NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F094121

Metagenome / Metatranscriptome Family F094121

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F094121
Family Type Metagenome / Metatranscriptome
Number of Sequences 106
Average Sequence Length 40 residues
Representative Sequence MKTIASALIALSVLAGVAAPANAAWDTKAFWENLARSAQ
Number of Associated Samples 77
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 0.00 %
% of genes from short scaffolds (< 2000 bps) 0.00 %
Associated GOLD sequencing projects 66
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (100.000 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(17.924 % of family members)
Environment Ontology (ENVO) Unclassified
(35.849 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(61.321 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 49.25%    β-sheet: 0.00%    Coil/Unstructured: 50.75%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF04519Bactofilin 2.86
PF16138DUF4846 1.90
PF01177Asp_Glu_race 1.90
PF00300His_Phos_1 0.95
PF01471PG_binding_1 0.95
PF01527HTH_Tnp_1 0.95
PF01266DAO 0.95
PF01068DNA_ligase_A_M 0.95
PF03237Terminase_6N 0.95
PF13827DUF4189 0.95
PF00561Abhydrolase_1 0.95
PF00665rve 0.95
PF13561adh_short_C2 0.95
PF00239Resolvase 0.95
PF13340DUF4096 0.95
PF10907DUF2749 0.95
PF01575MaoC_dehydratas 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG1664Cytoskeletal protein CcmA, bactofilin familyCytoskeleton [Z] 2.86
COG1423ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) familyReplication, recombination and repair [L] 0.95
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 0.95
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.95
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 0.95
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 0.95
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 0.95
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 0.95
COG4584TransposaseMobilome: prophages, transposons [X] 0.95


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

NameRankTaxonomyDistribution
UnclassifiedrootN/A100.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere17.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil14.15%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere10.38%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere9.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.49%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.72%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere4.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.83%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.83%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil1.89%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.94%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.94%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.94%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.94%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.94%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks0.94%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.94%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.94%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.94%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918013Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies)EnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002503Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006042Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3Host-AssociatedOpen in IMG/M
3300006178Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2Host-AssociatedOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010147Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019263Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019360White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaGEnvironmentalOpen in IMG/M
3300023261Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6EnvironmentalOpen in IMG/M
3300025313Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027866Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031576Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033815Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17EnvironmentalOpen in IMG/M
3300034662Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Iowa-Corn-GraphCirc_018906202140918013SoilMKTIISTLIALSVLAAVAAPANAAWDTKAFWAELARSAT
INPhiseqgaiiFebDRAFT_10118984613300000364SoilSALLALTVLTGIAVAPASAAWDTKAFWENLERTQGGGGN*
INPhiseqgaiiFebDRAFT_10148757613300000364SoilMLLCHPQFGSSLMKIIASALIALSILAGLVAPANAAWDTQSFWEGLARSAQ*
JGI11643J11755_1115056513300000787SoilMKTILTALLALSILGSAAVPVSAAWDTRAFWENLERQAGG
JGI1027J11758_1219930923300000789SoilASALIALSILAGLVAPANAAWDTQSFWEGLARSAQ*
JGI11643J12802_1030847413300000890SoilRGVHLMKTIISTLIALSVLAAVAAPANAAWDTKAFWAELDRSRT*
JGI1027J12803_10150213023300000955SoilMKTIVSALLALTVLTGVAASASAAWDTKAFWDNLERTQGGGGN*
JGI1027J12803_10265398323300000955SoilMKIIASALIALSILAGLVAPANAAWDTQSFWEGLARSAQ*
JGI1027J12803_10517746613300000955SoilMKIIASALIALSVLTSVAAPANAAWDTKAFWEGLARSAQ*
C687J35164_1022797023300002503SoilMKTILSALLALSFLTAVAAPASAAWDVKTFWDQLDRSSY*
Ga0062593_10076784723300004114SoilMKTIVSALLALTVLTGVAVAPASAAWDTKAFWENLERVAGGGN*
Ga0063356_10169615413300004463Arabidopsis Thaliana RhizosphereMKTIISTLIALSVLAAVAAPANAAWDTKAFWAELDRSRT*
Ga0062592_10262024413300004480SoilMKTLISALIALSLVASVAAPANAAWDAKTFWDELARTAM*
Ga0062594_10073493213300005093SoilMKTIISTLIALSVLTAVAAPANAAWDTKAFWADLARSAT*
Ga0070670_10219881523300005331Switchgrass RhizosphereMKTIASALIALSVLTTVAAPANAAWDTKAFWEGLARSAQ*
Ga0066388_10181165023300005332Tropical Forest SoilMKTIVSALLALTVLTGVAVAPASAAWDTKAFWENLERTQGGGN*
Ga0070668_10052048213300005347Switchgrass RhizosphereMKTIVSALLALSVLAGIAAPASAAWDTKAFWEELDRTRM*
Ga0070701_1035805133300005438Corn, Switchgrass And Miscanthus RhizosphereMKTLVSALIALSLVASVAAPANAAWDAKTFWDELARTAM*
Ga0070700_10109592713300005441Corn, Switchgrass And Miscanthus RhizosphereMKTIISTLIALSVLTAVAAPANAAWDTKAFWAEQARSAT*
Ga0070700_10196214113300005441Corn, Switchgrass And Miscanthus RhizosphereMIMKTIASALLALSVLTSIAAPASAAWDTKAFWENLERQAGGGN*
Ga0068854_10162091123300005578Corn RhizosphereLVSALIALSLVASVAAPANAAWDAKTFWDELARTAM*
Ga0068859_10139076223300005617Switchgrass RhizosphereMKTIISTLIALSVLTAVAAPANAAWDTKAFWAELSRSAT*
Ga0068861_10135774713300005719Switchgrass RhizosphereMKTIASALIALSVLAGIAAPANAAWDTKAFWEQQERART*
Ga0068861_10151714213300005719Switchgrass RhizosphereMKTIASALLALSVLTSIAAPASAAWDTKAFWENLERQAGGGN*
Ga0068861_10243695513300005719Switchgrass RhizosphereQLRSSLMKTIASALIALSILAAVAAPANAAWDTKAFWEDLARTAQ*
Ga0068870_1049467323300005840Miscanthus RhizosphereMKTIVSALLALTVLTGVAVAPASAAWDTKAFWENLERVAG
Ga0068863_10090772223300005841Switchgrass RhizosphereLCDHHSYGVLLMKTIVSALIALSVLASVSAPASAAWDTKAFWEDLARSAQ*
Ga0068863_10151592423300005841Switchgrass RhizosphereMKTIVSALLALTVLTGVAIAPASAAWDTKAFWDNLERTQGGGGN*
Ga0068862_10007507963300005844Switchgrass RhizosphereMKIIASALIALSVLTIVAAPANAAWDTKDFWESLARSA
Ga0075368_1006128523300006042Populus EndosphereMKTIASALIALSILAAVAAPANAAWDTKAFWEDLARTAQ*
Ga0075368_1029862413300006042Populus EndosphereMNTIISTLIALSVVVAVAAPANAAWDTKAFWAELAQSAT*
Ga0075367_1022256723300006178Populus EndosphereMKAIVSALLALTVLTGVAVAPASAAWDTKAFWDNLERTQGGGGN*
Ga0075367_1025824913300006178Populus EndosphereMKTIVSALLALTVLTGVAVAPASAAWDTKAFWENLERVAGG
Ga0075367_1066993823300006178Populus EndosphereMKTIASVLIALSILTTVAAPANAAWDTKAFWESLARSAQ*
Ga0075367_1088756223300006178Populus EndosphereTIVSALLALTVLTGVAVAPASAAWDTKAFWENLERVAGGGN*
Ga0075422_1058432013300006196Populus RhizosphereMKTIVSALLALTVLTGVAVAPASAAWDTKKFWEDQANSQGGGG*
Ga0075428_10008720163300006844Populus RhizosphereMKTILSALIALSVLGSVAVPASAAWDTKKFWENLENSQGGGN*
Ga0075428_10019415143300006844Populus RhizosphereMKTIISTLIALSVLAAVAAPANAAWDTKTFWENLARSAQ*
Ga0075428_10024393743300006844Populus RhizosphereMKTIVSALLALTVLTGFAVAPASAAWDTKKFWEDRERAQGGN*
Ga0075428_10185507113300006844Populus RhizosphereMKTIASALIALSVLAGVAAPANAAWDTKTFWENLARSAQ*
Ga0075421_10060654133300006845Populus RhizosphereMKTIISTLIALSVLVAVAAPANAAWDTKAFWAELARSAT*
Ga0075431_10169004533300006847Populus RhizospherePLMKTIISTLIALSVLAAVAAPANAAWDTKTFWENLARSAQ*
Ga0075420_10039923613300006853Populus RhizosphereMKTIVSALLALTVLTGFAVAPASAAWDTKKFWEDRERAQGGG
Ga0075425_10050686613300006854Populus RhizosphereMKMIVAALIAMSAIAAVAAPANAAWDAKTFWEKLDQSRT*
Ga0075425_10055780023300006854Populus RhizosphereMKTIVSALIALSVLASVSAPASAAWDTKAFWEDLARSAQ*
Ga0075425_10124909133300006854Populus RhizosphereMKAIVSALLALTVLTGVAVAPASAAWDTKAFWDNLERTQ
Ga0105251_1039386713300009011Switchgrass RhizosphereMKTIAFALIALSVLAGIAAPASAAWDTKAFWEQQEQSRT*
Ga0075418_1029414223300009100Populus RhizosphereMKTIASALVALSVLAGVAAPANAAWDTKVFWENLARSAQ*
Ga0105247_1156848913300009101Switchgrass RhizosphereMKTIASALIALSVLAGVAAPANAAWDTKAFWENLARSAQ*
Ga0111538_1221873723300009156Populus RhizosphereMKTIISTLMALSVLAAVAAPANAAWDTKAFWAELARSAT*
Ga0105249_1244363523300009553Switchgrass RhizosphereMKTIISTLIALSVLTAVAAPANAAWDTKAFWAELAQSAT*
Ga0126319_137142123300010147SoilMKTILSALIALSVLGSVAAPASAAWDTKAFWDNLERAQGGGGN*
Ga0126372_1178177423300010360Tropical Forest SoilMKTIVSALIALSVLASVSAPASAAWDTKTFWDDLARSAQ*
Ga0164300_1108176613300012951SoilMIMKTIASALLALSVLTSIAAPASAAWDTKAFWENLERQATGGN*
Ga0164298_1053025923300012955SoilMKTIISTLIALSVVVAVAAPANAAWDTKAFWAELAQSAT*
Ga0164298_1096261813300012955SoilMKTIVSALLALSVLTGFAASASAAWDTKAFWENLERTQGGGGN*
Ga0164299_1134192013300012958SoilMKTIASALIALSVLTTVAAPANAAWDAKAFWEGLARSAQ*
Ga0164299_1162276613300012958SoilMKTIVSALIALSVLAGIAAPANAAWDTKAFWEQQERART*
Ga0164301_1179292623300012960SoilISTLIALSVLAAVAAPANAAWDTKAFWAEQARSAT*
Ga0164304_1175628213300012986SoilMKTIVSALLALTVLTGVAVAPASAAWDTKAFWENLERTQGGGGN*
Ga0164307_1071281723300012987SoilMKAIVSTLLALTVLTGVAVAPASAAWDTKAFWDNLERTQGGGGN*
Ga0164305_1154121323300012989SoilESLMKTIASVLIALSILAGLAAPANAAWDTKAFWDELARYAQ*
Ga0157375_1234526113300013308Miscanthus RhizosphereKIIASALIALSVLTTVAAPANAAWDTKSFWEGLARSAQ*
Ga0163163_1208646823300014325Switchgrass RhizosphereMKTIASALIALSILAGLAAPANAAWDTQAFWQGLARSAQ*
Ga0132257_10212917013300015373Arabidopsis RhizosphereIISTLIALSVLTAVAAPANAAWDTKAFWADLARSAT*
Ga0132255_10206237213300015374Arabidopsis RhizosphereTIISTLIALSVLTAVAAPANAAWDTKAFWADLARSAT*
Ga0132255_10382474723300015374Arabidopsis RhizosphereMKTIVSALIALSVLTTVAAPANAAWDTKAFWEGLARSAQ*
Ga0184608_1010237343300018028Groundwater SedimentMKTIRPALLALSFLTAVAAPASAAWDAKTFWEQLDRS
Ga0190265_1013988333300018422SoilMKTIVSALLALSVLAGTVGSASAASDWTKEFWAQHERNLP
Ga0190268_1097520043300018466SoilVMKTIASALIALSVLAGIAAPASAAWDTKAFWEQVDRTGGQ
Ga0190274_1224620813300018476SoilMKTIVSALLALSVLAGIAAPASAAWDTKAFWEELDRTRM
Ga0184647_134044023300019263Groundwater SedimentMKTLVSALIALSLIASVAAPANAAWDAKTFWDELARTAM
Ga0187894_1010480723300019360Microbial Mat On RocksMKTIASALVALSILAGIAAPASAADRFNSKDFWAQQDRNLP
Ga0247796_112070113300023261SoilKTLVSALIALSLVASVAAPANAAWDAKTFWDELARTAM
Ga0209431_1028536243300025313SoilMIMKTILSALLALSFLTAVAAPASAAWDVKTFWDQLDRSSY
Ga0207685_1021367113300025905Corn, Switchgrass And Miscanthus RhizosphereMKTIVSALLALTVLTGVAVAPASAAWDTKKFWENL
Ga0207685_1021367123300025905Corn, Switchgrass And Miscanthus RhizosphereMKTILSALIALSVLGSVAVPASAAWDTKKFWEDRAESQGGGG
Ga0207681_1051975613300025923Switchgrass RhizosphereMKTIVSALLALSVLAGIAAPASAAWDTKAFWEELD
Ga0207669_1086838323300025937Miscanthus RhizosphereMKTIISTLIALSVVAAVAAPANAAWDTKAFWAEQARSAT
Ga0207668_1156788223300025972Switchgrass RhizosphereMKTIISTLIALSVLTAVAAPANAAWDTKAFWAELARSAT
Ga0207658_1013832413300025986Switchgrass RhizosphereMKTIVSALLALTVLTGVAVAPASAAWDTKAFWENLERVAGGGN
Ga0207641_1080565123300026088Switchgrass RhizosphereMKTIVSALIALSVLASVSAPASAAWDTKAFWEDLARSAQ
Ga0207675_10096572313300026118Switchgrass RhizosphereMKTIASALLALSVLTSIAAPASAAWDTKAFWENLERQAGGGN
Ga0207675_10148357323300026118Switchgrass RhizosphereMKTIASALIALSVLTTVAAPANAAWDTKAFWEGLARSAQ
Ga0209813_1000093373300027866Populus EndosphereMKTLVSALIALSLVASVAAPANAAWDAKTFWDELARTAM
Ga0209813_1007377223300027866Populus EndosphereMKTIISTLIALSVLTAVAAPANAAWDTKAFWAELSRSAT
Ga0209813_1024870223300027866Populus EndosphereMNTIISTLIALSVVVAVAAPANAAWDTKAFWAELAQSAT
Ga0209813_1033492923300027866Populus EndosphereMKTIVSALLALTVLTGVAVAPASAAWDTKAFWENLE
Ga0209814_1040439913300027873Populus RhizosphereMKTIISTLIALSVLVAVAAPANAAWDTKAFWAELARSAT
Ga0207428_1081783523300027907Populus RhizosphereMKTIISTLIALSVLAAVAAPANAAWDTKAFWAELDRSRT
Ga0209382_1016913153300027909Populus RhizosphereMKTIISTLIALSVLAAVAAPANAAWDTKTFWENLARSAQ
Ga0209382_1030146013300027909Populus RhizosphereKTILAALLALSILGSAAVPVSAAWNTQAFWENLERQAGGGN
Ga0209382_1041543323300027909Populus RhizosphereMKTILSALIALSVLGSVAVPASAAWDTKKFWENLENSQGGGN
Ga0209382_1153518613300027909Populus RhizosphereMKTIVSALLALTVLTGFAVAPASAAWDTKKFWEDRERAQGGN
Ga0268265_1265346323300028380Switchgrass RhizosphereMKTIVSALLALTVLTGVAVAPASAAWDTKAFWENLERV
Ga0307503_1062796113300028802SoilRGETSMKTIVSALIALSVLAGIAAPANAAWDTKAFWEQQERART
Ga0307503_1075974213300028802SoilMKTIVSALLALTVLTGVAVAPASAAWDTKAFWENLDRQAGGGN
Ga0307495_1014654523300031199SoilALIALSVLGSVAAPASAAWDTKAFWDNLERTQGGGGN
Ga0247727_1018526133300031576BiofilmMKTIASALVALSVIAGIAAPASAAWNPQEVFAQVERNLP
Ga0307469_1167909713300031720Hardwood Forest SoilMKTIAFALIALSVLASIAAPASAAWDTKAFWEQQEQSRT
Ga0307469_1186602813300031720Hardwood Forest SoilMKTILSALIALSVLGSVAVPASAAWDTKKFWENLENSQGGGG
Ga0307468_10114547723300031740Hardwood Forest SoilMKTIASALIALSVLTTVAAPANAAWDAKAFWEGLARSAQ
Ga0307470_1073909313300032174Hardwood Forest SoilMKTIVSALLALTVLTGVAVAPASAAWDTKKFWENLENSQGGGG
Ga0307472_10225031623300032205Hardwood Forest SoilMKTILSALIALSVLGSVAVPASAAWDTKAFWDNLERTQGGGGN
Ga0364946_158158_132_2573300033815SedimentMIMKTILSALLALSFLTAVAAPASAAWDTKAFWDQQDRSSY
Ga0314783_101847_19_1413300034662SoilMKTIIISTLMALSVVAAVAAPANAAWDTKAFWAEQARSAT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.