NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F094030

Metagenome / Metatranscriptome Family F094030

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F094030
Family Type Metagenome / Metatranscriptome
Number of Sequences 106
Average Sequence Length 45 residues
Representative Sequence VTAVFVTVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGRAMK
Number of Associated Samples 97
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 36.79 %
% of genes near scaffold ends (potentially truncated) 97.17 %
% of genes from short scaffolds (< 2000 bps) 95.28 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction Yes
3D model pTM-score0.57

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (58.491 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere
(7.547 % of family members)
Environment Ontology (ENVO) Unclassified
(38.679 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(39.623 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 51.39%    β-sheet: 0.00%    Coil/Unstructured: 48.61%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.57
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF00293NUDIX 56.60
PF03167UDG 28.30
PF10027DUF2269 2.83
PF02566OsmC 0.94
PF13176TPR_7 0.94
PF09365DUF2461 0.94
PF00266Aminotran_5 0.94
PF02618YceG 0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG0692Uracil-DNA glycosylaseReplication, recombination and repair [L] 28.30
COG1573Uracil-DNA glycosylaseReplication, recombination and repair [L] 28.30
COG3663G:T/U-mismatch repair DNA glycosylaseReplication, recombination and repair [L] 28.30
COG1559Endolytic transglycosylase MltG, terminates peptidoglycan polymerizationCell wall/membrane/envelope biogenesis [M] 0.94
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 0.94
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 0.94


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms58.49 %
UnclassifiedrootN/A41.51 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908041|P3_CLC_ConsensusfromContig51491Not Available1227Open in IMG/M
3300000956|JGI10216J12902_114495619Not Available1452Open in IMG/M
3300001535|A3PFW1_10197525Not Available1117Open in IMG/M
3300001538|A10PFW1_10271197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales942Open in IMG/M
3300002568|C688J35102_118692641All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300002568|C688J35102_119859274Not Available795Open in IMG/M
3300003324|soilH2_10042642Not Available1248Open in IMG/M
3300005093|Ga0062594_101866224Not Available636Open in IMG/M
3300005163|Ga0066823_10145097All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300005187|Ga0066675_10819287All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300005331|Ga0070670_102010582All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300005332|Ga0066388_103588309All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300005337|Ga0070682_101055643All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300005341|Ga0070691_11094396Not Available502Open in IMG/M
3300005366|Ga0070659_101098402All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300005439|Ga0070711_101105823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium683Open in IMG/M
3300005446|Ga0066686_10939959All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300005456|Ga0070678_100832870All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300005468|Ga0070707_102306024All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300005526|Ga0073909_10486907All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300005529|Ga0070741_10914549All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300005535|Ga0070684_101559445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium623Open in IMG/M
3300005539|Ga0068853_101499406All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300005563|Ga0068855_101706656All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300005602|Ga0070762_10574505All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300005713|Ga0066905_100268850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1321Open in IMG/M
3300005764|Ga0066903_105671967All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300006055|Ga0097691_1074960Not Available1064Open in IMG/M
3300006237|Ga0097621_100611290All Organisms → cellular organisms → Bacteria997Open in IMG/M
3300006806|Ga0079220_11704879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium551Open in IMG/M
3300006954|Ga0079219_11155143All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300009011|Ga0105251_10158007All Organisms → cellular organisms → Bacteria1022Open in IMG/M
3300009093|Ga0105240_11527033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium700Open in IMG/M
3300009098|Ga0105245_10670965Not Available1068Open in IMG/M
3300010039|Ga0126309_10375815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium844Open in IMG/M
3300010048|Ga0126373_11073214Not Available871Open in IMG/M
3300010361|Ga0126378_10904240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_68_14989Open in IMG/M
3300010362|Ga0126377_11026715Not Available891Open in IMG/M
3300010366|Ga0126379_10293606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1627Open in IMG/M
3300010379|Ga0136449_100782900Not Available1580Open in IMG/M
3300010399|Ga0134127_13091128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium543Open in IMG/M
3300012014|Ga0120159_1020522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2449Open in IMG/M
3300012019|Ga0120139_1013337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1884Open in IMG/M
3300012206|Ga0137380_11625098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium530Open in IMG/M
3300012207|Ga0137381_11356310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium604Open in IMG/M
3300012209|Ga0137379_11354962Not Available616Open in IMG/M
3300012354|Ga0137366_10516421Not Available862Open in IMG/M
3300012951|Ga0164300_10753842Not Available597Open in IMG/M
3300012957|Ga0164303_10894843Not Available621Open in IMG/M
3300012960|Ga0164301_11494687All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium556Open in IMG/M
3300012987|Ga0164307_10498007Not Available920Open in IMG/M
3300012989|Ga0164305_11041380All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae698Open in IMG/M
3300013104|Ga0157370_10637753Not Available974Open in IMG/M
3300013104|Ga0157370_10906840Not Available800Open in IMG/M
3300013104|Ga0157370_12009912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium518Open in IMG/M
3300013297|Ga0157378_10653526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1067Open in IMG/M
3300013758|Ga0120147_1044511Not Available787Open in IMG/M
3300014056|Ga0120125_1092677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium699Open in IMG/M
3300015171|Ga0167648_1098336All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium593Open in IMG/M
3300015371|Ga0132258_12876446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1197Open in IMG/M
3300017947|Ga0187785_10203662Not Available863Open in IMG/M
3300020081|Ga0206354_11720753Not Available876Open in IMG/M
3300021363|Ga0193699_10185241Not Available862Open in IMG/M
3300021384|Ga0213876_10584682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium594Open in IMG/M
3300021432|Ga0210384_11281843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium637Open in IMG/M
3300021560|Ga0126371_13755762Not Available512Open in IMG/M
3300024288|Ga0179589_10562892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium532Open in IMG/M
3300025898|Ga0207692_10169493Not Available1264Open in IMG/M
3300025913|Ga0207695_10236972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1727Open in IMG/M
3300025914|Ga0207671_11231664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium585Open in IMG/M
3300025915|Ga0207693_10658626Not Available813Open in IMG/M
3300025917|Ga0207660_10431541Not Available1064Open in IMG/M
3300025928|Ga0207700_11008733Not Available745Open in IMG/M
3300025932|Ga0207690_10610991Not Available891Open in IMG/M
3300025939|Ga0207665_10067911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2428Open in IMG/M
3300025949|Ga0207667_11342877Not Available690Open in IMG/M
3300025981|Ga0207640_10873942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium784Open in IMG/M
3300026023|Ga0207677_10953313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium776Open in IMG/M
3300026041|Ga0207639_10084762All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2518Open in IMG/M
3300026041|Ga0207639_11270985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium691Open in IMG/M
3300026067|Ga0207678_11892577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium521Open in IMG/M
3300026078|Ga0207702_10936769Not Available859Open in IMG/M
3300026142|Ga0207698_10166080All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1937Open in IMG/M
3300026550|Ga0209474_10689368Not Available528Open in IMG/M
3300028889|Ga0247827_10777844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium632Open in IMG/M
3300031251|Ga0265327_10109296Not Available1323Open in IMG/M
3300031672|Ga0307373_10511429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium647Open in IMG/M
3300031723|Ga0318493_10233868Not Available978Open in IMG/M
3300031740|Ga0307468_102247687Not Available529Open in IMG/M
3300031747|Ga0318502_10844875Not Available556Open in IMG/M
3300031819|Ga0318568_10513248Not Available747Open in IMG/M
3300031879|Ga0306919_10978606All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300031896|Ga0318551_10112727Not Available1458Open in IMG/M
3300031996|Ga0308176_10596524Not Available1134Open in IMG/M
3300031996|Ga0308176_11578505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium699Open in IMG/M
3300031996|Ga0308176_11826155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium649Open in IMG/M
3300031996|Ga0308176_12347422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium569Open in IMG/M
3300032074|Ga0308173_10862394Not Available836Open in IMG/M
3300032828|Ga0335080_10298451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1750Open in IMG/M
3300032895|Ga0335074_11585871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium513Open in IMG/M
3300032897|Ga0335071_10024595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia6018Open in IMG/M
3300032897|Ga0335071_10988997Not Available788Open in IMG/M
3300032954|Ga0335083_10825746Not Available742Open in IMG/M
3300032954|Ga0335083_11229745Not Available579Open in IMG/M
3300033513|Ga0316628_104256605Not Available509Open in IMG/M
3300034195|Ga0370501_0018480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2010Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere7.55%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil6.60%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.66%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost5.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.66%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.72%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.77%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.83%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.83%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.89%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.94%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.94%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.94%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.94%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.94%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.94%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.94%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.94%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.94%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.94%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.94%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.94%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.94%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908041Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3EnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001535Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001538Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005163Soil and rhizosphere microbial communities from Laval, Canada - mgHMBEnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006055Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300012014Permafrost microbial communities from Nunavut, Canada - A10_80cm_6MEnvironmentalOpen in IMG/M
3300012019Permafrost microbial communities from Nunavut, Canada - A7_5cm_12MEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013758Permafrost microbial communities from Nunavut, Canada - A24_65cm_12MEnvironmentalOpen in IMG/M
3300014056Permafrost microbial communities from Nunavut, Canada - A20_5cm_0MEnvironmentalOpen in IMG/M
3300015171Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3a, vegetated patch on medial moraine)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300031251Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaGHost-AssociatedOpen in IMG/M
3300031672Soil microbial communities from Risofladan, Vaasa, Finland - OX-2EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300034195Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
P3_CLC_012531002124908041SoilMESVLVAVHLLAATVWVGGSTALIFVGVPAIRTLEGDPRGRAGIAVLDQRSE
JGI10216J12902_11449561913300000956SoilMEGVLVAIHLLAASVWVGGSAALIFVGVPALRTLEGESRGRVMRELGLRW
A3PFW1_1019752513300001535PermafrostVIAVLVAVHLIAAGIWFGGSTALIFVGVPAIRILDGEPRGRAMKELG
A10PFW1_1027119733300001538PermafrostVTAVLVTVHLLAAGIWFGGSTALVFVGVPAIRTLDGEPRGRAMKELGLRWRPIGYG
C688J35102_11869264123300002568SoilVTGVLVAVHLLAAGIWFGGSTALVFVGVPAIRTVEGEQRGRAM
C688J35102_11985927413300002568SoilVTALFVTVHLLAAGIWFGGSTALVFVGVPAIRTLDGEPRSRAM
soilH2_1004264223300003324Sugarcane Root And Bulk SoilVTAFFVTVHLLAAGVWFGGSTALVFVGVPAIRTLDGEPRGRAM
Ga0062594_10186622423300005093SoilVLDVLVAVHLLAATVWVGGSTALIFVGVPAIRILEGEPRGRAMKELGLRWRPL
Ga0066823_1014509713300005163SoilVVVHLLAASVWVGGSTALIFVGVPAIRSLEGESRGRAMKELGLRWRPL
Ga0066675_1081928713300005187SoilVLDILVAVHLLAAAVWVGGSTALIFVGVPAIRTLEGEPRGRAMKALGLRW
Ga0070670_10201058223300005331Switchgrass RhizosphereVTAVLVVVHLLAATVWVGGSTALIFVGVPAIRTLEGEPRGRAMKELGL
Ga0066388_10358830923300005332Tropical Forest SoilVHEVFVIVHLLAAMVWVGGSIALVFAGVPAIRVLEGEPRGKAMRE
Ga0070682_10105564313300005337Corn RhizosphereVTAVFVTVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGRAMRELGLRWRPIGYGAL
Ga0070691_1109439613300005341Corn, Switchgrass And Miscanthus RhizosphereVTAVFVTVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGRAM
Ga0070659_10109840223300005366Corn RhizosphereVTAVFVTVHLLAAGVWFGGSTALVFVGVPAIRTLDGEPRGRAMKELGLRWRPI
Ga0070711_10110582323300005439Corn, Switchgrass And Miscanthus RhizosphereVTAVLVTVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRG
Ga0066686_1093995923300005446SoilVTAVLVTVHLLAAGIWFGGSTALVFVGVPAIRTLDGEPRGRAMKALGLRW
Ga0070678_10083287013300005456Miscanthus RhizosphereVLDVLVAVHLLAATVWVGGSTALIFVGVPAIRILEGEPRG
Ga0070707_10230602423300005468Corn, Switchgrass And Miscanthus RhizosphereVTAVLVAIHLIAAGIWFGGSTALIFVGVPAIRILEGEPRGRAMKELGLRWR
Ga0073909_1048690713300005526Surface SoilVTAVLVVVHLLAATVWVGGSTALIFVGVPAIRTLEGEPRGRAMKELG
Ga0070741_1091454923300005529Surface SoilMIAVLVTVHLLAAGIWFGGSTALVFVGVPAIRQLDGEPRGRAMRELGLRW
Ga0070684_10155944513300005535Corn RhizosphereVTAVFVTVHLLAAGVWFGGSTALVFVGVPAIRTLEGEPRG
Ga0068853_10149940613300005539Corn RhizosphereVTAVFVTVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGRAMKELGLRWRPI
Ga0068855_10170665623300005563Corn RhizosphereVEEAVVIVHLLAASVWLGGSVALVFAGVPAIRVLEGDPRGRAMKELGLRW
Ga0070762_1057450523300005602SoilVIVHLLAACIWVGGSIALVFAGVPAIRVLEGEPRGRAMREL
Ga0066905_10026885013300005713Tropical Forest SoilVLDVLVTVHLLAAAVWVGGSTALIFVGVPAIRTLEGEPRGRA
Ga0066903_10567196713300005764Tropical Forest SoilVEEFIVIVHLLAAIVWVGGSIALVFVGVPAIRVLEGAPRGRAMHE
Ga0097691_107496023300006055Arctic Peat SoilVIAVLVAVHLIAAGIWFGGSTALIFVGVPAIRILDGEPRGRAMKELGL
Ga0097621_10061129013300006237Miscanthus RhizosphereVLDVLVAVHLLAATVWVGGSTALIFVGVPAIRILEGEPRGRAMKELGLRWR
Ga0079220_1170487923300006806Agricultural SoilVTAVFVTVHLLAAGIWFGGSTALVFVGVPAIRTLDREPRGRAMK
Ga0079219_1115514313300006954Agricultural SoilVTAVFVTVHLLAAGIWFGGSTALVFVGVPAIRTLDGEPRGRAMKELGLRWRPI
Ga0105251_1015800713300009011Switchgrass RhizosphereVEEVVVIVHLLAATIWVGGSIALVFAGVPAIRVLE
Ga0105240_1152703313300009093Corn RhizosphereVTAVLVAIHLIAAGIWFGGSTALIFVGVPAIRILEGEPRG
Ga0105245_1067096513300009098Miscanthus RhizosphereVTAVLVVVHLLAATVWVGGSTALIFVGVPAIRTLEGEPRGRAMKELGLRWRPL
Ga0126309_1037581533300010039Serpentine SoilMQGVLVAVHLLAAAVWVGGSVALVFVGVPAIRTLDGDPRGRA
Ga0126373_1107321413300010048Tropical Forest SoilVEGVLVAVHLLAAAVWVGGSTALIFVGVPAVRGLDEPARGRAMRELG
Ga0126378_1090424033300010361Tropical Forest SoilVEGVLVAVHLLAAAVWVGGSTALIFVGVPAVRGLDEPARGRAMRELGLRWRPL
Ga0126377_1102671523300010362Tropical Forest SoilVHDVIVIVHLFAAIVWVGGSIALVFAGVPAIRVLEGEPR
Ga0126379_1029360643300010366Tropical Forest SoilVITFLRAVHLISAAVWIGGSVALVVAGVPAIRTLEG
Ga0136449_10078290033300010379Peatlands SoilVENVVVIVHLLAASVWVGGSVALVFAGVPAIRVLEGEPRGR
Ga0134127_1309112813300010399Terrestrial SoilVTAVFVIVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGRAMKELGL
Ga0120159_102052253300012014PermafrostVTAVLVTVHLLAAGIWFGGSTALVFVGVPAIRTLDGEPRG
Ga0120139_101333743300012019PermafrostVTAVLVVVHLLAATVWVGGSTALIFVGVPAIRTLDGEPRGRAMKELG
Ga0137380_1162509823300012206Vadose Zone SoilMEVVVVIHLLAACIWVGGSIALVVAGVPAIRILDGEPRQRAMR
Ga0137381_1135631023300012207Vadose Zone SoilVTAVLVAVHLIAAGIWFGGSTALVFVGVPAIRTLRVHSC*
Ga0137379_1135496213300012209Vadose Zone SoilMEVVVVIHLLAACIWVGGSIALVVAGVPAIRILDGEPRQRAM
Ga0137366_1051642113300012354Vadose Zone SoilVTGVLVAVHLIAAGVWFGGSTALVFVGVPAIRTLEGEPRGRAMRE
Ga0164300_1075384213300012951SoilVVGVLVAVHLLAAAVWVGGSTALIFVGVPAIRVLEGEPRGRAMKELG
Ga0164303_1089484323300012957SoilVEGVLVVVHLLAASVWVGGSTALVFAGVPAIRTLEGEP
Ga0164301_1149468713300012960SoilVTAVLVVVHLLAATVWVGGSTALIFVGVPAIRALE
Ga0164307_1049800713300012987SoilVTSVLVAVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGRAMRELGLRW
Ga0164305_1104138023300012989SoilVTAVLVTVHLLAAGIWFGGSTALVFVGVPAIRTLDGEPRSRVMKE
Ga0157370_1063775313300013104Corn RhizosphereVTAVFVTVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGRA
Ga0157370_1090684013300013104Corn RhizosphereVTAVFVTVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGRAMKELGLRWRP
Ga0157370_1200991213300013104Corn RhizosphereVTSVIVTVHLLAAGVWFGGSTALVFVGVPAIRTLEGEPRGRAM
Ga0157378_1065352613300013297Miscanthus RhizosphereVTAVLVTIHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGRAMKELGLRWRPVGYGALL
Ga0120147_104451123300013758PermafrostVTPVLVVVHLLAATVWVGGSTALIFVGVPAIRTLD
Ga0120125_109267713300014056PermafrostVTAVLVTVHLLAAGIWFGGSTALVFVGVPAIRTLEVEPRSRATKELG
Ga0167648_109833623300015171Glacier Forefield SoilVTAVLVTVHLIAAGIWFGGSTALIFVGVPAIRVLDG
Ga0132258_1287644613300015371Arabidopsis RhizosphereVHEIFVIVHLLAAMVWVGGSIALVFAGVPAIRVLEGEPRGKAMKE
Ga0187785_1020366213300017947Tropical PeatlandVTAVLVAVHLIAAGIWFGGSTALVFVGVPAIRTLEGAPRARVMRELGLRWRPIGYGSLLV
Ga0206354_1172075313300020081Corn, Switchgrass And Miscanthus RhizosphereVTAVFVTVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGRAMK
Ga0193699_1018524123300021363SoilVTAVLVVVHLLAATVWVGGSTALIFVGVPAIRTLEGEPRG
Ga0213876_1058468223300021384Plant RootsVTGSLVAVHLVAAGIWFGGSTALVFVGVPAIRTLDG
Ga0210384_1128184323300021432SoilMEEVIVIIHLLAASVWLGGSIALVFAGVPAIRVLEGEARGRAMKELGLRWRPVGYGSLV
Ga0126371_1375576213300021560Tropical Forest SoilVIGVLVTVHLLAAAVWVGGSTALIFVGVPVLRKLEGPERGRAMRELG
Ga0179589_1056289213300024288Vadose Zone SoilVIGVLVTVHLLAAAVWFGGSTALIFVGVPAIRILDGEPRGQAMKELGLRW
Ga0207692_1016949323300025898Corn, Switchgrass And Miscanthus RhizosphereVTAVLVTVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGRAMKAL
Ga0207695_1023697213300025913Corn RhizosphereVTAVFVTVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGRAMKELGLRWRPIGYGAL
Ga0207671_1123166423300025914Corn RhizosphereVTAVFVTVHLLAAGIWFGGSTALVFVGVPAVRTLEGEPRGRA
Ga0207693_1065862623300025915Corn, Switchgrass And Miscanthus RhizosphereVTAVLVTVHLLAAGIWFGGSTALVFVGVPAIRQLEGDARGRAMKQLGFLW
Ga0207660_1043154123300025917Corn RhizosphereVTAVFVTVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGRAMKELGLRWRPIGY
Ga0207700_1100873313300025928Corn, Switchgrass And Miscanthus RhizosphereVIALLVTIHLLAAAVWVGGSTALIFVGVPAVRVLEGEPRSRAMKEL
Ga0207690_1061099113300025932Corn RhizosphereVTAVFVTVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGRAMKELGLRWRPIGYGALLV
Ga0207665_1006791163300025939Corn, Switchgrass And Miscanthus RhizosphereVTAVLVTIHLVAAGIWFGGSTALVFVGVPAIRTLEGEPR
Ga0207667_1134287713300025949Corn RhizosphereVEEAVVIVHLLAASVWLGGSVALVFAGVPAIRVLEGDPRGRAMKELGLRWR
Ga0207640_1087394223300025981Corn RhizosphereVTAVFVTVHLLAAGIWFGGSTALVFVGVPAIRTLEG
Ga0207677_1095331323300026023Miscanthus RhizosphereVVVHLLAAAVWVGGSTALVFVGVPAIRTLEGEPRGRAMKELGLRWRPL
Ga0207639_1008476253300026041Corn RhizosphereVTAVFVTVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRVRAMKELGLRWRPIGYGALLV
Ga0207639_1127098513300026041Corn RhizosphereVTAVLVTVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGHAMKQLGLLWRP
Ga0207678_1189257713300026067Corn RhizosphereMALLVTVHLLAAGVWFGGSTALVFVGVPAIRTLDGEP
Ga0207702_1093676933300026078Corn RhizosphereVTAVLVAVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGTAMKKLGLLWRPLGYGALL
Ga0207698_1016608013300026142Corn RhizosphereVTAIFVTVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGRAMR
Ga0209474_1068936823300026550SoilVEEVVVIIHLLAAMVWVGGSVALVFAGVPAIRVLEG
Ga0247827_1077784413300028889SoilVADVLRIVHLLAAGVWLGGTVALVFAGVPAIRTLEGEARGRT
Ga0265327_1010929633300031251RhizosphereVTAVLVTVHLLAAGIWFGGSTALVFVGVPAIRSLDGEPR
Ga0307373_1051142913300031672SoilVIIHLLAASVWLGGSIALVFAGVPAIRVLEGDPRGRAMKELGLRWRPIG
Ga0318493_1023386813300031723SoilVIIHLLAAMIWVGGSVALVFVGVPAIRILEGEPRGRAMRELG
Ga0307468_10224768723300031740Hardwood Forest SoilVHEVFVIVHLLAAMVWVGGSVALVFAGVPAIRVLEGEPRG
Ga0318502_1084487523300031747SoilVIVHLLAATVWVGGSVALVFAGVPAIRVLEGEHRGRAMRELG
Ga0318568_1051324823300031819SoilVIIHLLAAMIWVGGSVALVFVGVPAIRILEGEPRGRAM
Ga0306919_1097860623300031879SoilVTAVLVTIHLLAAAVWVGGSTALIFVGVPAVRSLEGEPRSRA
Ga0318551_1011272733300031896SoilVVGVLVAVHLLAAAVWVGGSTALIFVGVPVIRTLDGPERG
Ga0308176_1059652413300031996SoilVTAVFVTVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGRAMKELGL
Ga0308176_1157850523300031996SoilVTAIFVTVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGRAMRELGLRWRPIGYG
Ga0308176_1182615523300031996SoilVTGVLVAVHLVAAGIWFGGSTALVFVGVPAIRTLEAD
Ga0308176_1234742223300031996SoilVTALFVTVHLLAAGIWFGGSTALVFVGVPAIRTLDG
Ga0308173_1086239433300032074SoilVTAVFVTVHLLAAGIWFGGSTALVFVGVPAIRTLEGEPRGRAMKELGLRWRPIG
Ga0335080_1029845113300032828SoilVTAFLVVVHLLSAGIWFGGSTALVFVGVPAVRTLE
Ga0335074_1158587123300032895SoilVTAVLVGIHLLAAGVWFGGSTALVFVGVPAVRTLE
Ga0335071_1002459583300032897SoilVTAFLVVVHLLSAGIWFGGSTALVFVGVPVVRTLEGEARGRAMK
Ga0335071_1098899723300032897SoilVTAFLVVVHLLSAGIWFGGSTALVFVGVPAIRTLDGEPRGRAMKV
Ga0335083_1082574613300032954SoilLEVVVIIHLLAAMVWVGGSVALVFVGVPAIRVLEGEP
Ga0335083_1122974513300032954SoilVTAVLVTVHLLAAGIWFGGSTALVFVGVPAIRQLE
Ga0316628_10425660523300033513SoilVTVVLVTVHLLAAGIWFGGSTALVFVGVPAIRTLDGEPRGRAMRALGLRWRPIGYGALVVAA
Ga0370501_0018480_1853_20083300034195Untreated Peat SoilVTAVLVTAHLLAAGIWFGGSTALVFVGVPAIRELDGESRGRAMKALGLRWRP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.