| Basic Information | |
|---|---|
| Family ID | F094071 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 50 residues |
| Representative Sequence | FECWMGGEKIYLHKPGNSNLDMPIDINNDGTLQTPIGEIKKKGN |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 10.58 % |
| % of genes near scaffold ends (potentially truncated) | 80.19 % |
| % of genes from short scaffolds (< 2000 bps) | 89.62 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (66.038 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere (8.491 % of family members) |
| Environment Ontology (ENVO) | Unclassified (54.717 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (62.264 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.17% β-sheet: 29.17% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF06723 | MreB_Mbl | 12.26 |
| PF07995 | GSDH | 10.38 |
| PF08334 | T2SSG | 2.83 |
| PF00561 | Abhydrolase_1 | 2.83 |
| PF03061 | 4HBT | 1.89 |
| PF07963 | N_methyl | 1.89 |
| PF13544 | Obsolete Pfam Family | 1.89 |
| PF02826 | 2-Hacid_dh_C | 1.89 |
| PF10129 | OpgC_C | 1.89 |
| PF11075 | DUF2780 | 0.94 |
| PF00849 | PseudoU_synth_2 | 0.94 |
| PF13243 | SQHop_cyclase_C | 0.94 |
| PF00248 | Aldo_ket_red | 0.94 |
| PF12543 | DUF3738 | 0.94 |
| PF05988 | DUF899 | 0.94 |
| PF01381 | HTH_3 | 0.94 |
| PF02452 | PemK_toxin | 0.94 |
| PF13229 | Beta_helix | 0.94 |
| PF07638 | Sigma70_ECF | 0.94 |
| PF02518 | HATPase_c | 0.94 |
| PF11379 | DUF3182 | 0.94 |
| PF00920 | ILVD_EDD | 0.94 |
| PF01257 | 2Fe-2S_thioredx | 0.94 |
| PF04093 | MreD | 0.94 |
| PF00005 | ABC_tran | 0.94 |
| PF13279 | 4HBT_2 | 0.94 |
| PF05015 | HigB-like_toxin | 0.94 |
| PF01627 | Hpt | 0.94 |
| PF00440 | TetR_N | 0.94 |
| PF13485 | Peptidase_MA_2 | 0.94 |
| PF00034 | Cytochrom_C | 0.94 |
| PF05016 | ParE_toxin | 0.94 |
| PF00581 | Rhodanese | 0.94 |
| PF04471 | Mrr_cat | 0.94 |
| PF04255 | DUF433 | 0.94 |
| PF07617 | DUF1579 | 0.94 |
| PF04365 | BrnT_toxin | 0.94 |
| PF10459 | Peptidase_S46 | 0.94 |
| PF00072 | Response_reg | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG1077 | Cell shape-determining ATPase MreB, actin-like superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 12.26 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 10.38 |
| COG0129 | Dihydroxyacid dehydratase/phosphogluconate dehydratase | Carbohydrate transport and metabolism [G] | 1.89 |
| COG0564 | Pseudouridine synthase RluA, 23S rRNA- or tRNA-specific | Translation, ribosomal structure and biogenesis [J] | 0.94 |
| COG1187 | Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605 | Translation, ribosomal structure and biogenesis [J] | 0.94 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.94 |
| COG1905 | NADH:ubiquinone oxidoreductase 24 kD subunit (chain E) | Energy production and conversion [C] | 0.94 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.94 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.94 |
| COG2891 | Cell shape-determining protein MreD | Cell wall/membrane/envelope biogenesis [M] | 0.94 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.94 |
| COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.94 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.04 % |
| Unclassified | root | N/A | 33.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000550|F24TB_10244966 | Not Available | 542 | Open in IMG/M |
| 3300000559|F14TC_102822055 | All Organisms → cellular organisms → Bacteria | 1435 | Open in IMG/M |
| 3300000955|JGI1027J12803_109291289 | Not Available | 550 | Open in IMG/M |
| 3300004643|Ga0062591_102904797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 508 | Open in IMG/M |
| 3300005328|Ga0070676_11003002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300005332|Ga0066388_101960811 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300005337|Ga0070682_100467862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 969 | Open in IMG/M |
| 3300005340|Ga0070689_102228805 | Not Available | 502 | Open in IMG/M |
| 3300005456|Ga0070678_102223171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 520 | Open in IMG/M |
| 3300005459|Ga0068867_102316664 | Not Available | 510 | Open in IMG/M |
| 3300005539|Ga0068853_101405614 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300005539|Ga0068853_102090832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300005563|Ga0068855_100667007 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300005563|Ga0068855_101722740 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300005577|Ga0068857_100718786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 950 | Open in IMG/M |
| 3300005578|Ga0068854_101462854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300005616|Ga0068852_102088998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300005617|Ga0068859_100237347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1912 | Open in IMG/M |
| 3300005718|Ga0068866_10360337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 927 | Open in IMG/M |
| 3300005829|Ga0074479_10740111 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300005843|Ga0068860_100129054 | All Organisms → cellular organisms → Bacteria | 2424 | Open in IMG/M |
| 3300005843|Ga0068860_101394113 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300006196|Ga0075422_10352557 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 641 | Open in IMG/M |
| 3300006638|Ga0075522_10194157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1028 | Open in IMG/M |
| 3300006806|Ga0079220_10071097 | Not Available | 1715 | Open in IMG/M |
| 3300006845|Ga0075421_100398683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1653 | Open in IMG/M |
| 3300006854|Ga0075425_101533826 | Not Available | 752 | Open in IMG/M |
| 3300006904|Ga0075424_101566299 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300009078|Ga0105106_10223435 | Not Available | 1372 | Open in IMG/M |
| 3300009093|Ga0105240_10212042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2262 | Open in IMG/M |
| 3300009093|Ga0105240_10591000 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
| 3300009093|Ga0105240_10867971 | Not Available | 973 | Open in IMG/M |
| 3300009093|Ga0105240_11067631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium | 861 | Open in IMG/M |
| 3300009098|Ga0105245_12645807 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300009156|Ga0111538_10994262 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300009176|Ga0105242_12429974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300009177|Ga0105248_10064177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4123 | Open in IMG/M |
| 3300009545|Ga0105237_11903472 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300009553|Ga0105249_13025847 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300010399|Ga0134127_11291575 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 799 | Open in IMG/M |
| 3300011119|Ga0105246_10878167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 802 | Open in IMG/M |
| 3300012200|Ga0137382_11337526 | Not Available | 504 | Open in IMG/M |
| 3300012680|Ga0136612_10452874 | Not Available | 651 | Open in IMG/M |
| 3300012924|Ga0137413_11119675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 624 | Open in IMG/M |
| 3300012931|Ga0153915_12054979 | Not Available | 669 | Open in IMG/M |
| 3300013100|Ga0157373_11204087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300013104|Ga0157370_10427395 | Not Available | 1218 | Open in IMG/M |
| 3300013296|Ga0157374_11451308 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300013297|Ga0157378_12155929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300013297|Ga0157378_12260008 | Not Available | 595 | Open in IMG/M |
| 3300013307|Ga0157372_12832369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300013308|Ga0157375_11510506 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300013308|Ga0157375_13713147 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 507 | Open in IMG/M |
| 3300014325|Ga0163163_10410838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella rosea | 1412 | Open in IMG/M |
| 3300014969|Ga0157376_10475917 | Not Available | 1223 | Open in IMG/M |
| 3300014969|Ga0157376_11829442 | Not Available | 644 | Open in IMG/M |
| 3300015371|Ga0132258_10001932 | All Organisms → cellular organisms → Bacteria | 37525 | Open in IMG/M |
| 3300015372|Ga0132256_101423430 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300017966|Ga0187776_10214815 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1215 | Open in IMG/M |
| 3300021432|Ga0210384_10719473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 893 | Open in IMG/M |
| 3300025862|Ga0209483_1130919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1063 | Open in IMG/M |
| 3300025909|Ga0207705_10349574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1139 | Open in IMG/M |
| 3300025913|Ga0207695_10317293 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
| 3300025913|Ga0207695_11087327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium | 679 | Open in IMG/M |
| 3300025918|Ga0207662_10573624 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300025921|Ga0207652_10983768 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300025921|Ga0207652_11780124 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 521 | Open in IMG/M |
| 3300025927|Ga0207687_11441418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300025928|Ga0207700_11692761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 558 | Open in IMG/M |
| 3300025933|Ga0207706_11642590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300025934|Ga0207686_10764766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 772 | Open in IMG/M |
| 3300025941|Ga0207711_10046006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3729 | Open in IMG/M |
| 3300025960|Ga0207651_10856248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 808 | Open in IMG/M |
| 3300026035|Ga0207703_11056410 | Not Available | 780 | Open in IMG/M |
| 3300026067|Ga0207678_11444357 | Not Available | 608 | Open in IMG/M |
| 3300026078|Ga0207702_11223669 | Not Available | 745 | Open in IMG/M |
| 3300026142|Ga0207698_10096411 | All Organisms → cellular organisms → Bacteria | 2437 | Open in IMG/M |
| 3300026557|Ga0179587_10733183 | Not Available | 651 | Open in IMG/M |
| 3300027031|Ga0208986_1019654 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300027660|Ga0209736_1128567 | Not Available | 679 | Open in IMG/M |
| 3300027765|Ga0209073_10128722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 918 | Open in IMG/M |
| 3300027775|Ga0209177_10215014 | Not Available | 692 | Open in IMG/M |
| 3300027979|Ga0209705_10127583 | Not Available | 1372 | Open in IMG/M |
| 3300028379|Ga0268266_10030187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4606 | Open in IMG/M |
| 3300028381|Ga0268264_10154235 | All Organisms → cellular organisms → Bacteria | 2062 | Open in IMG/M |
| 3300028381|Ga0268264_12018054 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300028665|Ga0302160_10061822 | Not Available | 776 | Open in IMG/M |
| 3300030854|Ga0075385_11866568 | Not Available | 517 | Open in IMG/M |
| 3300031231|Ga0170824_107793299 | Not Available | 1278 | Open in IMG/M |
| 3300031232|Ga0302323_103121608 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 528 | Open in IMG/M |
| 3300031446|Ga0170820_15359805 | Not Available | 1229 | Open in IMG/M |
| 3300031474|Ga0170818_107228613 | Not Available | 875 | Open in IMG/M |
| 3300031679|Ga0318561_10159484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium | 1213 | Open in IMG/M |
| 3300031765|Ga0318554_10529528 | Not Available | 666 | Open in IMG/M |
| 3300031854|Ga0310904_11169803 | Not Available | 553 | Open in IMG/M |
| 3300031946|Ga0310910_10508683 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300032017|Ga0310899_10059125 | Not Available | 1432 | Open in IMG/M |
| 3300032211|Ga0310896_10719209 | Not Available | 566 | Open in IMG/M |
| 3300033289|Ga0310914_11362656 | Not Available | 612 | Open in IMG/M |
| 3300033419|Ga0316601_100034814 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3557 | Open in IMG/M |
| 3300033433|Ga0326726_11605422 | Not Available | 633 | Open in IMG/M |
| 3300033500|Ga0326730_1013346 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1778 | Open in IMG/M |
| 3300034125|Ga0370484_0045363 | Not Available | 1080 | Open in IMG/M |
| 3300034819|Ga0373958_0137470 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 8.49% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 6.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 6.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.66% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.77% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.83% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.89% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.89% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.89% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.89% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.89% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.94% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.94% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.94% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.94% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.94% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.94% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.94% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012680 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06) | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027031 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028665 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_3 | Environmental | Open in IMG/M |
| 3300030854 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033500 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fraction | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F24TB_102449662 | 3300000550 | Soil | YLHKPDAPNLEMPIDINDDGTLQTPLGELRKKAS* |
| F14TC_1028220553 | 3300000559 | Soil | CWMGGARIYLHKPDAPNLDMPIDINDDGTLQTPLGELRKKAS* |
| JGI1027J12803_1092912891 | 3300000955 | Soil | TDVGGNDEVFECWMGGAKMYLHKPDAPNLDMPIDINDDGTLQTPLGELRKKAS* |
| Ga0062591_1029047971 | 3300004643 | Soil | EEFECWTGGGKIVLHTAGTDDLSIDINNDGTLDTPLGELKKKGN* |
| Ga0070676_110030021 | 3300005328 | Miscanthus Rhizosphere | VPNLIGEGSDEFECWMSGDKIILHKPGAPNEDMPLDINLDGTIDTPVGEIKKKGN* |
| Ga0066388_1019608111 | 3300005332 | Tropical Forest Soil | TAECWMDNEKIYLHKPGESSDQDIAIDINNDGTLETPMGELKKKGN* |
| Ga0070682_1004678622 | 3300005337 | Corn Rhizosphere | ETFECWTGGEKIYLHQPANPTLDFPIDINNDGTLQTPLGEIRKKGN* |
| Ga0070689_1022288051 | 3300005340 | Switchgrass Rhizosphere | EEVFECWIGGDRIYLHKAGTSDLDMPIDINNDGTLQTPLGEIKKKGT* |
| Ga0070678_1022231712 | 3300005456 | Miscanthus Rhizosphere | GKATLTDPSGGGEEVECWTGGGKIYLHKTGDPADQAMPIDINNDGTLDTPFGEIKKKGN* |
| Ga0068867_1023166642 | 3300005459 | Miscanthus Rhizosphere | FECWMGGEKIYLHKPGNSNLDMPIDINNDGTLQTPIGEIKKKGN* |
| Ga0068853_1014056141 | 3300005539 | Corn Rhizosphere | WTGGEKIYLHQPSNPTLDMPIDINLDGTLQTPLGEIKKKGN* |
| Ga0068853_1020908321 | 3300005539 | Corn Rhizosphere | WMSGDKIILHKPGAPNEDMPLDINLDGTIDTPLGEIKKKGN* |
| Ga0068855_1006670075 | 3300005563 | Corn Rhizosphere | FRSGKATMTDLGGNDDIFECWMGGEKIYLHQPSNPNLDMPIDINLDGTLQTPLGEIKKKGN* |
| Ga0068855_1017227403 | 3300005563 | Corn Rhizosphere | FRSGKATMTDLGGNDDIFECWMGGEKIYLHQPSNPNLDMPLDINLDGTLQTPLGEIKKKGN* |
| Ga0068857_1007187864 | 3300005577 | Corn Rhizosphere | EVECWTGGGKIYLHKTGDPADQAMPIDINNDGTLDTPFGEIKKKGN* |
| Ga0068854_1014628541 | 3300005578 | Corn Rhizosphere | EGSDEFECWMSGDKIILHKPGAPNEDMPLDINLDGTIDTPVGEIKKKGN* |
| Ga0068852_1020889982 | 3300005616 | Corn Rhizosphere | ATVPNLIGEGSDEFECWMSGDKIILHKPGAPNEDMPLDINLDGTIDTPVGEIKKKGN* |
| Ga0068859_1002373471 | 3300005617 | Switchgrass Rhizosphere | LLGDDDVFECWIKGDKVILHKPGESPDTDMPIDVNLDGTLQTPLGEIKKKGN* |
| Ga0068866_103603371 | 3300005718 | Miscanthus Rhizosphere | LTDPSGGGEEVECWTGGGKIYLHKTGDPADQAMPIDINNDGTLDTPFGEIKKKGN* |
| Ga0074479_107401113 | 3300005829 | Sediment (Intertidal) | WTGGEKVYLRQPGSPNLDMPIDINLDGTLQTPIGEIKKKGN* |
| Ga0068860_1001290541 | 3300005843 | Switchgrass Rhizosphere | CWMSGDKIILHKPGAPNEDMPLDINLDGTIDTPVGEIKKKGN* |
| Ga0068860_1013941133 | 3300005843 | Switchgrass Rhizosphere | WIKGDKVILHKPGESPDTDMPIDVNLDGTLQTPLGEIKKKGN* |
| Ga0075422_103525571 | 3300006196 | Populus Rhizosphere | TIAAGLGDDEVMECWMMGDKIILHKPGEPSATDMPIDLNLDGSLQTPLGEIKKKGN* |
| Ga0075522_101941574 | 3300006638 | Arctic Peat Soil | SGGEVLECWTGGGKIYPHKPRDPASQDMPLDINNDGTLDTPFGEIKKKGN* |
| Ga0079220_100710972 | 3300006806 | Agricultural Soil | MGGGKIYLHKPGDDPKVDMPIDVNDDGTLQTPLGEIKRKGN* |
| Ga0075421_1003986831 | 3300006845 | Populus Rhizosphere | GGGEEVECWMGGGKIYLHKPGEPASKDMPIDINNDGTLDTPFGEIKKKGN* |
| Ga0075425_1015338261 | 3300006854 | Populus Rhizosphere | VECWTSGSKIILHKPGAPNEDMPLEINDDGTLDTPMGEVRKKSS* |
| Ga0075424_1015662992 | 3300006904 | Populus Rhizosphere | VILGADEEFECWTGGGTIILHKAGESNATDMPIDVNNDGTVDTPMGEIRKKGN* |
| Ga0105106_102234351 | 3300009078 | Freshwater Sediment | GGFGFASFTITFRAGKATLTDVGGNDEVFECWIGGEKIYLQKPGNSNLDMSIDINSDGTLQTPLGEVTKKGN* |
| Ga0105240_102120421 | 3300009093 | Corn Rhizosphere | CWTGGGKIYLHKPGDPAGQDMPLDINNDGTLDTPFGEIKKKGN* |
| Ga0105240_105910004 | 3300009093 | Corn Rhizosphere | GKATMTDLGGNDDIFECWMGGEKIYLHQPSNPNLDMPLDINLDGTLQTPLGEIKKKGN* |
| Ga0105240_108679711 | 3300009093 | Corn Rhizosphere | NGGLGDDETFECWMGGGKIILHTPGSDPKTDMPLDINDDGTLQTPFGEIKRKGN* |
| Ga0105240_110676312 | 3300009093 | Corn Rhizosphere | LGNMTIIFRAGKATLADPTGGGEEVECWTGGGKIYLHKPGDLASQDMPLDINNDGTLDTPFGEIKKKGN* |
| Ga0105245_126458072 | 3300009098 | Miscanthus Rhizosphere | GGLGDDETLECWMGGGKIYLHKPGDDPKVDMPVDDNNHGTLQTPLGEIKRKGN* |
| Ga0111538_109942622 | 3300009156 | Populus Rhizosphere | MLDKSGSKIILHKPGAPNEDMPIEINDDGTLDTPMGEVRKKSS* |
| Ga0105242_124299742 | 3300009176 | Miscanthus Rhizosphere | MSGDKIILDKPGAPNEDMPLDINLDGTIDTPVGEIKKKGN* |
| Ga0105248_100641775 | 3300009177 | Switchgrass Rhizosphere | DETFECWMGGGKITLHTPGGDPKTDVPIDINDDGTLQTPFGEIKRKGN* |
| Ga0105237_119034721 | 3300009545 | Corn Rhizosphere | SGGLGDDETLECWMGGGKIYLHKPGDDPKVDMPIDVNDDGTLQTPLGEIKRKGN* |
| Ga0105249_130258472 | 3300009553 | Switchgrass Rhizosphere | SGKATLADPSGGGEEVECWTGGGKIYLHKPGDPAGQDMPIDINNDGTLETPFGEIKKKGN |
| Ga0134127_112915751 | 3300010399 | Terrestrial Soil | LGDNDETFECWTGGEKIYLHQPANPTLDFPIDINNDGTLQTPLGEIRKKGN* |
| Ga0105246_108781672 | 3300011119 | Miscanthus Rhizosphere | SVPNLIGEGSDEFECWMSGDKIILHKPGAPNEDMPLDINLDGTIDTPVGEIKKKGN* |
| Ga0137382_113375261 | 3300012200 | Vadose Zone Soil | NGEVFECWISGEKILLHQPGKSNMDIPIDINNDGTLQTPLGEIKKKGN* |
| Ga0136612_104528741 | 3300012680 | Polar Desert Sand | MSGEKIYLHKPGESTDTDMPIDINNEGTLDTPFGEIKKKGN* |
| Ga0137413_111196751 | 3300012924 | Vadose Zone Soil | SGQGEVLECWMSGDKIILHKPGQSNLDMPISINHDGTLDTALGEIKKKGN* |
| Ga0153915_120549791 | 3300012931 | Freshwater Wetlands | VFQKKGHRWVTFPSGKATMTDMGGGDEAFECWMVGGKMILHKLGKSNLDMPIDINNDGSLQTPLGEIKKKGN* |
| Ga0157373_112040872 | 3300013100 | Corn Rhizosphere | NEELECWMSGDKIILHKPGAPNEDMPLDINLDGTIDTPVGEIKKKGN* |
| Ga0157370_104273951 | 3300013104 | Corn Rhizosphere | IFRSGKATMTDLGGNDDIFECWMGGEKIYLHQPSNPNLDMPIDINLDGTLQTPLGEIKKKGN* |
| Ga0157374_114513081 | 3300013296 | Miscanthus Rhizosphere | EEVECWTGGGKIYLHKPGDPAGQDMPIEINNDGTLDTPFGEIKKKGN* |
| Ga0157378_121559291 | 3300013297 | Miscanthus Rhizosphere | LIGEGSDEFECWMSGDKIILHKPGAPNEDMPLDINLDGTIDTPVGEIKKKGN* |
| Ga0157378_122600081 | 3300013297 | Miscanthus Rhizosphere | TFTDPGGNDDVFECWMGGEKIYLHQPSNPTLDMPIDINLDGTLQTPLGEIKKKGN* |
| Ga0157372_128323691 | 3300013307 | Corn Rhizosphere | GGLGDDETLECWMGGGKIYLHKPGDDPKVDMPIDVNDDGTLQTPLGEIKRKGN* |
| Ga0157375_115105061 | 3300013308 | Miscanthus Rhizosphere | LADPTGGGEEVECWTGGGKIYLHKPGDPAGQDMPIDINNDGTLDTPFGEIKKKGN* |
| Ga0157375_137131471 | 3300013308 | Miscanthus Rhizosphere | EDVFECWMSGEKIYMHQPSDPNLDMPIDINLDGTLQTPLGEVKKKGN* |
| Ga0163163_104108381 | 3300014325 | Switchgrass Rhizosphere | DDTFECWMGGEKIYLHQPSNPTLDMPIDINLDGTLQTPLGEIKKKGN* |
| Ga0182019_107287282 | 3300014498 | Fen | IVFRAGKATLADPSGEGEVLECWMSGDQIILHKPGQSKLDMPIAINNDGTLDTPMGEIRKKGN* |
| Ga0157376_104759172 | 3300014969 | Miscanthus Rhizosphere | MTDPGGNDEVFECWIGGDRIYLHKAGSSDLDMPIDINNDGTLQTPFGEIKKKGN* |
| Ga0157376_118294421 | 3300014969 | Miscanthus Rhizosphere | IGGGLGGDTETLECWMGGGKIYLHKPGDDPKVDMPIDINDDGTLQTPLGEIKLKGN* |
| Ga0132258_1000193222 | 3300015371 | Arabidopsis Rhizosphere | VILGADEEFECWTGGGKIILHKAGESNATDMPIDVNNDGTVDTPMGEIRKKGN* |
| Ga0132256_1014234302 | 3300015372 | Arabidopsis Rhizosphere | VILGTDEEFECWTGGGKIILHKAGESNATDMPIDVNNDGTVDTPMGEIRKKGN* |
| Ga0187776_102148152 | 3300017966 | Tropical Peatland | MGGTEEFECWMEREKIYLHKPGEPPENDMPIDINNDGTLETPFGEIKKKGN |
| Ga0210384_107194731 | 3300021432 | Soil | GKATMPDVGENDEVFECWMDGGKLFLHQPGKSNLDMPIDINNDGTLQTPLGEIKKKGN |
| Ga0209483_11309194 | 3300025862 | Arctic Peat Soil | LRRKIRGSGGEVLECWTGGGKIYPHKPRDPASQDMPLDINNDGTLDTPFGEIKKKGN |
| Ga0207705_103495743 | 3300025909 | Corn Rhizosphere | GNEEVFECWTGGGKVLLHKPSNANLDMPIDINDDGTLQTPLGEIKRKGN |
| Ga0207695_103172933 | 3300025913 | Corn Rhizosphere | GGGAGDELECWMSGTRIILRKPGAPSEDMPIDINNDGTLDTPLGEIRKKGN |
| Ga0207695_110873272 | 3300025913 | Corn Rhizosphere | LGNMTIIFRAGKATLADPTGGGEEVECWTGGGKIYLHKPGDLASQDMPLDINNDGTLDTPFGEIKKKGN |
| Ga0207662_105736243 | 3300025918 | Switchgrass Rhizosphere | IAALLGDDDVFECWIKGDKVILHKPGESPDTDMPIDVNLDGTLQTPLGEIKKKGN |
| Ga0207652_109837682 | 3300025921 | Corn Rhizosphere | PSGGGEEVECWTGGGKIYLHKPGDPAGQDMPIDINNDGSLDTPFGEIKKKGN |
| Ga0207652_117801241 | 3300025921 | Corn Rhizosphere | RMYLHKPDAPNLDMPIDINDDGTLQTPLGEIRKKAS |
| Ga0207687_114414182 | 3300025927 | Miscanthus Rhizosphere | KATVPNLIGEGSDEFECWMSGDKIILHKPGAPNEDMPLDINLDGTIDTPVGEIKKKGN |
| Ga0207700_116927612 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | NMTIIFRAGKATLADPTGGGEEVECWTGGGKIYLHKPGDLASQDMPLDINNDGTLDTPFGEIKKKGN |
| Ga0207706_116425902 | 3300025933 | Corn Rhizosphere | DEFECWMSGDKIILHKPGAPNEDMPLDINLDGTIDTPVGEIKKKGN |
| Ga0207686_107647661 | 3300025934 | Miscanthus Rhizosphere | GDKIILHKPGAPNEDMPLDINLDGTIDTPVGEIKKKGN |
| Ga0207711_100460061 | 3300025941 | Switchgrass Rhizosphere | WMGGGKITLHTPGGDPKTDVPIDINDDGTLQTPFGEIKRKGN |
| Ga0207651_108562481 | 3300025960 | Switchgrass Rhizosphere | SGDKIILHKPGAPNEDMPLDINLDGTIDTPVGEIKKKGN |
| Ga0207703_110564102 | 3300026035 | Switchgrass Rhizosphere | GDDDTFECWMGGGKITLHTPGGDPKADVPIDINDDGILQTPFGEIKRKGN |
| Ga0207678_114443571 | 3300026067 | Corn Rhizosphere | MTDPGGNEEVFECWIGGDRIYLHKAGTSDLDMPIDINNDGTLQTPLGEIKKKGN |
| Ga0207702_112236691 | 3300026078 | Corn Rhizosphere | GGLGDDETFECWMGGGKIILHTPGSDPKTDMPLDINDDGTLQTPFGEIKRKGN |
| Ga0207698_100964113 | 3300026142 | Corn Rhizosphere | ATVPNLIGEGSDEFECWMSGDKIILHKPGAPNEDMPLDINLDGTIDTPVGEIKKKGN |
| Ga0179587_107331831 | 3300026557 | Vadose Zone Soil | KAIVNGGLGDDETFECWMGGGKIVLHTPGGDPKTDMPLDINDDGTLQTPFGEIKRKGN |
| Ga0208986_10196542 | 3300027031 | Forest Soil | NDEVFECWMTGEKLLLHQPGRSNLDMPIDINNDGTLQTPLGEIKKKGN |
| Ga0209736_11285672 | 3300027660 | Forest Soil | MTDVGGNDEVFECWMGGGKILLHQPAHANLDMPIDLNNDGTLQTPLGEIKKKGN |
| Ga0209073_101287222 | 3300027765 | Agricultural Soil | MGGGKIYLHKPGDDPKVDMPIDVNDDGTLQTPLGEIKRKGN |
| Ga0209177_102150141 | 3300027775 | Agricultural Soil | LECWMGGGKIYLHKPGDDPKVDMPIDVNDDGTLQTPLGEIKRKGN |
| Ga0209705_101275831 | 3300027979 | Freshwater Sediment | GGFGFASFTITFRAGKATLTDVGGNDEVFECWIGGEKIYLQKPGNSNLDMSIDINSDGTLQTPLGEVTKKGN |
| Ga0268266_100301875 | 3300028379 | Switchgrass Rhizosphere | IYLHKPGDDPKVDMPIDINDDGTLQTPLGEIKRKGN |
| Ga0268264_101542351 | 3300028381 | Switchgrass Rhizosphere | GDKIMLHKPGAPNEDMPLDINLDGTIDTPVGEIKKKGN |
| Ga0268264_120180541 | 3300028381 | Switchgrass Rhizosphere | WIKGDKVILHKPGESPDTDMPIDVNLDGTLQTPLGEIKKKGN |
| Ga0302160_100618222 | 3300028665 | Fen | KATMTDPGGNDEVLECWFGGDKIYLHKPGNSSLDMPIDINNDGTLQTPLGEIKKKGN |
| Ga0075385_118665681 | 3300030854 | Soil | MLDGGGKIILHTPGGDPKTDMPIDINDDGTLQTPFGEIKRKGN |
| Ga0170824_1077932991 | 3300031231 | Forest Soil | LTGDGGEELECWTSGTKILLHKPGNPNLDMSIDINNDGTLDTPLGEIRKKGN |
| Ga0170824_1084346041 | 3300031231 | Forest Soil | MGGGKIILHKPGQNSEMDLPLDLNKDGTIDTPFGEVKKKGD |
| Ga0302323_1031216081 | 3300031232 | Fen | ECWMGGEKIYLHDPVHPNYDMAIDVNNDGTLQTPLGEIKKKGN |
| Ga0170820_153598052 | 3300031446 | Forest Soil | GGEELECWTSGTKILLHKPGNPNLDMSIDINNDGTLDTPLGEIRKKGN |
| Ga0170818_1072286132 | 3300031474 | Forest Soil | ECWMTGEKLLLHQPGKANLDMPIDINNDGTLQTPLGEIKKKGN |
| Ga0318561_101594841 | 3300031679 | Soil | MTFRSGKATMTDAGGNDEVFECWMGGGRMYLHKPDAPNLDMPIDINDDGSLQTPLGEIRKKAS |
| Ga0318554_105295281 | 3300031765 | Soil | ATMTDGGGNDEVFECWMGGGRMYLHKPDAPNLDMPIDINDDGSLQTPLGEIRKKAS |
| Ga0310904_111698031 | 3300031854 | Soil | GARMYLHKPDAPNLDMPIDINDDGTLQTPLGEIRKKAS |
| Ga0310910_105086832 | 3300031946 | Soil | RSGKATMTDAGGNDEVFECWMGGGRMYLHKPDAPNLDMPIDINDDGSLQTPLGEIRKKAS |
| Ga0310899_100591251 | 3300032017 | Soil | ECWMGGGKVYLHKPGESQDIAIDINDDGTLQSPLGELKKKGNQ |
| Ga0310896_107192091 | 3300032211 | Soil | GGARMYLHKPDAPNLDMPIDINDDGTLQTPLGELRKKAS |
| Ga0310914_113626562 | 3300033289 | Soil | ATMTDAGGNDEVFECWMGGGRMYLHKPDAPNLDMPIDINDDGTLQTPLGELRKKAS |
| Ga0316601_1000348144 | 3300033419 | Soil | GTTELECWSDGQRLYLHKAGDTAEQDMPIEINEDGTLDTPFGEVKRKGK |
| Ga0326726_116054222 | 3300033433 | Peat Soil | CWMGGAKMYLHKPDAPNLDMPIDINDDGTLQTPLGELRKKAS |
| Ga0326730_10133464 | 3300033500 | Peat Soil | DGEKIYLHKPGESTDTDMPIDINNDGTLETPFGEIKKKGN |
| Ga0370484_0045363_97_258 | 3300034125 | Untreated Peat Soil | MMDIGGTSEFECWIGGGRIYLHEAGSSAEDIPLDINKDGTLDGPMGELKKKGN |
| Ga0373958_0137470_421_591 | 3300034819 | Rhizosphere Soil | MKDAIGDNDTTLECWMKGDKIYLHQPGDAPSQDMPIDINDDGTLQTPIGELKKKGK |
| ⦗Top⦘ |