| Basic Information | |
|---|---|
| Family ID | F094030 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 45 residues |
| Representative Sequence | VTAVFVTVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGRAMK |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 36.79 % |
| % of genes near scaffold ends (potentially truncated) | 97.17 % |
| % of genes from short scaffolds (< 2000 bps) | 95.28 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (58.491 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere (7.547 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.679 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.623 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.39% β-sheet: 0.00% Coil/Unstructured: 48.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF00293 | NUDIX | 56.60 |
| PF03167 | UDG | 28.30 |
| PF10027 | DUF2269 | 2.83 |
| PF02566 | OsmC | 0.94 |
| PF13176 | TPR_7 | 0.94 |
| PF09365 | DUF2461 | 0.94 |
| PF00266 | Aminotran_5 | 0.94 |
| PF02618 | YceG | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 28.30 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 28.30 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 28.30 |
| COG1559 | Endolytic transglycosylase MltG, terminates peptidoglycan polymerization | Cell wall/membrane/envelope biogenesis [M] | 0.94 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.94 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 58.49 % |
| Unclassified | root | N/A | 41.51 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908041|P3_CLC_ConsensusfromContig51491 | Not Available | 1227 | Open in IMG/M |
| 3300000956|JGI10216J12902_114495619 | Not Available | 1452 | Open in IMG/M |
| 3300001535|A3PFW1_10197525 | Not Available | 1117 | Open in IMG/M |
| 3300001538|A10PFW1_10271197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 942 | Open in IMG/M |
| 3300002568|C688J35102_118692641 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300002568|C688J35102_119859274 | Not Available | 795 | Open in IMG/M |
| 3300003324|soilH2_10042642 | Not Available | 1248 | Open in IMG/M |
| 3300005093|Ga0062594_101866224 | Not Available | 636 | Open in IMG/M |
| 3300005163|Ga0066823_10145097 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300005187|Ga0066675_10819287 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300005331|Ga0070670_102010582 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300005332|Ga0066388_103588309 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300005337|Ga0070682_101055643 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300005341|Ga0070691_11094396 | Not Available | 502 | Open in IMG/M |
| 3300005366|Ga0070659_101098402 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300005439|Ga0070711_101105823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 683 | Open in IMG/M |
| 3300005446|Ga0066686_10939959 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300005456|Ga0070678_100832870 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300005468|Ga0070707_102306024 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005526|Ga0073909_10486907 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300005529|Ga0070741_10914549 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300005535|Ga0070684_101559445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 623 | Open in IMG/M |
| 3300005539|Ga0068853_101499406 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300005563|Ga0068855_101706656 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300005602|Ga0070762_10574505 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300005713|Ga0066905_100268850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1321 | Open in IMG/M |
| 3300005764|Ga0066903_105671967 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300006055|Ga0097691_1074960 | Not Available | 1064 | Open in IMG/M |
| 3300006237|Ga0097621_100611290 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300006806|Ga0079220_11704879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 551 | Open in IMG/M |
| 3300006954|Ga0079219_11155143 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300009011|Ga0105251_10158007 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300009093|Ga0105240_11527033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 700 | Open in IMG/M |
| 3300009098|Ga0105245_10670965 | Not Available | 1068 | Open in IMG/M |
| 3300010039|Ga0126309_10375815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 844 | Open in IMG/M |
| 3300010048|Ga0126373_11073214 | Not Available | 871 | Open in IMG/M |
| 3300010361|Ga0126378_10904240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_68_14 | 989 | Open in IMG/M |
| 3300010362|Ga0126377_11026715 | Not Available | 891 | Open in IMG/M |
| 3300010366|Ga0126379_10293606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1627 | Open in IMG/M |
| 3300010379|Ga0136449_100782900 | Not Available | 1580 | Open in IMG/M |
| 3300010399|Ga0134127_13091128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 543 | Open in IMG/M |
| 3300012014|Ga0120159_1020522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2449 | Open in IMG/M |
| 3300012019|Ga0120139_1013337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1884 | Open in IMG/M |
| 3300012206|Ga0137380_11625098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 530 | Open in IMG/M |
| 3300012207|Ga0137381_11356310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 604 | Open in IMG/M |
| 3300012209|Ga0137379_11354962 | Not Available | 616 | Open in IMG/M |
| 3300012354|Ga0137366_10516421 | Not Available | 862 | Open in IMG/M |
| 3300012951|Ga0164300_10753842 | Not Available | 597 | Open in IMG/M |
| 3300012957|Ga0164303_10894843 | Not Available | 621 | Open in IMG/M |
| 3300012960|Ga0164301_11494687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 556 | Open in IMG/M |
| 3300012987|Ga0164307_10498007 | Not Available | 920 | Open in IMG/M |
| 3300012989|Ga0164305_11041380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae | 698 | Open in IMG/M |
| 3300013104|Ga0157370_10637753 | Not Available | 974 | Open in IMG/M |
| 3300013104|Ga0157370_10906840 | Not Available | 800 | Open in IMG/M |
| 3300013104|Ga0157370_12009912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 518 | Open in IMG/M |
| 3300013297|Ga0157378_10653526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1067 | Open in IMG/M |
| 3300013758|Ga0120147_1044511 | Not Available | 787 | Open in IMG/M |
| 3300014056|Ga0120125_1092677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 699 | Open in IMG/M |
| 3300015171|Ga0167648_1098336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 593 | Open in IMG/M |
| 3300015371|Ga0132258_12876446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1197 | Open in IMG/M |
| 3300017947|Ga0187785_10203662 | Not Available | 863 | Open in IMG/M |
| 3300020081|Ga0206354_11720753 | Not Available | 876 | Open in IMG/M |
| 3300021363|Ga0193699_10185241 | Not Available | 862 | Open in IMG/M |
| 3300021384|Ga0213876_10584682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 594 | Open in IMG/M |
| 3300021432|Ga0210384_11281843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 637 | Open in IMG/M |
| 3300021560|Ga0126371_13755762 | Not Available | 512 | Open in IMG/M |
| 3300024288|Ga0179589_10562892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 532 | Open in IMG/M |
| 3300025898|Ga0207692_10169493 | Not Available | 1264 | Open in IMG/M |
| 3300025913|Ga0207695_10236972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1727 | Open in IMG/M |
| 3300025914|Ga0207671_11231664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 585 | Open in IMG/M |
| 3300025915|Ga0207693_10658626 | Not Available | 813 | Open in IMG/M |
| 3300025917|Ga0207660_10431541 | Not Available | 1064 | Open in IMG/M |
| 3300025928|Ga0207700_11008733 | Not Available | 745 | Open in IMG/M |
| 3300025932|Ga0207690_10610991 | Not Available | 891 | Open in IMG/M |
| 3300025939|Ga0207665_10067911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2428 | Open in IMG/M |
| 3300025949|Ga0207667_11342877 | Not Available | 690 | Open in IMG/M |
| 3300025981|Ga0207640_10873942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 784 | Open in IMG/M |
| 3300026023|Ga0207677_10953313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 776 | Open in IMG/M |
| 3300026041|Ga0207639_10084762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2518 | Open in IMG/M |
| 3300026041|Ga0207639_11270985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 691 | Open in IMG/M |
| 3300026067|Ga0207678_11892577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 521 | Open in IMG/M |
| 3300026078|Ga0207702_10936769 | Not Available | 859 | Open in IMG/M |
| 3300026142|Ga0207698_10166080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1937 | Open in IMG/M |
| 3300026550|Ga0209474_10689368 | Not Available | 528 | Open in IMG/M |
| 3300028889|Ga0247827_10777844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 632 | Open in IMG/M |
| 3300031251|Ga0265327_10109296 | Not Available | 1323 | Open in IMG/M |
| 3300031672|Ga0307373_10511429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 647 | Open in IMG/M |
| 3300031723|Ga0318493_10233868 | Not Available | 978 | Open in IMG/M |
| 3300031740|Ga0307468_102247687 | Not Available | 529 | Open in IMG/M |
| 3300031747|Ga0318502_10844875 | Not Available | 556 | Open in IMG/M |
| 3300031819|Ga0318568_10513248 | Not Available | 747 | Open in IMG/M |
| 3300031879|Ga0306919_10978606 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300031896|Ga0318551_10112727 | Not Available | 1458 | Open in IMG/M |
| 3300031996|Ga0308176_10596524 | Not Available | 1134 | Open in IMG/M |
| 3300031996|Ga0308176_11578505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 699 | Open in IMG/M |
| 3300031996|Ga0308176_11826155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 649 | Open in IMG/M |
| 3300031996|Ga0308176_12347422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 569 | Open in IMG/M |
| 3300032074|Ga0308173_10862394 | Not Available | 836 | Open in IMG/M |
| 3300032828|Ga0335080_10298451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1750 | Open in IMG/M |
| 3300032895|Ga0335074_11585871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
| 3300032897|Ga0335071_10024595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6018 | Open in IMG/M |
| 3300032897|Ga0335071_10988997 | Not Available | 788 | Open in IMG/M |
| 3300032954|Ga0335083_10825746 | Not Available | 742 | Open in IMG/M |
| 3300032954|Ga0335083_11229745 | Not Available | 579 | Open in IMG/M |
| 3300033513|Ga0316628_104256605 | Not Available | 509 | Open in IMG/M |
| 3300034195|Ga0370501_0018480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2010 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 7.55% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.66% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 5.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.66% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.83% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.83% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.94% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.94% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.94% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.94% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.94% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.94% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.94% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.94% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.94% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908041 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
| 3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013758 | Permafrost microbial communities from Nunavut, Canada - A24_65cm_12M | Environmental | Open in IMG/M |
| 3300014056 | Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M | Environmental | Open in IMG/M |
| 3300015171 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3a, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Host-Associated | Open in IMG/M |
| 3300031672 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-2 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| P3_CLC_01253100 | 2124908041 | Soil | MESVLVAVHLLAATVWVGGSTALIFVGVPAIRTLEGDPRGRAGIAVLDQRSE |
| JGI10216J12902_1144956191 | 3300000956 | Soil | MEGVLVAIHLLAASVWVGGSAALIFVGVPALRTLEGESRGRVMRELGLRW |
| A3PFW1_101975251 | 3300001535 | Permafrost | VIAVLVAVHLIAAGIWFGGSTALIFVGVPAIRILDGEPRGRAMKELG |
| A10PFW1_102711973 | 3300001538 | Permafrost | VTAVLVTVHLLAAGIWFGGSTALVFVGVPAIRTLDGEPRGRAMKELGLRWRPIGYG |
| C688J35102_1186926412 | 3300002568 | Soil | VTGVLVAVHLLAAGIWFGGSTALVFVGVPAIRTVEGEQRGRAM |
| C688J35102_1198592741 | 3300002568 | Soil | VTALFVTVHLLAAGIWFGGSTALVFVGVPAIRTLDGEPRSRAM |
| soilH2_100426422 | 3300003324 | Sugarcane Root And Bulk Soil | VTAFFVTVHLLAAGVWFGGSTALVFVGVPAIRTLDGEPRGRAM |
| Ga0062594_1018662242 | 3300005093 | Soil | VLDVLVAVHLLAATVWVGGSTALIFVGVPAIRILEGEPRGRAMKELGLRWRPL |
| Ga0066823_101450971 | 3300005163 | Soil | VVVHLLAASVWVGGSTALIFVGVPAIRSLEGESRGRAMKELGLRWRPL |
| Ga0066675_108192871 | 3300005187 | Soil | VLDILVAVHLLAAAVWVGGSTALIFVGVPAIRTLEGEPRGRAMKALGLRW |
| Ga0070670_1020105822 | 3300005331 | Switchgrass Rhizosphere | VTAVLVVVHLLAATVWVGGSTALIFVGVPAIRTLEGEPRGRAMKELGL |
| Ga0066388_1035883092 | 3300005332 | Tropical Forest Soil | VHEVFVIVHLLAAMVWVGGSIALVFAGVPAIRVLEGEPRGKAMRE |
| Ga0070682_1010556431 | 3300005337 | Corn Rhizosphere | VTAVFVTVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGRAMRELGLRWRPIGYGAL |
| Ga0070691_110943961 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | VTAVFVTVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGRAM |
| Ga0070659_1010984022 | 3300005366 | Corn Rhizosphere | VTAVFVTVHLLAAGVWFGGSTALVFVGVPAIRTLDGEPRGRAMKELGLRWRPI |
| Ga0070711_1011058232 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VTAVLVTVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRG |
| Ga0066686_109399592 | 3300005446 | Soil | VTAVLVTVHLLAAGIWFGGSTALVFVGVPAIRTLDGEPRGRAMKALGLRW |
| Ga0070678_1008328701 | 3300005456 | Miscanthus Rhizosphere | VLDVLVAVHLLAATVWVGGSTALIFVGVPAIRILEGEPRG |
| Ga0070707_1023060242 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VTAVLVAIHLIAAGIWFGGSTALIFVGVPAIRILEGEPRGRAMKELGLRWR |
| Ga0073909_104869071 | 3300005526 | Surface Soil | VTAVLVVVHLLAATVWVGGSTALIFVGVPAIRTLEGEPRGRAMKELG |
| Ga0070741_109145492 | 3300005529 | Surface Soil | MIAVLVTVHLLAAGIWFGGSTALVFVGVPAIRQLDGEPRGRAMRELGLRW |
| Ga0070684_1015594451 | 3300005535 | Corn Rhizosphere | VTAVFVTVHLLAAGVWFGGSTALVFVGVPAIRTLEGEPRG |
| Ga0068853_1014994061 | 3300005539 | Corn Rhizosphere | VTAVFVTVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGRAMKELGLRWRPI |
| Ga0068855_1017066562 | 3300005563 | Corn Rhizosphere | VEEAVVIVHLLAASVWLGGSVALVFAGVPAIRVLEGDPRGRAMKELGLRW |
| Ga0070762_105745052 | 3300005602 | Soil | VIVHLLAACIWVGGSIALVFAGVPAIRVLEGEPRGRAMREL |
| Ga0066905_1002688501 | 3300005713 | Tropical Forest Soil | VLDVLVTVHLLAAAVWVGGSTALIFVGVPAIRTLEGEPRGRA |
| Ga0066903_1056719671 | 3300005764 | Tropical Forest Soil | VEEFIVIVHLLAAIVWVGGSIALVFVGVPAIRVLEGAPRGRAMHE |
| Ga0097691_10749602 | 3300006055 | Arctic Peat Soil | VIAVLVAVHLIAAGIWFGGSTALIFVGVPAIRILDGEPRGRAMKELGL |
| Ga0097621_1006112901 | 3300006237 | Miscanthus Rhizosphere | VLDVLVAVHLLAATVWVGGSTALIFVGVPAIRILEGEPRGRAMKELGLRWR |
| Ga0079220_117048792 | 3300006806 | Agricultural Soil | VTAVFVTVHLLAAGIWFGGSTALVFVGVPAIRTLDREPRGRAMK |
| Ga0079219_111551431 | 3300006954 | Agricultural Soil | VTAVFVTVHLLAAGIWFGGSTALVFVGVPAIRTLDGEPRGRAMKELGLRWRPI |
| Ga0105251_101580071 | 3300009011 | Switchgrass Rhizosphere | VEEVVVIVHLLAATIWVGGSIALVFAGVPAIRVLE |
| Ga0105240_115270331 | 3300009093 | Corn Rhizosphere | VTAVLVAIHLIAAGIWFGGSTALIFVGVPAIRILEGEPRG |
| Ga0105245_106709651 | 3300009098 | Miscanthus Rhizosphere | VTAVLVVVHLLAATVWVGGSTALIFVGVPAIRTLEGEPRGRAMKELGLRWRPL |
| Ga0126309_103758153 | 3300010039 | Serpentine Soil | MQGVLVAVHLLAAAVWVGGSVALVFVGVPAIRTLDGDPRGRA |
| Ga0126373_110732141 | 3300010048 | Tropical Forest Soil | VEGVLVAVHLLAAAVWVGGSTALIFVGVPAVRGLDEPARGRAMRELG |
| Ga0126378_109042403 | 3300010361 | Tropical Forest Soil | VEGVLVAVHLLAAAVWVGGSTALIFVGVPAVRGLDEPARGRAMRELGLRWRPL |
| Ga0126377_110267152 | 3300010362 | Tropical Forest Soil | VHDVIVIVHLFAAIVWVGGSIALVFAGVPAIRVLEGEPR |
| Ga0126379_102936064 | 3300010366 | Tropical Forest Soil | VITFLRAVHLISAAVWIGGSVALVVAGVPAIRTLEG |
| Ga0136449_1007829003 | 3300010379 | Peatlands Soil | VENVVVIVHLLAASVWVGGSVALVFAGVPAIRVLEGEPRGR |
| Ga0134127_130911281 | 3300010399 | Terrestrial Soil | VTAVFVIVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGRAMKELGL |
| Ga0120159_10205225 | 3300012014 | Permafrost | VTAVLVTVHLLAAGIWFGGSTALVFVGVPAIRTLDGEPRG |
| Ga0120139_10133374 | 3300012019 | Permafrost | VTAVLVVVHLLAATVWVGGSTALIFVGVPAIRTLDGEPRGRAMKELG |
| Ga0137380_116250982 | 3300012206 | Vadose Zone Soil | MEVVVVIHLLAACIWVGGSIALVVAGVPAIRILDGEPRQRAMR |
| Ga0137381_113563102 | 3300012207 | Vadose Zone Soil | VTAVLVAVHLIAAGIWFGGSTALVFVGVPAIRTLRVHSC* |
| Ga0137379_113549621 | 3300012209 | Vadose Zone Soil | MEVVVVIHLLAACIWVGGSIALVVAGVPAIRILDGEPRQRAM |
| Ga0137366_105164211 | 3300012354 | Vadose Zone Soil | VTGVLVAVHLIAAGVWFGGSTALVFVGVPAIRTLEGEPRGRAMRE |
| Ga0164300_107538421 | 3300012951 | Soil | VVGVLVAVHLLAAAVWVGGSTALIFVGVPAIRVLEGEPRGRAMKELG |
| Ga0164303_108948432 | 3300012957 | Soil | VEGVLVVVHLLAASVWVGGSTALVFAGVPAIRTLEGEP |
| Ga0164301_114946871 | 3300012960 | Soil | VTAVLVVVHLLAATVWVGGSTALIFVGVPAIRALE |
| Ga0164307_104980071 | 3300012987 | Soil | VTSVLVAVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGRAMRELGLRW |
| Ga0164305_110413802 | 3300012989 | Soil | VTAVLVTVHLLAAGIWFGGSTALVFVGVPAIRTLDGEPRSRVMKE |
| Ga0157370_106377531 | 3300013104 | Corn Rhizosphere | VTAVFVTVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGRA |
| Ga0157370_109068401 | 3300013104 | Corn Rhizosphere | VTAVFVTVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGRAMKELGLRWRP |
| Ga0157370_120099121 | 3300013104 | Corn Rhizosphere | VTSVIVTVHLLAAGVWFGGSTALVFVGVPAIRTLEGEPRGRAM |
| Ga0157378_106535261 | 3300013297 | Miscanthus Rhizosphere | VTAVLVTIHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGRAMKELGLRWRPVGYGALL |
| Ga0120147_10445112 | 3300013758 | Permafrost | VTPVLVVVHLLAATVWVGGSTALIFVGVPAIRTLD |
| Ga0120125_10926771 | 3300014056 | Permafrost | VTAVLVTVHLLAAGIWFGGSTALVFVGVPAIRTLEVEPRSRATKELG |
| Ga0167648_10983362 | 3300015171 | Glacier Forefield Soil | VTAVLVTVHLIAAGIWFGGSTALIFVGVPAIRVLDG |
| Ga0132258_128764461 | 3300015371 | Arabidopsis Rhizosphere | VHEIFVIVHLLAAMVWVGGSIALVFAGVPAIRVLEGEPRGKAMKE |
| Ga0187785_102036621 | 3300017947 | Tropical Peatland | VTAVLVAVHLIAAGIWFGGSTALVFVGVPAIRTLEGAPRARVMRELGLRWRPIGYGSLLV |
| Ga0206354_117207531 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | VTAVFVTVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGRAMK |
| Ga0193699_101852412 | 3300021363 | Soil | VTAVLVVVHLLAATVWVGGSTALIFVGVPAIRTLEGEPRG |
| Ga0213876_105846822 | 3300021384 | Plant Roots | VTGSLVAVHLVAAGIWFGGSTALVFVGVPAIRTLDG |
| Ga0210384_112818432 | 3300021432 | Soil | MEEVIVIIHLLAASVWLGGSIALVFAGVPAIRVLEGEARGRAMKELGLRWRPVGYGSLV |
| Ga0126371_137557621 | 3300021560 | Tropical Forest Soil | VIGVLVTVHLLAAAVWVGGSTALIFVGVPVLRKLEGPERGRAMRELG |
| Ga0179589_105628921 | 3300024288 | Vadose Zone Soil | VIGVLVTVHLLAAAVWFGGSTALIFVGVPAIRILDGEPRGQAMKELGLRW |
| Ga0207692_101694932 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VTAVLVTVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGRAMKAL |
| Ga0207695_102369721 | 3300025913 | Corn Rhizosphere | VTAVFVTVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGRAMKELGLRWRPIGYGAL |
| Ga0207671_112316642 | 3300025914 | Corn Rhizosphere | VTAVFVTVHLLAAGIWFGGSTALVFVGVPAVRTLEGEPRGRA |
| Ga0207693_106586262 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VTAVLVTVHLLAAGIWFGGSTALVFVGVPAIRQLEGDARGRAMKQLGFLW |
| Ga0207660_104315412 | 3300025917 | Corn Rhizosphere | VTAVFVTVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGRAMKELGLRWRPIGY |
| Ga0207700_110087331 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VIALLVTIHLLAAAVWVGGSTALIFVGVPAVRVLEGEPRSRAMKEL |
| Ga0207690_106109911 | 3300025932 | Corn Rhizosphere | VTAVFVTVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGRAMKELGLRWRPIGYGALLV |
| Ga0207665_100679116 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VTAVLVTIHLVAAGIWFGGSTALVFVGVPAIRTLEGEPR |
| Ga0207667_113428771 | 3300025949 | Corn Rhizosphere | VEEAVVIVHLLAASVWLGGSVALVFAGVPAIRVLEGDPRGRAMKELGLRWR |
| Ga0207640_108739422 | 3300025981 | Corn Rhizosphere | VTAVFVTVHLLAAGIWFGGSTALVFVGVPAIRTLEG |
| Ga0207677_109533132 | 3300026023 | Miscanthus Rhizosphere | VVVHLLAAAVWVGGSTALVFVGVPAIRTLEGEPRGRAMKELGLRWRPL |
| Ga0207639_100847625 | 3300026041 | Corn Rhizosphere | VTAVFVTVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRVRAMKELGLRWRPIGYGALLV |
| Ga0207639_112709851 | 3300026041 | Corn Rhizosphere | VTAVLVTVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGHAMKQLGLLWRP |
| Ga0207678_118925771 | 3300026067 | Corn Rhizosphere | MALLVTVHLLAAGVWFGGSTALVFVGVPAIRTLDGEP |
| Ga0207702_109367693 | 3300026078 | Corn Rhizosphere | VTAVLVAVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGTAMKKLGLLWRPLGYGALL |
| Ga0207698_101660801 | 3300026142 | Corn Rhizosphere | VTAIFVTVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGRAMR |
| Ga0209474_106893682 | 3300026550 | Soil | VEEVVVIIHLLAAMVWVGGSVALVFAGVPAIRVLEG |
| Ga0247827_107778441 | 3300028889 | Soil | VADVLRIVHLLAAGVWLGGTVALVFAGVPAIRTLEGEARGRT |
| Ga0265327_101092963 | 3300031251 | Rhizosphere | VTAVLVTVHLLAAGIWFGGSTALVFVGVPAIRSLDGEPR |
| Ga0307373_105114291 | 3300031672 | Soil | VIIHLLAASVWLGGSIALVFAGVPAIRVLEGDPRGRAMKELGLRWRPIG |
| Ga0318493_102338681 | 3300031723 | Soil | VIIHLLAAMIWVGGSVALVFVGVPAIRILEGEPRGRAMRELG |
| Ga0307468_1022476872 | 3300031740 | Hardwood Forest Soil | VHEVFVIVHLLAAMVWVGGSVALVFAGVPAIRVLEGEPRG |
| Ga0318502_108448752 | 3300031747 | Soil | VIVHLLAATVWVGGSVALVFAGVPAIRVLEGEHRGRAMRELG |
| Ga0318568_105132482 | 3300031819 | Soil | VIIHLLAAMIWVGGSVALVFVGVPAIRILEGEPRGRAM |
| Ga0306919_109786062 | 3300031879 | Soil | VTAVLVTIHLLAAAVWVGGSTALIFVGVPAVRSLEGEPRSRA |
| Ga0318551_101127273 | 3300031896 | Soil | VVGVLVAVHLLAAAVWVGGSTALIFVGVPVIRTLDGPERG |
| Ga0308176_105965241 | 3300031996 | Soil | VTAVFVTVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGRAMKELGL |
| Ga0308176_115785052 | 3300031996 | Soil | VTAIFVTVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGRAMRELGLRWRPIGYG |
| Ga0308176_118261552 | 3300031996 | Soil | VTGVLVAVHLVAAGIWFGGSTALVFVGVPAIRTLEAD |
| Ga0308176_123474222 | 3300031996 | Soil | VTALFVTVHLLAAGIWFGGSTALVFVGVPAIRTLDG |
| Ga0308173_108623943 | 3300032074 | Soil | VTAVFVTVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGRAMKELGLRWRPIG |
| Ga0335080_102984511 | 3300032828 | Soil | VTAFLVVVHLLSAGIWFGGSTALVFVGVPAVRTLE |
| Ga0335074_115858712 | 3300032895 | Soil | VTAVLVGIHLLAAGVWFGGSTALVFVGVPAVRTLE |
| Ga0335071_100245958 | 3300032897 | Soil | VTAFLVVVHLLSAGIWFGGSTALVFVGVPVVRTLEGEARGRAMK |
| Ga0335071_109889972 | 3300032897 | Soil | VTAFLVVVHLLSAGIWFGGSTALVFVGVPAIRTLDGEPRGRAMKV |
| Ga0335083_108257461 | 3300032954 | Soil | LEVVVIIHLLAAMVWVGGSVALVFVGVPAIRVLEGEP |
| Ga0335083_112297451 | 3300032954 | Soil | VTAVLVTVHLLAAGIWFGGSTALVFVGVPAIRQLE |
| Ga0316628_1042566052 | 3300033513 | Soil | VTVVLVTVHLLAAGIWFGGSTALVFVGVPAIRTLDGEPRGRAMRALGLRWRPIGYGALVVAA |
| Ga0370501_0018480_1853_2008 | 3300034195 | Untreated Peat Soil | VTAVLVTAHLLAAGIWFGGSTALVFVGVPAIRELDGESRGRAMKALGLRWRP |
| ⦗Top⦘ |