.94%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.94%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.94%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.94%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.94%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.94%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.94%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.94%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.94%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.94%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001546Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1EnvironmentalOpen in IMG/M
3300002066Barrow Graham LP Ref core NGADG0002-211 (Barrow Graham LP Ref core NGADG0002-211,NGADG0004-311, ASSEMBLY_DATE=20131004)EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006640Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11BEnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009548Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100EnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014152Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaGEnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300019788Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020083Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300mEnvironmentalOpen in IMG/M
3300021090Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redoEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300023091Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34EnvironmentalOpen in IMG/M
3300023258Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 30-34EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026273Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 (SPAdes)EnvironmentalOpen in IMG/M
3300027565Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027829Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300032069Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033483Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_AEnvironmentalOpen in IMG/M
3300033822Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 5-9EnvironmentalOpen in IMG/M
3300033888Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1EnvironmentalOpen in IMG/M
3300033977Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12659J15293_1010854823300001546Forest SoilGYRVIYFFLAEPGRIYMAAIYAKARKETLSAADQKILAKLAAQIKITTKGKQ*
JGIcombinedJ21911_1017249723300002066Arctic Peat SoilGFRVVYFFLSEPGRIYMAAIYAKSRKETLSAADRNVLARLAAQIKKAAKGGR*
Ga0062388_10004993523300004635Bog Forest SoilVVYFLLPEPGRIYMAAIYAKSRKDTLSGADHNVLAKLAGQIKKAAKGRR*
Ga0070689_10020936233300005340Switchgrass RhizosphereVIYFFVVEPGRIYIASVFAKSRRQNLSAADQNVLAKIDAQIKAAAKGGRL*
Ga0070688_10015422413300005365Switchgrass RhizosphereIYIASVFAKSRRQNLSAADQNVLAKIDAQIKAAAKGGRL*
Ga0070706_10093261023300005467Corn, Switchgrass And Miscanthus RhizosphereVVYFFLAKPGRIYMAAIYAKSRIDALSAADQNVLARLAAEIKKAGRGGRK*
Ga0070732_1086744023300005542Surface SoilRIFMAAIYAKSRKETLSGADQNVLTKLAAEIKKAVKGGR*
Ga0075019_1025283513300006086WatershedsFFVVEPGRIYMASIYAKSRKANLSADDQGVLAKIAAHLKKAAK*
Ga0070765_10153075413300006176SoilVIYYFLREPGQIFMAAIYAKSRKETLSRDDQNVLAKLAAQIKKAAKGGR*
Ga0075527_1005902933300006640Arctic Peat SoilVVYFFLGEPGRIYMAAIYAKSRKETLSAADRNVLARLAAQIKKAAKGWR*
Ga0075425_10223462623300006854Populus RhizospherePGRIYMAAIYAKSRMDALSAADQNVLARLAAEIKKAGRGGRK*
Ga0075425_10298237723300006854Populus RhizosphereMASIYAKSGKATLSAADQNVLAKLAAQIKKAAKGGQ*
Ga0075434_10079072633300006871Populus RhizosphereYFLLAKPGRIYMAAIYAKSRQETLSAADQNVLAKLGAQIKRASKGGK*
Ga0075435_10034163413300007076Populus RhizosphereVKSGGFRVVYFFLAKPGRIYMAAIYAKSRMDALSAADQNVLARLAAEIKKAGRGGRK*
Ga0099828_1145612313300009089Vadose Zone SoilLLYSGTGRIYMASIYAKSRKQTLSAADQNVLAKLAAKIKVAVKGDRRT*
Ga0099827_1138127723300009090Vadose Zone SoilVVYFFLPSRGGFYMAAIYAKSRKDTLSAADQNVLAKLAAQIKKAAKGGR*
Ga0116128_122075123300009518PeatlandAGPGCVYMAAAYAKSRKQTLSAADQNVLAKLAAQIKRAAKGGH*
Ga0116220_1045897123300009525Peatlands SoilAIYAKSRRETLSAADRNVLAKLAAQIKKTGKGGRYS*
Ga0116107_119740023300009548PeatlandFFLAGPGCVYMAAAYAKSRKQTLSAADQNVLAKLAAQIKRAAKGGH*
Ga0116130_116170213300009762PeatlandSIDAKSRKETLSAADRNVLAKLAARIKRAVKGGR*
Ga0116134_119529223300009764PeatlandVVYFFLAEPGRIYMAAIYAKSRKETLSAADQNVLAKLAAQIKKAARGGQ*
Ga0134071_1071157313300010336Grasslands SoilMAAIYAKSRKDTLSAADQNVLARLAAQIKKAAKAGR*
Ga0126378_1201942723300010361Tropical Forest SoilMAAIYAKSRQETLSMADQSVLAKLATEIKRTVRKGR*
Ga0136449_10135210013300010379Peatlands SoilVFMAAIYAKSRMENLSAADQNVLAKLAAQIKKTTKGRR*
Ga0134124_1109559413300010397Terrestrial SoilAAASASSYYFVAEPGQIFMAAIYAKSRKETLSAADQNVLIKLAAQIKKAAKGGR*
Ga0150983_1485741813300011120Forest SoilAAIYAKSRMDNLSAADQNVLAKIAAQIKKATRGGR*
Ga0137377_1085310623300012211Vadose Zone SoilVVYFFRAEPGTLYMAGIYAKSRKDTLSAADQNVLAKLAAQIKKAAKGGQ*
Ga0137373_1074631713300012532Vadose Zone SoilIYYFTAEPGRIYLASIYAKSQRENLSAADQNVLAKLAAQIKRASKGGR*
Ga0137397_1091981023300012685Vadose Zone SoilFMAAIYAKSRKDTLSASDRNVLAKLAAQIKRAAKGGQ*
Ga0137419_1159829913300012925Vadose Zone SoilEPGRIYMASIYAKSRKQTLSAADQNVLAKLATQIKGALKGDRKT*
Ga0137419_1192789623300012925Vadose Zone SoilMAAIYAKSRKETLSAADQNVLAKLAAQINKAAKGAR*
Ga0137407_1233567223300012930Vadose Zone SoilFFLAEPGRIYMAGIYAKSRQASLSAADQNVLAKLAAQLKKAAKGA*
Ga0137410_1104392533300012944Vadose Zone SoilYFFLTEPGQIFMAAIYAKLRKETLSAADQNVLAKLAAQIKKAAKGAR*
Ga0181539_102202223300014151BogVIYFFMAEPGRIFMAAIYAKSRKENLSAANQNVLAKLAAQIKKAAKGGR*
Ga0181539_105314323300014151BogVAPKSGGLRVIYFFLAQPERVFMASIYAKSRKETLSAADQNVLAKLAAQIKKAAEGGR*
Ga0181539_123490713300014151BogVVYFFLAEPERVFMASIYAKSRKETLSAADRNVLAELAAQIKKAAKGGR*
Ga0181533_107857353300014152BogVAPKSGGLRVIYFFLAQPERVFMASIYAKSRKETLSAADQNVLAKLAAQIKKAA
Ga0181527_102869633300014153BogVAPKSGGLRVIYFFLAQPERVFMASIYAKSRKETLSAADQNVLAKLAAQIKKAAKGGR*
Ga0181518_1026015333300014156BogYMASIDAKSRKETLSAAVRNVLAKLAARIKRAVKGGR*
Ga0181518_1048668223300014156BogFLAEPGRIYMAAIYAKSRMETLSAADRNVLAKLAAQIKKAAKGR*
Ga0181531_1048561023300014169BogMAAIYAKSRMETLSAADRNVLAKLAAQIKKAAKGG*
Ga0182010_1068959113300014490FenGFRVIYFFLAEPGRIYMAAIYAKSRKETLSATDRNVLAKLAASIKKAAKGGR*
Ga0182011_1059942223300014496FenRVHMATIYAKSRKETLSAADRNVLARLAAQIKRAAKGGRRS*
Ga0182024_10000395653300014501PermafrostVIYFFLAEPGRIYMAAIYAKAQKESLSAADQKVLAKLAVQIKNAAKGG*
Ga0182021_1275509323300014502FenFMAAIYAKSRKETLSAADRNVLAKLAVQIKKAAKGGR*
Ga0181536_1025169133300014638BogVIYFFMAEPGRIFMAAIYAKSRKENLSAANQNVLAKLAAQ
Ga0181516_1051933113300014655BogLAEPGRIYMAAIYAKSRMETLSAADRNVLAKLAAQIKKAAKGG*
Ga0182027_1008402653300014839FenVIYFFLAEPGRIYMAAIYAKSRKETLSAADRNVLAKLAASIKKVAKGGR*
Ga0182027_1011011313300014839FenEPGRIYMAAIYAKSRKETLSAADRNVLAKLAANIKKAAKGGR*
Ga0182027_1194410923300014839FenMASIYAKSRRENLSAADRNVLAKLAARIKRAVKGGR*
Ga0182027_1216601223300014839FenLRVVYFFLAEPERVYMASIYAKSRKETLSAADRNVLAKLAAQIKK
Ga0187849_139371113300017929PeatlandMASIYAKSRKETLSAADRNVLAKLAAQIKKAAKGGR
Ga0187848_1005575133300017935PeatlandMAAIYAKSRKENLSAANQNVLAKLAAQIKKAAKGGR
Ga0187853_1009781033300017940PeatlandVAPKSGNLRVIYFFLAEPERVFMASIYAKSRKETLSAADQNVLAKLAAQIKKAAKGGR
Ga0187817_1008582323300017955Freshwater SedimentMAAIYAKTSKQNLSAADQNILVKLAAQIKKASKKGS
Ga0187783_1069002213300017970Tropical PeatlandIYLFLPAPQRIYMAMIYHKSRKETLSAADKKVLATLAGQIKTAAKKG
Ga0187805_1026082713300018007Freshwater SedimentLAEPGRIYMAAIYAKTSKQNLSAADQNILVKLAAQIKKASKKGS
Ga0187872_1031878323300018017PeatlandAAPGRIYMAAIYAKSRKETLSSADRNVLAKLAAQIKRAAKGGR
Ga0187885_1045336613300018025PeatlandIYMALIYAKSRMETLSDADRNVLAKIAAQIKKAAKGGR
Ga0187885_1045729523300018025PeatlandRVVYFFLAEPERVFMASIYAKSRKETLSAADQNVLAKLATQIKKAARGGR
Ga0187875_1015276133300018035PeatlandVIYYFLAEPGRIYMAAIYAKSRMETLSAADRNVLAKLAAQIKKAVKGG
Ga0187862_1006322063300018040PeatlandYFFLTEPGRIYMALIYAKSRMETLSDADRNVLAKIAAQIKKAAKGGR
Ga0187851_1086153923300018046PeatlandVIYFFLAEPGRIYMAGIYAKSRKETLPQADQNVLVKIAAQIKRAAKEGRQT
Ga0187858_1024613233300018057PeatlandLRLVYFFLAEPERVYMASIYAKSRKETLSAADRNVLARLATQIKKAAKGGR
Ga0182028_128858623300019788FenVIYFFLAEPGRIYMAAIYAKSRKETLSAADRNVLAKLAASIKKVAKGGR
Ga0194111_1019194013300020083Freshwater LakeMAAIYAKSRKDTLSAADQNVLLKIAAEIKKAAKGGR
Ga0210377_1075778623300021090Groundwater SedimentMAAIYAKSRKDTLTAADQNVLAKLAAQIEKAAKGGR
Ga0210386_1107522533300021406SoilFLSEPRIYIAAIYAKSRKEMLSMAHQNVLAKLASQIKKAAKK
Ga0210390_1013577843300021474SoilEPGRIYIAAIYAKSRKETLSKADQNVLAKLASQIKKAAKK
Ga0224559_105166933300023091SoilFRVIYFLLAEPGRVYMAGIYAKSRKDALSGADQNVLARLAAQIKKAAKGGR
Ga0224535_113343933300023258SoilAGPGQVYMASIYAKSRKETLSAADQNVLAKLAAEIKRAVKGGR
Ga0207670_1008565833300025936Switchgrass RhizosphereVIYFFVVEPGRIYIASVFAKSRRQNLSAADQNVLAKIDAQIKAAAKGGRL
Ga0207689_1106450313300025942Miscanthus RhizosphereYMSAIYAKSQKENLSAADRHVLAKLAAQIKKAAKRGRH
Ga0207667_1184436723300025949Corn RhizosphereMAAIYAKSQKENLSPADQKLLATLAAQIKRAAKGEG
Ga0209881_102365833300026273SoilLSEPGRIYMAAIYAKSRKDTLSAADRNVLARLAAQIKKAAKGRR
Ga0209219_116217613300027565Forest SoilVIYFFLTEPGRIYMASIYAKSQRETLSAADQNVLA
Ga0209773_1026532413300027829Bog Forest SoilGLRVVYFLLPEPGRIYMAAIYAKSRKDTLSGADHNVLAKLAGQIKKAAKGRR
Ga0209580_1056772123300027842Surface SoilGRIFMAAIYAKSRKETLSGADQNVLTKLAAEIKKAVKGGR
Ga0209624_1018768033300027895Forest SoilVVYFFLAEPGRIYMAAIYAKSQKDTLSAADQNVLAKLAAQIKKAAKGGR
Ga0209067_1021102633300027898WatershedsFFVVEPGRIYMASIYAKSRKANLSADDQGVLAKIAAHLKKAAK
Ga0311340_1087429613300029943PalsaMAAIHAKSRKETLSGSDQNLLAKLAAQIKKAARGER
Ga0311336_1043986633300029990FenVYFFVAELGRIYMAAIYAKSRKETLSAADRNVLARLAAQIKKAAKGGR
Ga0311345_1017831673300030688BogFFLAEPGRIYMAAIYAKSRVDSLSAADNNVLAKIAAQIKKAAKEGE
Ga0170834_10721307813300031057Forest SoilGFRAVYFFLAGPGRIYMAAIYAKSRKETLSGADQNALAKLAAQIKKAVKGGV
Ga0302325_1108976913300031234PalsaVIYFFLSAPGRIYMADIYAKSRKETLSAADQHALARLAAQIKRAAKEGNNHGYAHCEYGNQGPDQARHS
Ga0302325_1186778413300031234PalsaVIYFFLVSPGTLYMAGAYAKARKETLSGADQNVLAKLAARIKK
Ga0302324_10097490733300031236PalsaMAAIYAKSRVDSLSAADNNLLAKIAAQIKQGAKEGERS
Ga0265316_1111712333300031344RhizosphereRVIYFFLSPPGLIYMASVYAKSRKETLSAADRNVLAKLASEIKRAAQGGR
Ga0302326_1056707713300031525PalsaVIYFFLSAPGRIYMADIYAKSRKETLSAADQHALARLAAQIKRAAKEGSNHGYAHCEYGN
Ga0310686_11303115433300031708SoilYMAAIYEKSRMENLSAADQNVLAKLAAQIKKAAKGEP
Ga0265342_1068036013300031712RhizosphereSGPGSIYMASVYAKSRKETLSAADRNVLAKLASQIKRAARGGR
Ga0302321_10114917323300031726FenMAAIYAKSRMETLSAADRNVLAKLAAQIKKAAKGGG
Ga0315282_1039760713300032069SedimentVVYFFLPELGRIYMAAIYAKSRKGTLSAADQNVLAKLAAQIKKAAKGGR
Ga0335082_1144885323300032782SoilFRTVYFFLAQPGRIYMAAIYAKSRKETLSGADQNVLAKLAAQIKKAAKGGQ
Ga0335079_1002097093300032783SoilVRGVVYFFLAEPGRIYMAAIYAKSQKETLSAADQNVLAKLAAQIKKAARGGQ
Ga0335079_1029422213300032783SoilRIYMAAIYAKSRKDTLSAADRNVLAKLAAQIKKAAKGRG
Ga0335078_1027710353300032805SoilMAAIYAKSRKDTLSAADRNVLAKLAAQIKKAAKGRG
Ga0335078_1145048723300032805SoilVIYVFLAEPGRIYMAAIYAKSRKGTLSAADQHVLAKLAAQIKKAAKGGR
Ga0335081_1248559313300032892SoilPGQVFMAAIYAKSRMENLSAADQNVLAKLAAQIKQTTKGRR
Ga0335077_1060572113300033158SoilAEPGRIYMAAIYAKSRKDTLSAADRNVLAKLAAQIKKAAKGRG
Ga0326728_1042334913300033402Peat SoilVAPKSGGLRVIYFFLAQPERVFMASIYAKSRKETLSAADQNVLAKLAAQIKKAAKGGR
Ga0326728_1050722033300033402Peat SoilGFRVIYFFLAEPGRIYMAAIYAKSRKESLSAADRNVLAKLAASIKKVAKGGR
Ga0316629_1146388113300033483SoilLTGPGCIYMAGINAKSRQKELSMADQNVLAKLAAQIKKTTKGGQ
Ga0334828_092680_106_2613300033822SoilVVYFFLAEPGRIYMAAIYAKSRKDTLSAADRNVLAKLAAQIKKESKGGRQS
Ga0334792_082250_50_2053300033888SoilLRVVYFFLAEPERVYMASIYAKSRKETLSAADRNVLAKLAAQIKKVTKGGR
Ga0314861_0062870_274_3963300033977PeatlandVKRAQLAAVYAKSRRETLSAADRNTLAKLAAEIKKAAKGG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.