| Basic Information | |
|---|---|
| Family ID | F094136 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MPSYQNVTPPLSLFSGDVGFSFNNEAFPGSATSGSQFALPSFTGV |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 91.51 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (89.623 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (31.132 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.849 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.340 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF08734 | GYD | 29.25 |
| PF03476 | MOSC_N | 6.60 |
| PF12844 | HTH_19 | 2.83 |
| PF16264 | SatD | 1.89 |
| PF07238 | PilZ | 0.94 |
| PF02452 | PemK_toxin | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 29.25 |
| COG3217 | N-hydroxylaminopurine reductase subunit YcbX, contains MOSC domain | Defense mechanisms [V] | 6.60 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.62 % |
| Unclassified | root | N/A | 10.38 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908009|FWIRA_GRAM18402HLTG1 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300002121|C687J26615_10143470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300004080|Ga0062385_10421628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
| 3300004092|Ga0062389_101712750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 809 | Open in IMG/M |
| 3300004092|Ga0062389_103769755 | Not Available | 569 | Open in IMG/M |
| 3300005172|Ga0066683_10439659 | Not Available | 801 | Open in IMG/M |
| 3300005434|Ga0070709_10397427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1028 | Open in IMG/M |
| 3300005446|Ga0066686_11009742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300005537|Ga0070730_11019766 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300005542|Ga0070732_10215357 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300005602|Ga0070762_10260635 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300006050|Ga0075028_101030189 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300006176|Ga0070765_102076771 | Not Available | 531 | Open in IMG/M |
| 3300009038|Ga0099829_11081587 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300009088|Ga0099830_10140973 | All Organisms → cellular organisms → Bacteria | 1845 | Open in IMG/M |
| 3300009088|Ga0099830_10161609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1730 | Open in IMG/M |
| 3300009088|Ga0099830_11433716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300009088|Ga0099830_11747445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300009088|Ga0099830_11752435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300009090|Ga0099827_11295156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300009090|Ga0099827_11471376 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300009545|Ga0105237_10141809 | All Organisms → cellular organisms → Bacteria | 2397 | Open in IMG/M |
| 3300010046|Ga0126384_10814432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
| 3300010159|Ga0099796_10334253 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300010343|Ga0074044_10210255 | Not Available | 1291 | Open in IMG/M |
| 3300010366|Ga0126379_10006885 | All Organisms → cellular organisms → Bacteria | 7707 | Open in IMG/M |
| 3300010366|Ga0126379_13415111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300010396|Ga0134126_11652779 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 704 | Open in IMG/M |
| 3300010880|Ga0126350_10521905 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300010937|Ga0137776_1605835 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300011269|Ga0137392_10267029 | Not Available | 1410 | Open in IMG/M |
| 3300011270|Ga0137391_11007020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
| 3300011271|Ga0137393_11511416 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300011271|Ga0137393_11617779 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300012189|Ga0137388_11504593 | Not Available | 610 | Open in IMG/M |
| 3300012189|Ga0137388_11937232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300012205|Ga0137362_11197177 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300012205|Ga0137362_11468025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300012349|Ga0137387_10055025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPHIGHO2_12_FULL_67_30 | 2666 | Open in IMG/M |
| 3300012349|Ga0137387_10403400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 991 | Open in IMG/M |
| 3300012349|Ga0137387_11015734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300012351|Ga0137386_10222875 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
| 3300012359|Ga0137385_11549593 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300012363|Ga0137390_11244403 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300012683|Ga0137398_10698917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300012924|Ga0137413_10144819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPHIGHO2_12_FULL_67_30 | 1544 | Open in IMG/M |
| 3300012925|Ga0137419_10488871 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 975 | Open in IMG/M |
| 3300012927|Ga0137416_10312464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1306 | Open in IMG/M |
| 3300012930|Ga0137407_11185376 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300012931|Ga0153915_11066571 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300012957|Ga0164303_10659333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
| 3300012971|Ga0126369_11532282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
| 3300012984|Ga0164309_11396907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300014157|Ga0134078_10333002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300014158|Ga0181521_10492297 | Not Available | 588 | Open in IMG/M |
| 3300014201|Ga0181537_10187475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1422 | Open in IMG/M |
| 3300015054|Ga0137420_1162944 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300015357|Ga0134072_10111448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 855 | Open in IMG/M |
| 3300017930|Ga0187825_10028098 | All Organisms → cellular organisms → Bacteria | 1893 | Open in IMG/M |
| 3300017994|Ga0187822_10222949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300018006|Ga0187804_10086996 | Not Available | 1269 | Open in IMG/M |
| 3300018034|Ga0187863_10555624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300018060|Ga0187765_10792664 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300018077|Ga0184633_10373002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
| 3300018482|Ga0066669_11798103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300020021|Ga0193726_1303493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300021170|Ga0210400_10175611 | All Organisms → cellular organisms → Bacteria | 1734 | Open in IMG/M |
| 3300021170|Ga0210400_11573830 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300021402|Ga0210385_10561102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 869 | Open in IMG/M |
| 3300021406|Ga0210386_11692943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300021420|Ga0210394_10075344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2919 | Open in IMG/M |
| 3300021478|Ga0210402_10024735 | All Organisms → cellular organisms → Bacteria | 5166 | Open in IMG/M |
| 3300021479|Ga0210410_10968933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
| 3300021559|Ga0210409_10363777 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
| 3300021560|Ga0126371_11323961 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 853 | Open in IMG/M |
| 3300025477|Ga0208192_1099222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300026327|Ga0209266_1176980 | Not Available | 815 | Open in IMG/M |
| 3300026499|Ga0257181_1064144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300026538|Ga0209056_10453693 | Not Available | 723 | Open in IMG/M |
| 3300026551|Ga0209648_10036738 | All Organisms → cellular organisms → Bacteria | 4252 | Open in IMG/M |
| 3300027737|Ga0209038_10074401 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300027773|Ga0209810_1064087 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1824 | Open in IMG/M |
| 3300027825|Ga0209039_10168080 | Not Available | 905 | Open in IMG/M |
| 3300027829|Ga0209773_10339289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300027846|Ga0209180_10418698 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300027853|Ga0209274_10078886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1600 | Open in IMG/M |
| 3300027855|Ga0209693_10154039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1135 | Open in IMG/M |
| 3300027875|Ga0209283_10589743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
| 3300027875|Ga0209283_10676779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300027875|Ga0209283_10842521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300028138|Ga0247684_1005700 | All Organisms → cellular organisms → Bacteria | 1953 | Open in IMG/M |
| 3300028906|Ga0308309_10349311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1261 | Open in IMG/M |
| 3300028906|Ga0308309_11520540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300029636|Ga0222749_10229522 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300031128|Ga0170823_11631686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300031231|Ga0170824_121167641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1380 | Open in IMG/M |
| 3300031708|Ga0310686_100458906 | All Organisms → cellular organisms → Bacteria | 2508 | Open in IMG/M |
| 3300031715|Ga0307476_10226453 | All Organisms → cellular organisms → Bacteria | 1361 | Open in IMG/M |
| 3300031715|Ga0307476_10298431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1182 | Open in IMG/M |
| 3300031718|Ga0307474_10301477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1234 | Open in IMG/M |
| 3300031753|Ga0307477_10114120 | All Organisms → cellular organisms → Bacteria | 1881 | Open in IMG/M |
| 3300031949|Ga0214473_11324516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
| 3300031962|Ga0307479_10129591 | All Organisms → cellular organisms → Bacteria | 2466 | Open in IMG/M |
| 3300031962|Ga0307479_11825737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300032895|Ga0335074_10258901 | All Organisms → cellular organisms → Bacteria | 2037 | Open in IMG/M |
| 3300032898|Ga0335072_11072032 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 31.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.38% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 5.66% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.66% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.66% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.77% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.83% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.83% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.89% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.94% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.94% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.94% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.94% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.94% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.94% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.94% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.94% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.94% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908009 | Soil microbial communities from sample at FACE Site Metagenome WIR_Amb2 | Environmental | Open in IMG/M |
| 3300002121 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025477 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FWIRA_01354970 | 2124908009 | Soil | MPSYQNVNPPLSLFSGDVGFSFNNETFPGSAQAGSQFAIPSFTGLPDG |
| C687J26615_101434701 | 3300002121 | Soil | MPSYANSQPPLSLSPGDVGFSFSSEAVPSSATAGSQFALPHAP |
| Ga0062385_104216282 | 3300004080 | Bog Forest Soil | MPNYQNTVPPSSLSPGDVGFSFNNETFPGSAQAGSQFAIPSYAGQPDTGTAVR |
| Ga0062389_1017127501 | 3300004092 | Bog Forest Soil | MPSYQNVTPPSSLFSGDVGFSYNNETFPGSAQAGSQFALPS |
| Ga0062389_1037697551 | 3300004092 | Bog Forest Soil | MPSYQNAVPPSSLMPGDVGFSFNNETFPGSAEAGSQFAIPSYAGQPDT |
| Ga0066683_104396591 | 3300005172 | Soil | MPSYQNVTPPLAVSPGDVGFSYNNEAFPGSAQSGTQFALSFP |
| Ga0070709_103974273 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MPIYQNSTPPYALSSGDVGFSFNNEAFPAANTAGSQFALPSYTGIADGGTA |
| Ga0066686_110097421 | 3300005446 | Soil | MPTYQNVVPPIALSPGDVGFSFNNEAFPGSATAGSQFALLFPTGRGES |
| Ga0070730_110197661 | 3300005537 | Surface Soil | MPSYQNVTPPLSLFSGDVGFSFNNEAFPGSAQAGSQFAI |
| Ga0070732_102153572 | 3300005542 | Surface Soil | MPSYQNLTPPLSLMPGDVGFSFNNEAFPGSAQAGSQFA |
| Ga0070762_102606351 | 3300005602 | Soil | MPSYQNAVPPSSLFPGDVGFSFNNETFPGSAQAGSQFAIPSYAGQPDTGTAVRWQ |
| Ga0075028_1010301892 | 3300006050 | Watersheds | MPSYQNVTPPISLFSGDVGFSFNNEAFPGSATSGSQFAVPS |
| Ga0070765_1020767711 | 3300006176 | Soil | MPSYSSAVPPLALSPGDVGFSFNNEAVPAAAAAGTQFALPHP |
| Ga0099829_110815871 | 3300009038 | Vadose Zone Soil | MPSYQNVTPPLSLMPGDVGFSFNNESFPGSAQAGSQFALPSYAGR |
| Ga0099830_101409734 | 3300009088 | Vadose Zone Soil | MPSYQNVTPPISLMPGDVGFSFNNEAFPGSAQAGSQFAIP |
| Ga0099830_101616093 | 3300009088 | Vadose Zone Soil | MPTYQNVTPPISLFSGDVGFSFNNEAFPGSATSGTQFALPSFTGTNDPG |
| Ga0099830_114337161 | 3300009088 | Vadose Zone Soil | MPSYQNLTPPSSLFPGDVGFSFNNEAFPGGALAGSQFAIPSYAGQPDSGTAVRWQ |
| Ga0099830_117474451 | 3300009088 | Vadose Zone Soil | MPSYQNLTPPISLMPGDVGFSFNNEAFPGSALAGSQFALPRYAGQPDTGTAVR |
| Ga0099830_117524351 | 3300009088 | Vadose Zone Soil | MPAYQNVTPPISLMPGDVGFSFNNEAFPGSATAGSQFAIPSYAGQPDSGTAV |
| Ga0099827_112951561 | 3300009090 | Vadose Zone Soil | MPSYQNVTPPLSLFSGDVGFSFNNEAFPGSATSGSQFALPSFTGVPDSGTA |
| Ga0099827_114713761 | 3300009090 | Vadose Zone Soil | MPSYQNVTPPISLFSGDVGFSFNNEAFPGSATSGSQFALPSFTGVPDSGTA |
| Ga0105237_101418091 | 3300009545 | Corn Rhizosphere | MPIYQNSTPPFALSSGDVGFSFNNEAFPAANTAGSQFALPSYTGIADGGT |
| Ga0126384_108144321 | 3300010046 | Tropical Forest Soil | MPAYQNTLPPISLFSGDVGFSFNNEAFPGGATSGSQFALPSFTGLPDSGT |
| Ga0099796_103342531 | 3300010159 | Vadose Zone Soil | MPVYQNTTPPLSLSSGDVGFSFNNEAFPGGAASGTQFAL |
| Ga0074044_102102552 | 3300010343 | Bog Forest Soil | MPTYQNATPPSALYPGDVGYSWNNEAFPGATTSGSQFALSTPGG |
| Ga0126379_1000688513 | 3300010366 | Tropical Forest Soil | MPAYQNVTPPISLMPGDVGFSFSNEAFPGSATAGSQFTIPNYA |
| Ga0126379_134151112 | 3300010366 | Tropical Forest Soil | MPAYQNTFPPISLMPGDVGFSYNNEVFPGSAQAGSQFAIPGYAGQPDTGTAVRWQTIF |
| Ga0134126_116527792 | 3300010396 | Terrestrial Soil | MPIYQNSTPPYALSSGDVGFSFNNEAFPAANTAGSQFALPSYTGI |
| Ga0126350_105219051 | 3300010880 | Boreal Forest Soil | MPSYQNLLPPISLAPGDVGFSFNNEAFPGGTQAGSQFAISSFAGQPDTGTAVR |
| Ga0137776_16058353 | 3300010937 | Sediment | MPAYQNTLPPISLFSGDIGFSFNNEAFPGGATSGTQFAIPSFTGLPDGGTAVRWQT |
| Ga0137392_102670291 | 3300011269 | Vadose Zone Soil | MPSYQNVTPPISLSPGDVGFSFSNEAFPGSATAGSQFAIPSYAGQ |
| Ga0137391_110070202 | 3300011270 | Vadose Zone Soil | MPNYSNTTPPSSLSPGDVGFSFNNENPAAPQAGAQFAIARPYG |
| Ga0137393_115114161 | 3300011271 | Vadose Zone Soil | MPSYQNVTPPLSLMPGDVGFSFNNESFPGSAQAGSQFALPSYAG |
| Ga0137393_116177791 | 3300011271 | Vadose Zone Soil | MPTYQNVLPPIALCPGDVGFSFNNEAFPGAGTAGT |
| Ga0137388_115045931 | 3300012189 | Vadose Zone Soil | MPSYQNLTPPASLFPGDVGFSFSNEAFPGGAQAGSQF |
| Ga0137388_119372321 | 3300012189 | Vadose Zone Soil | MPSYQNVTPPISLMPGDVGFSFNNEAFHGSAQAGSQFAIPSYAGQPDSGT |
| Ga0137362_111971771 | 3300012205 | Vadose Zone Soil | MPAYQNVTPPSSLFSGDVGFSFNNEAFPGSATSGTQFALPSFTGTTDAGTAVR |
| Ga0137362_114680251 | 3300012205 | Vadose Zone Soil | MPTYQNVTPPLSLFSGDVGFSFNNEAFPGSATSGTQFALP |
| Ga0137387_100550251 | 3300012349 | Vadose Zone Soil | MPVYQNTLPPISLFSGDVGFSFNNEAFPGVATSGSQFALPSYT |
| Ga0137387_104034001 | 3300012349 | Vadose Zone Soil | MPAYQNTTPPISLFSGDVGFSFNNETFPAANTAGSQFALPSFTGV |
| Ga0137387_110157342 | 3300012349 | Vadose Zone Soil | MPSYQNVTPPLSLFSGDVGFSFNNEAFPGSATSGSQFALPSFTGVP |
| Ga0137386_102228752 | 3300012351 | Vadose Zone Soil | MPAYQNVTPPISLSPGDVGFSFNNEAFPAANTAGSQFAIPSYTGRADSGNAVRWQ |
| Ga0137385_115495932 | 3300012359 | Vadose Zone Soil | MPSYQNVTPPLSLFSGDVGFSFNNEAFPGSATSGSQFALPSFTGV |
| Ga0137390_112444031 | 3300012363 | Vadose Zone Soil | MPVYQNTTPPLSLSSGDVGFSFNNEAFPGGATSGTQ |
| Ga0137398_106989171 | 3300012683 | Vadose Zone Soil | MPVYQNTTPPLSLSSGDVGFSFNNEAFPGGATSGTQFALPSFTGIADSGTAV |
| Ga0137413_101448194 | 3300012924 | Vadose Zone Soil | MPVYQNTLPPISLFSGDVGFSFNNEAFPGAATSGSQFALPSYTGLPDGGTA |
| Ga0137419_104888712 | 3300012925 | Vadose Zone Soil | MPVYQNTLPPISLFSVVAGSSKKNEAFPGAATSGSQFALPSYTGLPDGGTAVRW |
| Ga0137416_103124643 | 3300012927 | Vadose Zone Soil | MPAYQNVTPPLSLFSGDVGFSFNNEAFPGSATSGTQFAL |
| Ga0137407_111853762 | 3300012930 | Vadose Zone Soil | MGCAAKGAEMPSYQNVTPPISLSSGDVGFSFNNEAFPGSATSGSQFAVPSFTGVPDAGTAVRWQ |
| Ga0153915_110665712 | 3300012931 | Freshwater Wetlands | MPSYQNVTPPLSLFSGDVGFSFNNEAFPGSAQAGSQFAIPSFAGLPD |
| Ga0164303_106593332 | 3300012957 | Soil | MPSYQNVTPPLSLFSGDVGFSFNNETFPGSAQAGSQFAIPSFTGLPDGGTS |
| Ga0126369_115322822 | 3300012971 | Tropical Forest Soil | MPAYQNSLPPISLFSGDVGFSFNNEAFPAGATSGSQFALPSYTGLPDGG |
| Ga0164309_113969071 | 3300012984 | Soil | MPSYQNVTPPVSLFSGDVGFSFNNETFPGSAQAGSQFAIPSFTGLPDGGTSVRWQTIF |
| Ga0134078_103330021 | 3300014157 | Grasslands Soil | MPVYQNTLPPISLFSGDVGFSFNNEAFPGAATSGSQFALPSYM |
| Ga0181521_104922972 | 3300014158 | Bog | MPTYQNATPPNALYPGDVGYSWNNEAFPGANTSGT |
| Ga0181537_101874751 | 3300014201 | Bog | MPTYQNSTPPYALSSGDVGFSFNNEAFPAANTAGSQFALP |
| Ga0137420_11629441 | 3300015054 | Vadose Zone Soil | MPVYPVYQNTTPPLSLSSGDVGFSFNNEAFPGGATSGTQ |
| Ga0134072_101114482 | 3300015357 | Grasslands Soil | MPAYQNTTPPISLFSGDVGFSFNNEAFPAANTAGSQF |
| Ga0187825_100280981 | 3300017930 | Freshwater Sediment | MPTYQNALPPASLFSGDVGYSFNNESFPGSATSGSQFALQSFT |
| Ga0187822_102229492 | 3300017994 | Freshwater Sediment | MPTYQNALPPASLFSGDVGYSFNNESFPGSATSGSQFALQ |
| Ga0187804_100869961 | 3300018006 | Freshwater Sediment | MPSYQNLYPPSSLMPGDVGFSFNNEAFPGSAQAGSQFAIPSYAGQPDTGTAVRW |
| Ga0187863_105556241 | 3300018034 | Peatland | MPSYQNVTPPLSLFPGDVGFSFINEAFPTGAEAGSQFALPNFTGVPDGGKAVRWQTI |
| Ga0187765_107926642 | 3300018060 | Tropical Peatland | MPTYQNVVPPIALSPGDVGFSFNNEAFPGSATAGSQFALPSFAGQPDSGTAV |
| Ga0184633_103730021 | 3300018077 | Groundwater Sediment | MPSYANSQPPLSLSPGDVGFSFSSEAVPSSATAGSQFALPH |
| Ga0066669_117981032 | 3300018482 | Grasslands Soil | MPVYQNTLPPISLFSGDVGFSFNNEAFPGAATSGTQFALPSYTGLPDSGTA |
| Ga0193726_13034932 | 3300020021 | Soil | MPIYQNSTPPYALSSGDVGFSFNNEAFPAANTAGSQFALPSY |
| Ga0210400_101756114 | 3300021170 | Soil | MPVYQNATPPLSLFSGDVGFSFNNEAFPGAATSGTQFALPS |
| Ga0210400_115738301 | 3300021170 | Soil | MPAYQNVTPPSSLFSGDVGFSFNNEAFPGSAQAGAQFALPSFTG |
| Ga0210385_105611021 | 3300021402 | Soil | MQAYQNVTPPFSLSSGDVGFSFNNEAFPAANTAGSQFALPSFTGIS |
| Ga0210386_116929431 | 3300021406 | Soil | MPAYQNVTPPFSLSSGDVGFSFNNEAFPAANTSGSQFALP |
| Ga0210394_100753444 | 3300021420 | Soil | MPTYANSLPPYSLAPGDAGFSFNNEAVPSSATAGSQFALPHST |
| Ga0210402_100247357 | 3300021478 | Soil | MPTYQNALPPTSLFSGDVGFSFNNEAFPGAATSGSQFALPSYTGVPDAGTAV |
| Ga0210410_109689332 | 3300021479 | Soil | MPSYQNLTPPLSLSPGDVGFSFNNETFPGSAQAGSQFAIPSYAGQPDVGT |
| Ga0210409_103637771 | 3300021559 | Soil | MPSYQNVTPPISLMPGDVGFSFNNEAFPGSALAGSQFAIPS |
| Ga0126371_113239611 | 3300021560 | Tropical Forest Soil | MPAYQNTTPPISLMPGDVGFSFNNETFPGSATAGSQF |
| Ga0208192_10992221 | 3300025477 | Peatland | MPSYSNAVPPLSLFPGDVGFSFNNEAFPADGTAGGQFA |
| Ga0209266_11769801 | 3300026327 | Soil | MPSYQNVTPPLAVSPGDVGFSYNNEAFPGSAQSGTQFALS |
| Ga0257181_10641442 | 3300026499 | Soil | MPSYQNVTPPISLMPGDVGFSFNNEAFPGGAQAGSQFAIPSYAGQPDT |
| Ga0209056_104536931 | 3300026538 | Soil | MPSYQNVTPPLAVSPGDVGFSYNNEAFPGSAQSGTQFALSFPAGF |
| Ga0209648_100367381 | 3300026551 | Grasslands Soil | MPSYQNVTPPISLMPGDVGFSFNNEAFPGSAQAGSQF |
| Ga0209038_100744011 | 3300027737 | Bog Forest Soil | MPNYQNTVPPSSLSPGDVGFSFNNETFPGSAQAGSQFA |
| Ga0209810_10640871 | 3300027773 | Surface Soil | MPTYQNVVPPISLSSGDIGFSFNNEAFPAANTAGSQFALPSYTG |
| Ga0209039_101680802 | 3300027825 | Bog Forest Soil | MPTYQNATPPNTLYPGDVGYSWNNEALPGANTSGTQFA |
| Ga0209773_103392892 | 3300027829 | Bog Forest Soil | MPSYQNAVPPSSLMPGDVGFSFNNETFPGSAEAGSQFAIPSYAGQPDTGTSVRWQTIF |
| Ga0209180_104186981 | 3300027846 | Vadose Zone Soil | MPSYQNVTPPLSLMPGDVGFSFNNESFPGSAQAGSQFALP |
| Ga0209274_100788863 | 3300027853 | Soil | MPNYQNAVPPSSLFPGDVGFSFNNETFPGSAQAGSQFA |
| Ga0209693_101540391 | 3300027855 | Soil | MPSYQNVTPPSSLFPGDVGFSFNNEAFPSANTAGTQF |
| Ga0209283_105897432 | 3300027875 | Vadose Zone Soil | MPSYQNVTPPISLFSGDVGFSFNNEAFPGSATSGSQFA |
| Ga0209283_106767792 | 3300027875 | Vadose Zone Soil | MPTYQNVTPPISLFSGDVGFSFNNETFPAANTAGT |
| Ga0209283_108425212 | 3300027875 | Vadose Zone Soil | MPVYQNTTPPLSLSSGDVGFSFNNEAFPGGATSGTQFA |
| Ga0247684_10057001 | 3300028138 | Soil | MPSYQNVTPPLSLFSGDVGFSFNNETFPGSAQAGSQFAIPSFTGLPDGGTSVR |
| Ga0308309_103493111 | 3300028906 | Soil | MPTYQNSTPPYALSSGDVGFSFNNEAFPAANTAGSQFALPSYTGISDG |
| Ga0308309_115205401 | 3300028906 | Soil | MPNYQNAVPPSSLSPGDVGFSFNNETFPGSAQAGSQFALPSYGGQPDA |
| Ga0222749_102295223 | 3300029636 | Soil | MPSYQNAVPPSSLFPGDVGFSFNNETFPGSAQAGSQFAIPSYAG |
| Ga0170823_116316862 | 3300031128 | Forest Soil | MPTYQNVLPPISLSPGDVGFSFNNEAFPGGATSGSQFALPSYAGQPDV |
| Ga0170824_1211676413 | 3300031231 | Forest Soil | MPSYQNLNPPISLAPGDVGFSFNNEAFPGGAQAGSQFAISSFAGQPDS |
| Ga0310686_1004589064 | 3300031708 | Soil | MPNYQNAVPPSSLSPGDVGFSFNNETFPGSAQAGSQFALPSYGGQPD |
| Ga0307476_102264533 | 3300031715 | Hardwood Forest Soil | MPSYQNAVPPSSLMPGDVGFSFNNETFPGSAQAGSQFAIPSYAGQP |
| Ga0307476_102984311 | 3300031715 | Hardwood Forest Soil | MPSYQNLTPPYALFSGDVGFSFNNEAFPAANTAGSQFA |
| Ga0307474_103014771 | 3300031718 | Hardwood Forest Soil | MPSYQNLTPPYALFSGDVGFSFNNEAFPAANTAGSQ |
| Ga0307477_101141201 | 3300031753 | Hardwood Forest Soil | MPSYQNVTPPSSLFPGDVGFSFNNEAFPGGAQAGSQFALTTPGG |
| Ga0214473_113245162 | 3300031949 | Soil | MPSYANSQPPLSLSPGDVGFSFSSEAVPSSATAGSQFALPHPPGVG |
| Ga0307479_101295911 | 3300031962 | Hardwood Forest Soil | MPSYQNVTPPFSLSSGDVGFSFNNEAFPGSALTGTQFALPSFTGI |
| Ga0307479_118257372 | 3300031962 | Hardwood Forest Soil | MPAYQNVAPPSSLFSGDVGFSFNNEAFPGSATSGT |
| Ga0335074_102589011 | 3300032895 | Soil | MPSYQNTTPPSSLMPGDVGFSFNNETFPGGAEAGSQFAIPSYAGRA |
| Ga0335072_110720321 | 3300032898 | Soil | MPIYQNSTPPYALSSGDVGFSFNNEAFPAANTAGSQF |
| ⦗Top⦘ |