Basic Information | |
---|---|
Family ID | F094003 |
Family Type | Metagenome |
Number of Sequences | 106 |
Average Sequence Length | 36 residues |
Representative Sequence | MNYKGETMNKIYTGAGVVSISVVISVLVYIIIVGI |
Number of Associated Samples | 61 |
Number of Associated Scaffolds | 106 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 80.19 % |
% of genes near scaffold ends (potentially truncated) | 6.60 % |
% of genes from short scaffolds (< 2000 bps) | 77.36 % |
Associated GOLD sequencing projects | 61 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (70.755 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine (52.830 % of family members) |
Environment Ontology (ENVO) | Unclassified (96.226 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (83.962 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.79% β-sheet: 0.00% Coil/Unstructured: 49.21% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 106 Family Scaffolds |
---|---|---|
PF01726 | LexA_DNA_bind | 6.60 |
PF01612 | DNA_pol_A_exo1 | 2.83 |
PF13155 | Toprim_2 | 1.89 |
PF08273 | Prim_Zn_Ribbon | 1.89 |
PF01541 | GIY-YIG | 0.94 |
PF00004 | AAA | 0.94 |
PF00136 | DNA_pol_B | 0.94 |
PF07661 | MORN_2 | 0.94 |
PF00732 | GMC_oxred_N | 0.94 |
PF03144 | GTP_EFTU_D2 | 0.94 |
COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
---|---|---|---|
COG4643 | Uncharacterized domain associated with phage/plasmid primase | Mobilome: prophages, transposons [X] | 1.89 |
COG0417 | DNA polymerase B elongation subunit | Replication, recombination and repair [L] | 0.94 |
COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.94 |
COG2849 | Antitoxin component YwqK of the YwqJK toxin-antitoxin module | Defense mechanisms [V] | 0.94 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 93.40 % |
Unclassified | root | N/A | 6.60 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000142|LPaug09P16500mDRAFT_c1004519 | All Organisms → Viruses → Predicted Viral | 3154 | Open in IMG/M |
3300000163|LPjun09P162000mDRAFT_c1039675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 655 | Open in IMG/M |
3300000181|LPjun08P4500mDRAFT_c1025663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 804 | Open in IMG/M |
3300000264|LP_A_09_P04_500DRAFT_1029618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 671 | Open in IMG/M |
3300006076|Ga0081592_1198007 | Not Available | 650 | Open in IMG/M |
3300006076|Ga0081592_1202632 | Not Available | 636 | Open in IMG/M |
3300006304|Ga0068504_1212721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 758 | Open in IMG/M |
3300006304|Ga0068504_1212722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 827 | Open in IMG/M |
3300006306|Ga0068469_1064639 | All Organisms → cellular organisms → Bacteria | 12963 | Open in IMG/M |
3300006306|Ga0068469_1074146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 2162 | Open in IMG/M |
3300006306|Ga0068469_1140287 | All Organisms → Viruses → Predicted Viral | 2720 | Open in IMG/M |
3300006306|Ga0068469_1148840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 894 | Open in IMG/M |
3300006306|Ga0068469_1209757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 827 | Open in IMG/M |
3300006306|Ga0068469_1278104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 1063 | Open in IMG/M |
3300006308|Ga0068470_1126817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 2677 | Open in IMG/M |
3300006308|Ga0068470_1520130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 1223 | Open in IMG/M |
3300006310|Ga0068471_1194898 | All Organisms → Viruses → Predicted Viral | 1995 | Open in IMG/M |
3300006310|Ga0068471_1221622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 5745 | Open in IMG/M |
3300006310|Ga0068471_1299555 | All Organisms → Viruses → Predicted Viral | 2143 | Open in IMG/M |
3300006310|Ga0068471_1503881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 1301 | Open in IMG/M |
3300006310|Ga0068471_1611332 | All Organisms → Viruses → Predicted Viral | 2208 | Open in IMG/M |
3300006310|Ga0068471_1619728 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 1093 | Open in IMG/M |
3300006310|Ga0068471_1620263 | All Organisms → Viruses → Predicted Viral | 1773 | Open in IMG/M |
3300006311|Ga0068478_1123400 | All Organisms → Viruses → Predicted Viral | 4385 | Open in IMG/M |
3300006311|Ga0068478_1175938 | All Organisms → Viruses → Predicted Viral | 2405 | Open in IMG/M |
3300006311|Ga0068478_1267019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 869 | Open in IMG/M |
3300006313|Ga0068472_10151589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 4424 | Open in IMG/M |
3300006313|Ga0068472_10235959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 1230 | Open in IMG/M |
3300006313|Ga0068472_10726685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 800 | Open in IMG/M |
3300006316|Ga0068473_1159253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 7424 | Open in IMG/M |
3300006316|Ga0068473_1214079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 851 | Open in IMG/M |
3300006324|Ga0068476_1231473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 1083 | Open in IMG/M |
3300006324|Ga0068476_1390037 | All Organisms → Viruses → Predicted Viral | 1845 | Open in IMG/M |
3300006324|Ga0068476_1430677 | Not Available | 613 | Open in IMG/M |
3300006324|Ga0068476_1476442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 735 | Open in IMG/M |
3300006325|Ga0068501_1102872 | All Organisms → Viruses → Predicted Viral | 2036 | Open in IMG/M |
3300006325|Ga0068501_1469041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 691 | Open in IMG/M |
3300006325|Ga0068501_1515449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 1023 | Open in IMG/M |
3300006326|Ga0068477_1116642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 8363 | Open in IMG/M |
3300006326|Ga0068477_1125808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3836 | Open in IMG/M |
3300006326|Ga0068477_1223684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 1867 | Open in IMG/M |
3300006330|Ga0068483_1155275 | All Organisms → Viruses → Predicted Viral | 1675 | Open in IMG/M |
3300006335|Ga0068480_1373893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 716 | Open in IMG/M |
3300006335|Ga0068480_1517949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 587 | Open in IMG/M |
3300006336|Ga0068502_1121368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 10086 | Open in IMG/M |
3300006336|Ga0068502_1364329 | All Organisms → Viruses → Predicted Viral | 1171 | Open in IMG/M |
3300006336|Ga0068502_1381893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 1398 | Open in IMG/M |
3300006336|Ga0068502_1383229 | All Organisms → Viruses → Predicted Viral | 1296 | Open in IMG/M |
3300006336|Ga0068502_1408676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 671 | Open in IMG/M |
3300006336|Ga0068502_1425747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 1682 | Open in IMG/M |
3300006336|Ga0068502_1468397 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 866 | Open in IMG/M |
3300006336|Ga0068502_1920808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 640 | Open in IMG/M |
3300006338|Ga0068482_1346363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 786 | Open in IMG/M |
3300006338|Ga0068482_1446539 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 688 | Open in IMG/M |
3300006339|Ga0068481_1532736 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1100 | Open in IMG/M |
3300006339|Ga0068481_1532817 | Not Available | 2484 | Open in IMG/M |
3300006340|Ga0068503_10343581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 1163 | Open in IMG/M |
3300006340|Ga0068503_10483518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 952 | Open in IMG/M |
3300006340|Ga0068503_10485237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 1396 | Open in IMG/M |
3300006340|Ga0068503_10559834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 1285 | Open in IMG/M |
3300006340|Ga0068503_10679238 | All Organisms → Viruses → Predicted Viral | 1066 | Open in IMG/M |
3300006341|Ga0068493_10627186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 658 | Open in IMG/M |
3300006347|Ga0099697_1101857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 1373 | Open in IMG/M |
3300006347|Ga0099697_1299681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 1020 | Open in IMG/M |
3300006416|Ga0100043_10203079 | Not Available | 2281 | Open in IMG/M |
3300006900|Ga0066376_10482943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 700 | Open in IMG/M |
3300006900|Ga0066376_10671208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 573 | Open in IMG/M |
3300007756|Ga0105664_1017086 | All Organisms → Viruses → Predicted Viral | 1210 | Open in IMG/M |
3300007777|Ga0105711_1199217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 940 | Open in IMG/M |
3300009173|Ga0114996_10977774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 602 | Open in IMG/M |
3300009412|Ga0114903_1114769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 593 | Open in IMG/M |
3300009420|Ga0114994_10066829 | All Organisms → Viruses → Predicted Viral | 2460 | Open in IMG/M |
3300017775|Ga0181432_1010607 | All Organisms → Viruses → Predicted Viral | 2239 | Open in IMG/M |
3300020399|Ga0211623_10097619 | All Organisms → Viruses → Predicted Viral | 1010 | Open in IMG/M |
3300020447|Ga0211691_10037686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 1704 | Open in IMG/M |
3300021065|Ga0206686_1238839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 512 | Open in IMG/M |
3300021089|Ga0206679_10583631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 574 | Open in IMG/M |
3300021352|Ga0206680_10344530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 578 | Open in IMG/M |
3300021442|Ga0206685_10101166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 951 | Open in IMG/M |
3300021442|Ga0206685_10187829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 694 | Open in IMG/M |
3300021443|Ga0206681_10085254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 1231 | Open in IMG/M |
3300021978|Ga0232646_1129754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 849 | Open in IMG/M |
3300022225|Ga0187833_10299340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 894 | Open in IMG/M |
(restricted) 3300024517|Ga0255049_10079896 | All Organisms → Viruses → Predicted Viral | 1482 | Open in IMG/M |
3300025042|Ga0207889_1013978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 746 | Open in IMG/M |
3300025069|Ga0207887_1065299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 594 | Open in IMG/M |
3300027779|Ga0209709_10001668 | Not Available | 20219 | Open in IMG/M |
3300028018|Ga0256381_1009140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 1601 | Open in IMG/M |
3300028022|Ga0256382_1071612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 822 | Open in IMG/M |
3300028039|Ga0256380_1028208 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 902 | Open in IMG/M |
3300028190|Ga0257108_1009766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 2800 | Open in IMG/M |
3300028488|Ga0257113_1238985 | Not Available | 519 | Open in IMG/M |
3300031773|Ga0315332_10944815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 515 | Open in IMG/M |
3300031801|Ga0310121_10004074 | All Organisms → cellular organisms → Bacteria | 13075 | Open in IMG/M |
3300031802|Ga0310123_10047885 | All Organisms → Viruses → Predicted Viral | 3018 | Open in IMG/M |
3300031803|Ga0310120_10195217 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 1111 | Open in IMG/M |
3300031861|Ga0315319_10233721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 927 | Open in IMG/M |
3300032278|Ga0310345_10262912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 1586 | Open in IMG/M |
3300032360|Ga0315334_11711004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 535 | Open in IMG/M |
3300032820|Ga0310342_100658902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 1194 | Open in IMG/M |
3300032820|Ga0310342_100881948 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1041 | Open in IMG/M |
3300034629|Ga0326756_006336 | All Organisms → Viruses → Predicted Viral | 1349 | Open in IMG/M |
3300034629|Ga0326756_021068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 764 | Open in IMG/M |
3300034654|Ga0326741_072347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 571 | Open in IMG/M |
3300034656|Ga0326748_058137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 548 | Open in IMG/M |
3300034658|Ga0326751_016333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 | 798 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 52.83% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 8.49% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 6.60% |
Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 6.60% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 4.72% |
Filtered Seawater | Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater | 4.72% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 3.77% |
Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 2.83% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.89% |
Diffuse Hydrothermal Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Fluids | 1.89% |
Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.94% |
Background Seawater | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater | 0.94% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.94% |
Diffuse Vent Fluid, Hydrothermal Vents | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Vent Fluid, Hydrothermal Vents | 0.94% |
Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Fluids | 0.94% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.94% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000142 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 500m | Environmental | Open in IMG/M |
3300000163 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P16 2000m | Environmental | Open in IMG/M |
3300000181 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2008 P4 500m | Environmental | Open in IMG/M |
3300000264 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_500 | Environmental | Open in IMG/M |
3300006076 | Microbial communities in diffuse hydrothermal fluids of Manus Basin, Bismarck Sea ? fluid A | Environmental | Open in IMG/M |
3300006304 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_1000m | Environmental | Open in IMG/M |
3300006306 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_0500m | Environmental | Open in IMG/M |
3300006308 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0500m | Environmental | Open in IMG/M |
3300006310 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_3_0500m | Environmental | Open in IMG/M |
3300006311 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_1000m | Environmental | Open in IMG/M |
3300006313 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0770m | Environmental | Open in IMG/M |
3300006316 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_1000m | Environmental | Open in IMG/M |
3300006324 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0500m | Environmental | Open in IMG/M |
3300006325 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0500m | Environmental | Open in IMG/M |
3300006326 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0770m | Environmental | Open in IMG/M |
3300006330 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_1_1000m | Environmental | Open in IMG/M |
3300006335 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_2_0500m | Environmental | Open in IMG/M |
3300006336 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0500m | Environmental | Open in IMG/M |
3300006338 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_1_0770m | Environmental | Open in IMG/M |
3300006339 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_3_0500m | Environmental | Open in IMG/M |
3300006340 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770m | Environmental | Open in IMG/M |
3300006341 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT236_2_0770m | Environmental | Open in IMG/M |
3300006347 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_1000m | Environmental | Open in IMG/M |
3300006416 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0770m | Environmental | Open in IMG/M |
3300006900 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_A | Environmental | Open in IMG/M |
3300007756 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample CTDBack_2015_DNA CLC_assembly | Environmental | Open in IMG/M |
3300007777 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS918_NRZ_DNA CLC_assembly | Environmental | Open in IMG/M |
3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
3300009412 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2 | Environmental | Open in IMG/M |
3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
3300020399 | Marine microbial communities from Tara Oceans - TARA_B100000470 (ERX555969-ERR598947) | Environmental | Open in IMG/M |
3300020447 | Marine microbial communities from Tara Oceans - TARA_B100000745 (ERX556090-ERR599159) | Environmental | Open in IMG/M |
3300021065 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015 | Environmental | Open in IMG/M |
3300021089 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 | Environmental | Open in IMG/M |
3300021352 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 | Environmental | Open in IMG/M |
3300021442 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 | Environmental | Open in IMG/M |
3300021443 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 | Environmental | Open in IMG/M |
3300021978 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Perseverance_CTD_V16A_01_btl17 _150kmer | Environmental | Open in IMG/M |
3300022225 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_400_PacBio MetaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300024517 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3 | Environmental | Open in IMG/M |
3300025042 | Marine viral communities from the Pacific Ocean - LP-47 (SPAdes) | Environmental | Open in IMG/M |
3300025069 | Marine viral communities from the Pacific Ocean - LP-38 (SPAdes) | Environmental | Open in IMG/M |
3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
3300028018 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 1600m | Environmental | Open in IMG/M |
3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
3300028039 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 2300m | Environmental | Open in IMG/M |
3300028190 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_1000m | Environmental | Open in IMG/M |
3300028488 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_1320m | Environmental | Open in IMG/M |
3300031773 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915 | Environmental | Open in IMG/M |
3300031801 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986 | Environmental | Open in IMG/M |
3300031802 | Marine microbial communities from Western Arctic Ocean, Canada - CB6_AW_1057 | Environmental | Open in IMG/M |
3300031803 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_AW_983 | Environmental | Open in IMG/M |
3300031861 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 3416 | Environmental | Open in IMG/M |
3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
3300034629 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 543_2600 | Environmental | Open in IMG/M |
3300034654 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 487_2244 | Environmental | Open in IMG/M |
3300034656 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 502_2477 | Environmental | Open in IMG/M |
3300034658 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 524_CTD | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
LPaug09P16500mDRAFT_10045197 | 3300000142 | Marine | MNYKGETMNRIYTGAGVVSISVVFSVLVYIIINGV* |
LPjun09P162000mDRAFT_10396752 | 3300000163 | Marine | MNYKGETMNKIYTGAGVASVSVVIGVLVYIIIVGV* |
LPjun08P4500mDRAFT_10256632 | 3300000181 | Marine | MNYKGETMNKIYTGAGVVSISVVISVLVYIIINGV* |
LP_A_09_P04_500DRAFT_10296182 | 3300000264 | Marine | MNYKGETMNRIYTGAGVVSISVVVSVLVYIIIVGI* |
Ga0081592_11980073 | 3300006076 | Diffuse Hydrothermal Fluids | MNYKGETMNKIYTGAGVVSISVVIGVLVYIIIVGV* |
Ga0081592_12026321 | 3300006076 | Diffuse Hydrothermal Fluids | MNYKGETMNKIYTGAGVVSVSVVISVLVYIIVVGI* |
Ga0068504_12127212 | 3300006304 | Marine | MNFKGDIMNKIYTGAGVVSILTVISILVFIKIVGI* |
Ga0068504_12127222 | 3300006304 | Marine | MNYKGGTMDKIYTGAGVVSIITVISVLVYIIIIGV* |
Ga0068469_106463912 | 3300006306 | Marine | MNFKGGTMDKIYTGAGVVSIITVMSVVVYIIIAGI* |
Ga0068469_10741462 | 3300006306 | Marine | MNYKGETMNKIYTGAGVVSISVVISVLVYIIIVGI* |
Ga0068469_11402875 | 3300006306 | Marine | MNYKGETMNKIYTGAGVASVSVVISVLVYIIIVGI* |
Ga0068469_11488403 | 3300006306 | Marine | MNYKGETMNRIYTGAGVVSISVIICVLVYIIMIGI* |
Ga0068469_12097573 | 3300006306 | Marine | MNYKGETMIKIYTGAGVVSISVVISVLVYIIIVGI* |
Ga0068469_12781042 | 3300006306 | Marine | MNSKGETMNKIYTGAGVVSISVVMCVLVYIIMIGI* |
Ga0068470_11268174 | 3300006308 | Marine | MNYKGETMNKIYTGAGVVSISVVISVLVYIIIVGV* |
Ga0068470_15201303 | 3300006308 | Marine | MNYKGESMNKIYTGAGVASISVVISVLVYIIIVGI* |
Ga0068471_11948983 | 3300006310 | Marine | MNSKGENMNKIYTGAGVVSISVIICVLVYIIMIGI* |
Ga0068471_122162219 | 3300006310 | Marine | MNYKGETMNKIYTGAGVVSISVVVSVLVYIIIVGI* |
Ga0068471_12995552 | 3300006310 | Marine | MNFNGETMDKIYTGAGVVSILIVISVLFYIIIVGI* |
Ga0068471_15038813 | 3300006310 | Marine | MNYKGETMNRIYTGAGVVSISVVISVLVYIIIVGI* |
Ga0068471_16113322 | 3300006310 | Marine | MNYKGETMNRIYTGAGVVSISVVASVLVYIIIVGI* |
Ga0068471_16197284 | 3300006310 | Marine | MNYKGETMNKIYTGAGVASVSVVISVLIYIIIVGI* |
Ga0068471_16202633 | 3300006310 | Marine | MNSKGERMNRIYTGAGVVSISVIICVLVYIIMVGI* |
Ga0068478_11234001 | 3300006311 | Marine | VMNYKGETMNKIYTGAGVVSVSVVISVLVYIIIVGI* |
Ga0068478_11759386 | 3300006311 | Marine | MNYKGETMNKIYTGAGVASVSVVIGVVVYIIIVGI* |
Ga0068478_12670192 | 3300006311 | Marine | MNYKGETMNKIYTGAGVVSISVVIGVLVYIIIVGI* |
Ga0068472_101515898 | 3300006313 | Marine | MNYKGETMNKIYTGAGVVSVSVVIGVLVYIIIVGI* |
Ga0068472_102359594 | 3300006313 | Marine | MNFNGGTMDKIYTGAGVVSIITVISVLVYIIIIGV* |
Ga0068472_107266853 | 3300006313 | Marine | MNFNEGTMDKIYTGAGVVSISVVIGVLVYIIIVGV* |
Ga0068473_115925310 | 3300006316 | Marine | MNYKGETMNKIYTGAGVVSVSVVIGVLVYIIVVGI* |
Ga0068473_12140793 | 3300006316 | Marine | MNFKGGTMDKIYTGAGVVSILTVISVLVYIIIVGI* |
Ga0068476_12314733 | 3300006324 | Marine | MNYKGETMNRIYTGAGVASISVVIGVVVYIIIVGI* |
Ga0068476_13900373 | 3300006324 | Marine | MNSKGETMNKIYTGAGVVSISVVISVLVYIIIVGV* |
Ga0068476_14306773 | 3300006324 | Marine | MNFFKGETMNKLYTGAGVVSISVVISVLVYIIIVGV* |
Ga0068476_14764422 | 3300006324 | Marine | MNYKGETMNKIYTGAGVASISVVISVLVYIIIVGI* |
Ga0068501_11028724 | 3300006325 | Marine | MNYKGERMNRIYTGAGVVSISVVMCVLVYIIMIGI* |
Ga0068501_14690412 | 3300006325 | Marine | MNYKGETMNRIYTGAGVVSISVVISVLVYIIIVGV* |
Ga0068501_15154493 | 3300006325 | Marine | MNYKGETMNKIYTGAGVLSVSVVISVLVYIIIVGI* |
Ga0068477_111664214 | 3300006326 | Marine | MNYKGETMNKIYTGAGVASISVVIGVLVYIIIVGI* |
Ga0068477_11258088 | 3300006326 | Marine | MNYKGETMNKIYTGAGVASISVVVSVLVYVIIVGV* |
Ga0068477_12236845 | 3300006326 | Marine | MNFKGGTMDKIYTGAGVVSIITVMSVVVYIIISGI* |
Ga0068483_11552752 | 3300006330 | Marine | MNYKGETMNKIYTGAGVVSVSVAIGVLVYIIVVGI* |
Ga0068480_13738933 | 3300006335 | Marine | MNFKGGTMDKIYTGAGVVSISVVISVLVYIIIVGI* |
Ga0068480_15179492 | 3300006335 | Marine | MNYKGETMNRIYTGAGVASISVVISVVVYIIIVGI* |
Ga0068502_112136826 | 3300006336 | Marine | MNYKGESMNKIYTGAGVASVSVVISVLVYIIIVGI* |
Ga0068502_13643291 | 3300006336 | Marine | MNFNGGTMDKIYTGAGVVSILIVISVLFYIIIVGI* |
Ga0068502_13818935 | 3300006336 | Marine | MNFFKGETMNKLYTGAGVVSVSVVISVLVYIIIVGV* |
Ga0068502_13832293 | 3300006336 | Marine | MNYKGERMNRIYTGAGVVSISVIMCVLVYIIMIGI* |
Ga0068502_14086762 | 3300006336 | Marine | MNYKGETMNRIYTGAGVVSISVVFSVLVYIIIVGV* |
Ga0068502_14257472 | 3300006336 | Marine | MNSKGETMNRIYTGAGVVSISVVVSVLVYIIIVGI* |
Ga0068502_14683974 | 3300006336 | Marine | RFKFNVMNYKGETMNKIYTGAGVASISVVIGVVVYIIIVGI* |
Ga0068502_19208082 | 3300006336 | Marine | MNSKGETMNKIYTGAGVASVSVVISVLVYIIIVGI* |
Ga0068482_13463632 | 3300006338 | Marine | MNYKGETMNKIYTGAGVASVSVVIGVLVYIIIVGI* |
Ga0068482_14465393 | 3300006338 | Marine | QRNVMNYKGDTMNKIYTGAGVASVSVVISVLVYIIIVGI* |
Ga0068481_15327362 | 3300006339 | Marine | MNYKGETMNRIYTGAGVVSISVVISVLVYIITVGI* |
Ga0068481_15328177 | 3300006339 | Marine | LKNYLQRSVMNYKGETMNKIYTGAGVVSISVVISVLVYIIIVGV* |
Ga0068503_103435813 | 3300006340 | Marine | MNYKGETMNKIYTGAGLASVSVVIGVLVYIIIVGI* |
Ga0068503_104835182 | 3300006340 | Marine | MNFKGGTMDKIYTGAGVVSIITVISVLVYIIIIGV* |
Ga0068503_104852373 | 3300006340 | Marine | MNYKGETMNKIYTGAGIVSVSVVISVLVYIIIVGV* |
Ga0068503_105598342 | 3300006340 | Marine | MNFKGGIMDKIYTGAGVVSILTVISVLVYIIIVGI* |
Ga0068503_106792383 | 3300006340 | Marine | MNYKGETMNRIYTGAGVASVSVVIGVLVYIIVVGI* |
Ga0068493_106271862 | 3300006341 | Marine | MNFNGGTMDKIYTGAGVVSISVEIGVLDYIIFVGV* |
Ga0099697_11018574 | 3300006347 | Marine | MNFKGGTMDKIYTGAGVVSIITVISVLVYIIIVGI* |
Ga0099697_12996814 | 3300006347 | Marine | MHYKGETMNKIYTGAGVVSVSVVISVLVYIIVVGI* |
Ga0100043_102030793 | 3300006416 | Marine | MNYKGETMNKIYTGAGVVSVSVVISVLVYIIIVGV* |
Ga0066376_104829432 | 3300006900 | Marine | MNYKGETMNKIYTGAGVVSISVVIGVLVYIIIAGI* |
Ga0066376_106712082 | 3300006900 | Marine | MNYKEEIMNKIYTVAGVISILIAISVLIYIIIVGV* |
Ga0105664_10170863 | 3300007756 | Background Seawater | MNYKGETMNRIYTGAGVVSVSVVIGVLVYIIIVGV* |
Ga0105711_11992172 | 3300007777 | Diffuse Vent Fluid, Hydrothermal Vents | MNYKGETMNKIYTGAGVASISVVIGVVVYIIIVGI* |
Ga0114996_109777742 | 3300009173 | Marine | MNYKGEEMNKIYIGAGVLSISVVLGVLVYIIIVGI* |
Ga0114903_11147692 | 3300009412 | Deep Ocean | MNYKGETMNKIYTGAGVVSVSVVISVLVYIIIVGI* |
Ga0114994_100668296 | 3300009420 | Marine | LRYLKEEIMNKIYMGAGVVSIAVVMCVLVYIIMFGI* |
Ga0181432_10106072 | 3300017775 | Seawater | MNFKGGTMDKIYTGAGVVSIITVMSVVVYIIISGI |
Ga0211623_100976193 | 3300020399 | Marine | MNYKGEEMNNIYMGAGVLSISVVLSVLVYIIIVGI |
Ga0211691_100376866 | 3300020447 | Marine | NVMNYKGEEMNNIYMGAGVLSISVVLSVLVYIIIVGI |
Ga0206686_12388392 | 3300021065 | Seawater | MNYKGETMNRIYTGAGVVSISVVISVLVYIIIVGI |
Ga0206679_105836312 | 3300021089 | Seawater | MNYKGERMNRIYTGAGVVSISVIICVLVYIIMIGI |
Ga0206680_103445302 | 3300021352 | Seawater | MNYKGERMNRIYTGAGVVSISVIMCVLVYIIMIGI |
Ga0206685_101011662 | 3300021442 | Seawater | MNYKGENMNRIYTGAGVVSISVIICVLVYIIMIGI |
Ga0206685_101878293 | 3300021442 | Seawater | MNYKGETMNRIYTGAGVVSISVVVSVLVYIIIVGI |
Ga0206681_100852543 | 3300021443 | Seawater | MNYKGETMNRIYTGAGVVSISVVFSVLVYIIINGV |
Ga0232646_11297542 | 3300021978 | Hydrothermal Vent Fluids | MNYKGETMNKIYTGAGVVSISVVIGVLVYIIIVGV |
Ga0187833_102993402 | 3300022225 | Seawater | MNYKGETMNKIYTGAGVVSVSVVISVLVYIIIVGI |
(restricted) Ga0255049_100798962 | 3300024517 | Seawater | MNSKGEIMNKIYTGAGVVSISVVMCVLVYIIMIGI |
Ga0207889_10139782 | 3300025042 | Marine | MNYKGETMNKIYTGAGVVSVSVVISVLVYIIIVGV |
Ga0207887_10652991 | 3300025069 | Marine | MNFFKGETMNKLYTGAGVVSVSVVISVLVYIIIVGV |
Ga0209709_1000166826 | 3300027779 | Marine | LRYLKEEIMNKIYMGAGVVSIAVVMCVLVYIIMFGI |
Ga0256381_10091404 | 3300028018 | Seawater | MNFNGGTMDKIYTGAGVVSILTVISVLVYIIIVGI |
Ga0256382_10716122 | 3300028022 | Seawater | MNYKGDTMNKIYTGAGVISIITVMSVLVYIIIIGV |
Ga0256380_10282081 | 3300028039 | Seawater | MNFNGGTMNKIYTGAGVVSILTVISVLVYIIIVGI |
Ga0257108_10097663 | 3300028190 | Marine | MNYKGETMNKIYTGAGVASVSVVIGVLVYIIIVGV |
Ga0257113_12389851 | 3300028488 | Marine | MNFFKGETMNKLYTGAGVVSISVVIGVLVYIIIVGV |
Ga0315332_109448152 | 3300031773 | Seawater | MNYKGENMNRIYTGAGVVSISVIICVLVYIIMVGV |
Ga0310121_1000407428 | 3300031801 | Marine | MNFNGGIMDKIYTGAGVVSILTVLSVLVYIIIIGV |
Ga0310123_100478854 | 3300031802 | Marine | MNYKGDIMNKIYTGAGVVSILTVISILIYIIIVGV |
Ga0310120_101952171 | 3300031803 | Marine | LKNYLQRSVMNYKGETMNKIYTGAGVASVSVVIGVLVYIIIAGI |
Ga0315319_102337213 | 3300031861 | Seawater | MNYKGETMNRIYTGAGVVSISVVISVLVYIIIVGV |
Ga0310345_102629122 | 3300032278 | Seawater | MNFKGGTMDKIYTGAGVVSIITVMSVVVYIIIAGI |
Ga0315334_117110042 | 3300032360 | Seawater | MNYKGETMNKIYTGAGVVSISVVISVLVYIIIVGV |
Ga0310342_1006589022 | 3300032820 | Seawater | MNFNGETMDKIYTGAGVVSILIVISVLFYIIIVGI |
Ga0310342_1008819483 | 3300032820 | Seawater | MNYKGETMNKIYTGAGVVSISVVISVLVYIIIVGI |
Ga0326756_006336_644_751 | 3300034629 | Filtered Seawater | MNYKGETMNKIYTGAGVASVSVVIGVLVYIIIVGI |
Ga0326756_021068_415_522 | 3300034629 | Filtered Seawater | MNYKGDIMNKIYTGAGVASILTVISILVYIIIVGI |
Ga0326741_072347_40_147 | 3300034654 | Filtered Seawater | MNYKGETMNKIYTGAGVVSISVVIGILIYIIIVGI |
Ga0326748_058137_49_156 | 3300034656 | Filtered Seawater | MNYKGETMNKIYTGAGVLSVSIVISVLVYIIIVGI |
Ga0326751_016333_3_107 | 3300034658 | Filtered Seawater | MNYKGETMNKIYTGAGVVSISVVIGVLIYIIIVGV |
⦗Top⦘ |