| Basic Information | |
|---|---|
| Family ID | F094035 |
| Family Type | Metagenome |
| Number of Sequences | 106 |
| Average Sequence Length | 42 residues |
| Representative Sequence | RIGDLRSHMDSRFDDMRATWHSELRRVEEVLDARLKHLEER |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.81 % |
| % of genes near scaffold ends (potentially truncated) | 83.02 % |
| % of genes from short scaffolds (< 2000 bps) | 84.91 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (85.849 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (9.434 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.943 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (55.660 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.52% β-sheet: 0.00% Coil/Unstructured: 43.48% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF01715 | IPPT | 5.71 |
| PF12706 | Lactamase_B_2 | 4.76 |
| PF00312 | Ribosomal_S15 | 4.76 |
| PF01266 | DAO | 3.81 |
| PF13483 | Lactamase_B_3 | 2.86 |
| PF00578 | AhpC-TSA | 2.86 |
| PF01138 | RNase_PH | 2.86 |
| PF00300 | His_Phos_1 | 1.90 |
| PF13544 | Obsolete Pfam Family | 1.90 |
| PF08241 | Methyltransf_11 | 1.90 |
| PF00069 | Pkinase | 1.90 |
| PF01381 | HTH_3 | 1.90 |
| PF00436 | SSB | 1.90 |
| PF14559 | TPR_19 | 1.90 |
| PF14534 | DUF4440 | 1.90 |
| PF01040 | UbiA | 1.90 |
| PF01169 | UPF0016 | 0.95 |
| PF00109 | ketoacyl-synt | 0.95 |
| PF03989 | DNA_gyraseA_C | 0.95 |
| PF03571 | Peptidase_M49 | 0.95 |
| PF02321 | OEP | 0.95 |
| PF02687 | FtsX | 0.95 |
| PF07690 | MFS_1 | 0.95 |
| PF04366 | Ysc84 | 0.95 |
| PF13231 | PMT_2 | 0.95 |
| PF01663 | Phosphodiest | 0.95 |
| PF00083 | Sugar_tr | 0.95 |
| PF01425 | Amidase | 0.95 |
| PF01906 | YbjQ_1 | 0.95 |
| PF06439 | 3keto-disac_hyd | 0.95 |
| PF00717 | Peptidase_S24 | 0.95 |
| PF07929 | PRiA4_ORF3 | 0.95 |
| PF11799 | IMS_C | 0.95 |
| PF08668 | HDOD | 0.95 |
| PF00266 | Aminotran_5 | 0.95 |
| PF07075 | DUF1343 | 0.95 |
| PF03481 | Sua5_C | 0.95 |
| PF08003 | Methyltransf_9 | 0.95 |
| PF07811 | TadE | 0.95 |
| PF03726 | PNPase | 0.95 |
| PF13432 | TPR_16 | 0.95 |
| PF00579 | tRNA-synt_1b | 0.95 |
| PF01144 | CoA_trans | 0.95 |
| PF01804 | Penicil_amidase | 0.95 |
| PF00106 | adh_short | 0.95 |
| PF12847 | Methyltransf_18 | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 7.62 |
| COG0324 | tRNA A37 N6-isopentenylltransferase MiaA | Translation, ribosomal structure and biogenesis [J] | 5.71 |
| COG0184 | Ribosomal protein S15P/S13E | Translation, ribosomal structure and biogenesis [J] | 4.76 |
| COG1185 | Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) | Translation, ribosomal structure and biogenesis [J] | 3.81 |
| COG0689 | Ribonuclease PH | Translation, ribosomal structure and biogenesis [J] | 2.86 |
| COG2123 | Exosome complex RNA-binding protein Rrp42, RNase PH superfamily | Intracellular trafficking, secretion, and vesicular transport [U] | 2.86 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 1.90 |
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 1.90 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.90 |
| COG4670 | Acyl CoA:acetate/3-ketoacid CoA transferase | Lipid transport and metabolism [I] | 0.95 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| COG3876 | Exo-beta-N-acetylmuramidase YbbC/NamZ, DUF1343 family | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.95 |
| COG2366 | Acyl-homoserine lactone (AHL) acylase PvdQ | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.95 |
| COG2119 | Putative Ca2+/H+ antiporter, TMEM165/GDT1 family | General function prediction only [R] | 0.95 |
| COG2057 | Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit | Lipid transport and metabolism [I] | 0.95 |
| COG1788 | Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit | Lipid transport and metabolism [I] | 0.95 |
| COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 0.95 |
| COG0188 | DNA gyrase/topoisomerase IV, subunit A | Replication, recombination and repair [L] | 0.95 |
| COG0180 | Tryptophanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| COG0162 | Tyrosyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.85 % |
| Unclassified | root | N/A | 14.15 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005330|Ga0070690_100712604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 771 | Open in IMG/M |
| 3300005334|Ga0068869_100295085 | All Organisms → cellular organisms → Bacteria | 1307 | Open in IMG/M |
| 3300005334|Ga0068869_101191563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 669 | Open in IMG/M |
| 3300005336|Ga0070680_100521718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1017 | Open in IMG/M |
| 3300005354|Ga0070675_101672837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300005355|Ga0070671_101653435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300005434|Ga0070709_11670057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300005458|Ga0070681_11740306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300005458|Ga0070681_11740306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300005542|Ga0070732_10645965 | Not Available | 643 | Open in IMG/M |
| 3300005544|Ga0070686_100848612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 739 | Open in IMG/M |
| 3300005564|Ga0070664_100126430 | All Organisms → cellular organisms → Bacteria | 2243 | Open in IMG/M |
| 3300005564|Ga0070664_102002255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300005614|Ga0068856_100051851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4045 | Open in IMG/M |
| 3300005618|Ga0068864_100011438 | All Organisms → cellular organisms → Bacteria | 7331 | Open in IMG/M |
| 3300005836|Ga0074470_11457115 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300005843|Ga0068860_101601218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
| 3300006050|Ga0075028_100373543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 810 | Open in IMG/M |
| 3300006102|Ga0075015_100047451 | All Organisms → cellular organisms → Bacteria | 2020 | Open in IMG/M |
| 3300006237|Ga0097621_100412864 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300006354|Ga0075021_10060109 | All Organisms → cellular organisms → Bacteria | 2211 | Open in IMG/M |
| 3300006881|Ga0068865_101011469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 728 | Open in IMG/M |
| 3300007265|Ga0099794_10791614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 507 | Open in IMG/M |
| 3300009038|Ga0099829_11695254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 520 | Open in IMG/M |
| 3300009174|Ga0105241_12221388 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300009176|Ga0105242_10356212 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1353 | Open in IMG/M |
| 3300009176|Ga0105242_11082759 | Not Available | 814 | Open in IMG/M |
| 3300009176|Ga0105242_11957406 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300009176|Ga0105242_12101895 | Not Available | 608 | Open in IMG/M |
| 3300009177|Ga0105248_10040582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 5217 | Open in IMG/M |
| 3300009177|Ga0105248_10543081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1311 | Open in IMG/M |
| 3300009524|Ga0116225_1064120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1742 | Open in IMG/M |
| 3300009545|Ga0105237_11529417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300009545|Ga0105237_11684449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 641 | Open in IMG/M |
| 3300009551|Ga0105238_10042569 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4598 | Open in IMG/M |
| 3300010371|Ga0134125_11485551 | Not Available | 738 | Open in IMG/M |
| 3300010373|Ga0134128_10079423 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 3747 | Open in IMG/M |
| 3300010397|Ga0134124_12852946 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300010401|Ga0134121_11664571 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300011270|Ga0137391_10620878 | Not Available | 904 | Open in IMG/M |
| 3300011271|Ga0137393_10802345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 804 | Open in IMG/M |
| 3300011271|Ga0137393_11193485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 646 | Open in IMG/M |
| 3300012210|Ga0137378_10913518 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300012917|Ga0137395_10940757 | Not Available | 623 | Open in IMG/M |
| 3300012971|Ga0126369_12267595 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300013296|Ga0157374_12250967 | Not Available | 572 | Open in IMG/M |
| 3300014325|Ga0163163_10402315 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1427 | Open in IMG/M |
| 3300014501|Ga0182024_10543983 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1467 | Open in IMG/M |
| 3300014501|Ga0182024_12727098 | Not Available | 528 | Open in IMG/M |
| 3300014968|Ga0157379_10264871 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1562 | Open in IMG/M |
| 3300017972|Ga0187781_10304354 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300018047|Ga0187859_10429006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae | 728 | Open in IMG/M |
| 3300018062|Ga0187784_10219004 | All Organisms → cellular organisms → Bacteria | 1552 | Open in IMG/M |
| 3300021168|Ga0210406_10534557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 923 | Open in IMG/M |
| 3300021170|Ga0210400_10002568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 16682 | Open in IMG/M |
| 3300021181|Ga0210388_10239624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1591 | Open in IMG/M |
| 3300021405|Ga0210387_10657159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 930 | Open in IMG/M |
| 3300021432|Ga0210384_10019085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 6653 | Open in IMG/M |
| 3300021432|Ga0210384_11141595 | Not Available | 683 | Open in IMG/M |
| 3300021477|Ga0210398_10456592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1041 | Open in IMG/M |
| 3300021559|Ga0210409_10614758 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300021559|Ga0210409_10620464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 950 | Open in IMG/M |
| 3300021559|Ga0210409_11719593 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300025506|Ga0208937_1145325 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300025899|Ga0207642_10742582 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300025913|Ga0207695_10871623 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300025914|Ga0207671_10346298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1178 | Open in IMG/M |
| 3300025916|Ga0207663_11727010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 503 | Open in IMG/M |
| 3300025924|Ga0207694_10052757 | Not Available | 3152 | Open in IMG/M |
| 3300025934|Ga0207686_10244522 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1307 | Open in IMG/M |
| 3300025934|Ga0207686_10518573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 927 | Open in IMG/M |
| 3300025934|Ga0207686_10666616 | Not Available | 824 | Open in IMG/M |
| 3300025937|Ga0207669_10918876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300025938|Ga0207704_10927600 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300025942|Ga0207689_11535895 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300025944|Ga0207661_11368172 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300025945|Ga0207679_10106034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2208 | Open in IMG/M |
| 3300025949|Ga0207667_10635797 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300026035|Ga0207703_10957501 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300026088|Ga0207641_11204747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 757 | Open in IMG/M |
| 3300026088|Ga0207641_12244932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 546 | Open in IMG/M |
| 3300026089|Ga0207648_10647748 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 976 | Open in IMG/M |
| 3300026095|Ga0207676_10027250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 4255 | Open in IMG/M |
| 3300026095|Ga0207676_11733408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 623 | Open in IMG/M |
| 3300027641|Ga0208827_1040799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1602 | Open in IMG/M |
| 3300027754|Ga0209596_1156736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1008 | Open in IMG/M |
| 3300027765|Ga0209073_10089730 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1071 | Open in IMG/M |
| 3300027826|Ga0209060_10010975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5343 | Open in IMG/M |
| 3300028381|Ga0268264_11671256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300029908|Ga0311341_10845983 | Not Available | 504 | Open in IMG/M |
| 3300030045|Ga0302282_1337526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300030520|Ga0311372_12762382 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300031057|Ga0170834_109872709 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300031057|Ga0170834_112455542 | Not Available | 1125 | Open in IMG/M |
| 3300031234|Ga0302325_11149332 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300031236|Ga0302324_101365986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 930 | Open in IMG/M |
| 3300031525|Ga0302326_11145001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 1076 | Open in IMG/M |
| 3300031715|Ga0307476_11109260 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300031754|Ga0307475_11287180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300032180|Ga0307471_101931124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
| 3300032421|Ga0310812_10200173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 866 | Open in IMG/M |
| 3300032805|Ga0335078_10540366 | Not Available | 1486 | Open in IMG/M |
| 3300032954|Ga0335083_10258935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1551 | Open in IMG/M |
| 3300033412|Ga0310810_10095418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3553 | Open in IMG/M |
| 3300033475|Ga0310811_10360561 | All Organisms → cellular organisms → Bacteria | 1622 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.55% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 6.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 6.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 6.60% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 4.72% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.77% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.77% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.83% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.89% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.89% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.89% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.89% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.89% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.94% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.94% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.94% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.94% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.94% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025506 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300029908 | II_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300030045 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_3 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070690_1007126041 | 3300005330 | Switchgrass Rhizosphere | NARLSDLRAHMDSRFDDMKDMWRGELRRVEEVLDARLKHLEERTS* |
| Ga0068869_1002950853 | 3300005334 | Miscanthus Rhizosphere | LVNNARLSDLRSHLDVRFEEMKDLWRSELHRVEEVLDARLKHLEER* |
| Ga0068869_1011915631 | 3300005334 | Miscanthus Rhizosphere | LIGILINNARLSDLRAHMDSRFDDMKDMWRGELRRVEEVLDARLKHLEERTS* |
| Ga0070680_1005217182 | 3300005336 | Corn Rhizosphere | MNSRINDLRSHMDSRFEEMRATWHSELRRVEEVLDARLKHLEER* |
| Ga0070675_1016728372 | 3300005354 | Miscanthus Rhizosphere | GDNNTRIAELRTHMDNRFDDMKDMWRSELHRVEEVLDARLRHLEER* |
| Ga0070671_1016534351 | 3300005355 | Switchgrass Rhizosphere | NTRIGETNIRIGELRSHMDVRFEEMKDLWRSELHRVEEVIDARLKHIER* |
| Ga0070709_116700571 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | ETNSRIGELRSHMDARFEEMKDLWRSELHRVEEVIDARLRHIEGR* |
| Ga0070681_117403062 | 3300005458 | Corn Rhizosphere | MNSRINDLRSHMDSCFDEMRATWHSELRRVEEVLDARLKHLEER* |
| Ga0070681_117403063 | 3300005458 | Corn Rhizosphere | NNSRLSDLRSHMDSRFDDMRATWHSELRRVEEVLDARLKHLEER* |
| Ga0070732_106459651 | 3300005542 | Surface Soil | SRMADIRVHFDQRIDEVKETWRSELRRVEEVLDARLNHLEERLR* |
| Ga0070686_1008486121 | 3300005544 | Switchgrass Rhizosphere | LSDLRAHMDSRFDDMKDMWRGELRRVEEVLDARLKHLEERTS* |
| Ga0070664_1001264303 | 3300005564 | Corn Rhizosphere | SRIGDLRSHIDSRFDEMRSTWQSELRRVEEVLDARLKHLEER* |
| Ga0070664_1020022551 | 3300005564 | Corn Rhizosphere | RLGDLRSHMDSRFDDMRTHWQSELRRVEEVLDARLRHLEEH* |
| Ga0068856_1000518511 | 3300005614 | Corn Rhizosphere | GDLRSHIDSRFDEMRSTWQSELRRVEEVLDARLKHLEER* |
| Ga0068864_1000114386 | 3300005618 | Switchgrass Rhizosphere | LAKQTGRIGNNDAKIGELRSHMDVRFEEMKDLWRSELHRVEEVIDARLKHIER* |
| Ga0074470_114571151 | 3300005836 | Sediment (Intertidal) | THMDARFDEMRDTWRAELRRIEETIDARLKRLEQS* |
| Ga0068860_1016012181 | 3300005843 | Switchgrass Rhizosphere | HMDSRFDDIRATWHSELRRVEGVLDARLKHLEER* |
| Ga0075028_1003735431 | 3300006050 | Watersheds | LRSHMDVPFEEMKDPWRSELHRVREVIVARLKHIKGR* |
| Ga0075015_1000474511 | 3300006102 | Watersheds | MHMNARFDAVNQRLNDLRDLWSTELHRVEEVLDARLKHLEER* |
| Ga0097621_1004128641 | 3300006237 | Miscanthus Rhizosphere | RIDDLRSNVDTRIDDLRSHMDSRFDEMRSTWTSELRRVKEVLDARLKHLEER* |
| Ga0075021_100601091 | 3300006354 | Watersheds | LMHMNARFDAVNQRLNDLRDLWSTELHRVEEVLDARLKHLEER* |
| Ga0068865_1010114693 | 3300006881 | Miscanthus Rhizosphere | AHMDSRFDDMKDMWRGELRRVEEVLDARLKHLEERTS* |
| Ga0099794_107916143 | 3300007265 | Vadose Zone Soil | RLAEIDRGLNARIDDLRSHMDARFDDMRTTWQSELRRVEEVLDAA* |
| Ga0099829_116952542 | 3300009038 | Vadose Zone Soil | MDSRFEDIKDTWRAELRRVEEVIDARLKHLEERG* |
| Ga0105241_122213881 | 3300009174 | Corn Rhizosphere | RLSDLKSHVDSRFDDMKDMSRSELHRVEEVLDARLKHLEERT* |
| Ga0105242_103562124 | 3300009176 | Miscanthus Rhizosphere | GDVNSRIDDLRGHMDSRFDEMRATWHSELRRVEEVLDARLKHLEER* |
| Ga0105242_110827592 | 3300009176 | Miscanthus Rhizosphere | GDLNARVGETNARIAELRSHMDSRFEEMKDLWRSELHRVEEVIDARLRHIEGR* |
| Ga0105242_119574062 | 3300009176 | Miscanthus Rhizosphere | ADGAHMDSRFDDMRATWHSELRRVEEVLDARLKHLEER* |
| Ga0105242_121018951 | 3300009176 | Miscanthus Rhizosphere | ELRSHMDGRFDEMRATWQAELHRVEEVLDARLKHLEER* |
| Ga0105248_100405828 | 3300009177 | Switchgrass Rhizosphere | TRIGETNTRIGELRSHMDVRFEEMKDLWRSELHRVEEVIDARLKHIER* |
| Ga0105248_105430814 | 3300009177 | Switchgrass Rhizosphere | GDLRSHMDSRFDDMRTHWQSELRRVEEVLDARLRHLEEH* |
| Ga0116225_10641201 | 3300009524 | Peatlands Soil | IDDFRLHVDSRFSATDALFTERLRRVEEVMDARLKHLEES* |
| Ga0105237_115294171 | 3300009545 | Corn Rhizosphere | RIGDLRSHMDSRFDDMRATWHSELRRVEEVLDARLKHLEER* |
| Ga0105237_116844491 | 3300009545 | Corn Rhizosphere | NSRLSDLKSHVDSRFDDMKDMWRSELHRVEEVLDARLKHMEERR* |
| Ga0105238_100425691 | 3300009551 | Corn Rhizosphere | MNSRINDLRSHMDSRFDEMRATWHSELRRVEEVLDARLKHLEER* |
| Ga0134125_114855511 | 3300010371 | Terrestrial Soil | MDRKMDHRFDDMKDMWRSELHRVEEVLDARLKHLEERA* |
| Ga0134128_100794232 | 3300010373 | Terrestrial Soil | VAETNTRIGELRSHMDVRFEEMKDLWRSELHRVEEVIDARLKHIEER* |
| Ga0134124_128529462 | 3300010397 | Terrestrial Soil | ACGPMDSRFDDMRATWHSELRRVEEVLDARLKHLEER* |
| Ga0134121_116645711 | 3300010401 | Terrestrial Soil | TNTRIGETNIRIGELRSHMDVRFEEMKGLWRSELHRVEEVIDARLKHIER* |
| Ga0137391_106208781 | 3300011270 | Vadose Zone Soil | NSRLTHLRIHVDRRFDELRDLWRAELRRVGGVIDARLKHLQDRV* |
| Ga0137393_108023451 | 3300011271 | Vadose Zone Soil | IGELRSHMDARFDDMRETWRSELHRVEEVIDARLKHLEER* |
| Ga0137393_111934854 | 3300011271 | Vadose Zone Soil | RSHMDVRFDDMRTTWQSELQRVEEVLDARLKHLEAR* |
| Ga0137378_109135181 | 3300012210 | Vadose Zone Soil | RFSRIDQQFADSREMWRSELRRVEEVLDARLKHLEER* |
| Ga0137395_109407572 | 3300012917 | Vadose Zone Soil | DHRFDDMRDMWRSELHRVEEVLDARLKHLEEGFR* |
| Ga0126369_122675951 | 3300012971 | Tropical Forest Soil | INNARLSDLRSHIDHRFDDMKDLWRSELHRVEEVLDARLKHLEER* |
| Ga0157374_122509671 | 3300013296 | Miscanthus Rhizosphere | NDRGSHMDSRFDEMRAAWHSELRRVEEVLDARLKHLEER* |
| Ga0163163_104023151 | 3300014325 | Switchgrass Rhizosphere | DVNSRIDDLRGHMDSRFDEMRATWHSELRRVEEVLDARLKHLEER* |
| Ga0182024_105439831 | 3300014501 | Permafrost | DSRINDLRSHMDSRFDEMRSTWTSELRRVGEILDARLKHLEER* |
| Ga0182024_127270983 | 3300014501 | Permafrost | HMDNRFDDMKETWRAELQRVEGVLDARLKHFEDS* |
| Ga0157379_102648711 | 3300014968 | Switchgrass Rhizosphere | DDLRSHMDSRFDEMRSAWTSELRRVKEVLDARLKHLEER* |
| Ga0187781_103043541 | 3300017972 | Tropical Peatland | ARFADLSSHIDARFDDMRSTWKSELHRVEEVLDARLKHLEER |
| Ga0187859_104290062 | 3300018047 | Peatland | LVGILVNNSRLNDLRGHMDARFADMRETWRSDLRRVEEVLDARLKHLEAR |
| Ga0187784_102190044 | 3300018062 | Tropical Peatland | SHIDARFDDMRSTWKSELHRVEEVLDARLKHLEER |
| Ga0210406_105345571 | 3300021168 | Soil | MDKKMDQRFIDAKDMWRSELHRVEEVLDARLKHLEER |
| Ga0210400_1000256810 | 3300021170 | Soil | MNGRLGDVNARLGDLRHHIDSQFDEVGRRFDDMKDVWRSELHRVEEMLDAKLKHLEERA |
| Ga0210388_102396243 | 3300021181 | Soil | MNSRLDDLRSHMDARFDGLKDMWRSELHRVEEVLDARLRHLEER |
| Ga0210387_106571593 | 3300021405 | Soil | LTRLSDLGSHMDIRFNEMRDLWRSELYRVEQVIDARLKHLE |
| Ga0210384_100190853 | 3300021432 | Soil | LINNSRLTGLRVHVDGRFDEMRDLWRAELRRVEEVIDARLKHLEERG |
| Ga0210384_111415952 | 3300021432 | Soil | GELRSDMNARFAEMRDASRADLRRVEEVIDARLKHLEER |
| Ga0210398_104565921 | 3300021477 | Soil | LSERMEPDDMRDLWRAELRRVEEVLDARLKHLEERG |
| Ga0210409_106147583 | 3300021559 | Soil | AHMDTRFDDMRDTWRSELHRVEEVLDARLRHLAERG |
| Ga0210409_106204641 | 3300021559 | Soil | TELRSHMDARFDDMRVTWQAALRRVEEVLDARLKHLEER |
| Ga0210409_117195931 | 3300021559 | Soil | RFNAMDVRFEEVKDLWRSELHRVEEVLDARLKHLEER |
| Ga0208937_11453252 | 3300025506 | Peatland | ARIAELRGHMDIRFDEMRDLWRSELYRVEQAIDARLKHLEERG |
| Ga0207642_107425821 | 3300025899 | Miscanthus Rhizosphere | RNHVDSRFDDMKDMWRSELHRVEEVLDARLKHLEERI |
| Ga0207707_105761213 | 3300025912 | Corn Rhizosphere | RIGELRSHMDVRFEEMKDLWRSELHRVEEVIDARLKHIER |
| Ga0207695_108716231 | 3300025913 | Corn Rhizosphere | IGDLRSHIDSRFDEIRSTWQSELRRVEEVLDARLKHLEER |
| Ga0207671_103462981 | 3300025914 | Corn Rhizosphere | IGELRSHMDVRFEEMKDLWRSELHRVEEVIDARLKHIEH |
| Ga0207663_117270102 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | DLRSHMDSRFDEMRSTWTSELRRVEEVLDARLKHLEER |
| Ga0207694_100527571 | 3300025924 | Corn Rhizosphere | SHVDSRFDDMKDMSRSELHRVEEVLDARLKHLEERT |
| Ga0207686_102445223 | 3300025934 | Miscanthus Rhizosphere | GETNARIGELRSHMDSRFEEMKDLWRSELHRVEEVIDARLRHIEGR |
| Ga0207686_105185732 | 3300025934 | Miscanthus Rhizosphere | LRSHLDVRFEEMKDLWRSELHRVGEVLDARLKHLEER |
| Ga0207686_106666161 | 3300025934 | Miscanthus Rhizosphere | INNSRLSDLRSHMDVRLDELKEMWRSELHRVEEVLDARLKHLEER |
| Ga0207669_109188762 | 3300025937 | Miscanthus Rhizosphere | ISELRTHMDVRFEEMKDLWRSELHRVEEVIDARLKHIER |
| Ga0207704_109276003 | 3300025938 | Miscanthus Rhizosphere | LRAHMDSRFDDMKDMWRGELRRVEEVLDARLKHLEERTS |
| Ga0207689_115358952 | 3300025942 | Miscanthus Rhizosphere | ILVNNARLSDLRSHLDVRFEEMKDLWRSELHRVEEVLDARLKHLEER |
| Ga0207661_113681721 | 3300025944 | Corn Rhizosphere | DSRIGDLRSHMDFRFDEMRTTWKSELRRVEEVLDARLKHLEER |
| Ga0207679_101060343 | 3300025945 | Corn Rhizosphere | SRIGDLRSHIDSRFDEMRSTWQSELRRVEEVLDARLKHLEER |
| Ga0207667_106357971 | 3300025949 | Corn Rhizosphere | MNSRINDLRSHMDSRFEEMRATWHSELRRVEEVLD |
| Ga0207703_109575011 | 3300026035 | Switchgrass Rhizosphere | INNARLSDLRAHMDSRFDDMKDMWRGELRRVEEVLDARLKHLEERTS |
| Ga0207641_112047472 | 3300026088 | Switchgrass Rhizosphere | NGRIGELRSHFDHRFDDLKETWRSELRRVEEVLDARLSHLEERLR |
| Ga0207641_122449321 | 3300026088 | Switchgrass Rhizosphere | MNSRINDLRSHMDSCFDEMRATWHSELRRVEEVLDARLKHL |
| Ga0207648_106477481 | 3300026089 | Miscanthus Rhizosphere | MQAEMNRRFDESKDLWRSELHRVEEILDARLKHLEER |
| Ga0207676_100272502 | 3300026095 | Switchgrass Rhizosphere | LAKQTGRIGNNDAKIGELRSHMDVRFEEMKDLWRSELHRVEEVIDARLKHIER |
| Ga0207676_117334082 | 3300026095 | Switchgrass Rhizosphere | FDHRFDDLKETWRSELRRVEEVLDARLSHLEERLR |
| Ga0208827_10407991 | 3300027641 | Peatlands Soil | DDLRSHMDTRFSATDALFTERLRRVEEVLDARLKHLEES |
| Ga0209596_11567363 | 3300027754 | Freshwater Lake | AHMDHRFDDTRDMWRTELHRVEEILDARLKHIEERR |
| Ga0209073_100897302 | 3300027765 | Agricultural Soil | MNSRINDLRSHMDSCFDEMRATWHSELRRVEEVLDARLKHLEER |
| Ga0209060_100109751 | 3300027826 | Surface Soil | NSPLSDVNTRITELRSHLDDRFNVVDRRFEEMKDMWRSELRRVEEVLDARLRHLEER |
| Ga0268264_116712561 | 3300028381 | Switchgrass Rhizosphere | TDLRSHMDSRFDDIRATWHSELRRVEGVLDARLKHLEER |
| Ga0311341_108459831 | 3300029908 | Bog | SRLNDMNGRISDLRSHMDTRFDDMRVMWQSELHRVEEVLDARLRHLEEN |
| Ga0302282_13375261 | 3300030045 | Fen | FKGIDAPLDGMNQRFDDLRDLWRAELHRVEEVLGARLKHLEER |
| Ga0311372_127623821 | 3300030520 | Palsa | LNDLRRHMDARFDDMRETWRSELRRVEEVIDARLKRLEAR |
| Ga0170834_1098727093 | 3300031057 | Forest Soil | MDRGLNARIDDLRSHMDTRFDDMRATWQSELRRVEGVLDARLKHLEAR |
| Ga0170834_1124555422 | 3300031057 | Forest Soil | HVDGRFDEMRDLWRAELRRVEEVIDARLKHLEDRG |
| Ga0302325_111493322 | 3300031234 | Palsa | RLNDLRSHIDARFDEMRETWRAELRRVEEVLDARLKHIEKD |
| Ga0302324_1013659862 | 3300031236 | Palsa | RLGAAIKESRDHMDTRFNEIRDLWRSELYRVEQVFDARLKHLEERGR |
| Ga0302326_111450012 | 3300031525 | Palsa | RSHMDNRFDDARDSWRAELRRVEEVIDARLKHIEDR |
| Ga0307476_111092601 | 3300031715 | Hardwood Forest Soil | LGDLSSSLNARFGDLRAHMDVRFEEMKDLWRSELHRVEEVIDARLKHIEER |
| Ga0307475_112871801 | 3300031754 | Hardwood Forest Soil | ELRSHMDSRFDDIRATWQAELRRVEEVLDARLKHLEER |
| Ga0307471_1019311242 | 3300032180 | Hardwood Forest Soil | TDLRSHMDSLFDDMRATWHSELRRVEEVLDARLKHLEER |
| Ga0310812_102001731 | 3300032421 | Soil | INDLRSHMDSCFDEMRATWHSELRRVEEVLDARLKHLEER |
| Ga0335078_105403662 | 3300032805 | Soil | LDLQRRMDQRFDEMKELWQSELRRVEEILDARLKHIEER |
| Ga0335083_102589353 | 3300032954 | Soil | MDARIDDLRTDLKDTWRAELRRVEEVLDARLKHLEER |
| Ga0310810_100954181 | 3300033412 | Soil | MNSRINDLRSHMDSRFDEMRATWHSELRRVEEVLDARLKHLEER |
| Ga0310811_103605611 | 3300033475 | Soil | VNSRINDLRSHMDSRFDEMRATWHSELRRVEEVLDARLKHLEER |
| ⦗Top⦘ |