NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F093996

Metagenome / Metatranscriptome Family F093996

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F093996
Family Type Metagenome / Metatranscriptome
Number of Sequences 106
Average Sequence Length 75 residues
Representative Sequence MQKCKKVWNLEMTVAMEQDFDSPELAANQIQPSDKAKVKEITGQRIIFSTVKLLKEDKADGLRSKEDKGVGGSSTGTN
Number of Associated Samples 80
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 48.00 %
% of genes near scaffold ends (potentially truncated) 16.98 %
% of genes from short scaffolds (< 2000 bps) 75.47 %
Associated GOLD sequencing projects 72
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (67.925 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(28.302 % of family members)
Environment Ontology (ENVO) Unclassified
(95.283 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(81.132 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 32.05%    β-sheet: 1.28%    Coil/Unstructured: 66.67%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF01381HTH_3 53.77
PF08291Peptidase_M15_3 6.60
PF13730HTH_36 6.60
PF00157Pou 0.94



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms71.70 %
UnclassifiedrootN/A28.30 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002511|JGI25131J35506_1006779All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811607Open in IMG/M
3300002760|JGI25136J39404_1002912All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2812819Open in IMG/M
3300003542|FS900DNA_10030531All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281545Open in IMG/M
3300006076|Ga0081592_1076475All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811407Open in IMG/M
3300006306|Ga0068469_1086009All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811971Open in IMG/M
3300006308|Ga0068470_1094619All Organisms → cellular organisms → Bacteria1874Open in IMG/M
3300006308|Ga0068470_1149435Not Available980Open in IMG/M
3300006310|Ga0068471_1056760All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2812610Open in IMG/M
3300006310|Ga0068471_1217393All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2812379Open in IMG/M
3300006310|Ga0068471_1572527All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811638Open in IMG/M
3300006310|Ga0068471_1580055Not Available1150Open in IMG/M
3300006310|Ga0068471_1588460Not Available884Open in IMG/M
3300006311|Ga0068478_1098419Not Available945Open in IMG/M
3300006313|Ga0068472_10759213All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281531Open in IMG/M
3300006315|Ga0068487_1004173All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281603Open in IMG/M
3300006324|Ga0068476_1064988Not Available7683Open in IMG/M
3300006324|Ga0068476_1067695All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811508Open in IMG/M
3300006324|Ga0068476_1238139All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281920Open in IMG/M
3300006325|Ga0068501_1093849All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811563Open in IMG/M
3300006325|Ga0068501_1109058All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811888Open in IMG/M
3300006325|Ga0068501_1267843All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281621Open in IMG/M
3300006326|Ga0068477_1259910All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281808Open in IMG/M
3300006336|Ga0068502_1125516All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2813571Open in IMG/M
3300006336|Ga0068502_1129600Not Available4034Open in IMG/M
3300006336|Ga0068502_1144489Not Available4849Open in IMG/M
3300006336|Ga0068502_1191778All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811523Open in IMG/M
3300006338|Ga0068482_1187342All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2812370Open in IMG/M
3300006338|Ga0068482_1702350Not Available675Open in IMG/M
3300006339|Ga0068481_1498216All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2813229Open in IMG/M
3300006339|Ga0068481_1511501Not Available4591Open in IMG/M
3300006340|Ga0068503_10183009All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2812503Open in IMG/M
3300006340|Ga0068503_10328508All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811822Open in IMG/M
3300006340|Ga0068503_10515604All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811416Open in IMG/M
3300006340|Ga0068503_10569014All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281772Open in IMG/M
3300006341|Ga0068493_10228317All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811530Open in IMG/M
3300006341|Ga0068493_10291708All Organisms → Viruses → Predicted Viral2765Open in IMG/M
3300006344|Ga0099695_1066718All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811500Open in IMG/M
3300006736|Ga0098033_1131472All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281705Open in IMG/M
3300006738|Ga0098035_1070348All Organisms → Viruses → Predicted Viral1247Open in IMG/M
3300006753|Ga0098039_1047301All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811508Open in IMG/M
3300006754|Ga0098044_1234218All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281714Open in IMG/M
3300006789|Ga0098054_1112370All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811016Open in IMG/M
3300006900|Ga0066376_10424707All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281758Open in IMG/M
3300006902|Ga0066372_10096538All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811520Open in IMG/M
3300006926|Ga0098057_1106164All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281685Open in IMG/M
3300006929|Ga0098036_1001451Not Available8870Open in IMG/M
3300006929|Ga0098036_1027364All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811796Open in IMG/M
3300007758|Ga0105668_1143073Not Available1012Open in IMG/M
3300007758|Ga0105668_1169452All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811005Open in IMG/M
3300007963|Ga0110931_1091985Not Available915Open in IMG/M
3300007963|Ga0110931_1182115All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281629Open in IMG/M
3300008216|Ga0114898_1016585Not Available2645Open in IMG/M
3300008217|Ga0114899_1004713Not Available6511Open in IMG/M
3300008219|Ga0114905_1047139All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811596Open in IMG/M
3300009412|Ga0114903_1029313All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811369Open in IMG/M
3300009413|Ga0114902_1077826Not Available911Open in IMG/M
3300009414|Ga0114909_1036767All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811501Open in IMG/M
3300009595|Ga0105214_109010All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281680Open in IMG/M
3300009602|Ga0114900_1030849All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811799Open in IMG/M
3300009603|Ga0114911_1058926All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811175Open in IMG/M
3300009604|Ga0114901_1045372All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811543Open in IMG/M
3300009619|Ga0105236_1027279All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281689Open in IMG/M
3300010153|Ga0098059_1132041Not Available987Open in IMG/M
3300010155|Ga0098047_10410297All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281506Open in IMG/M
3300017775|Ga0181432_1150323Not Available716Open in IMG/M
3300020434|Ga0211670_10086295All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811200Open in IMG/M
3300021345|Ga0206688_10016307All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281546Open in IMG/M
3300021442|Ga0206685_10047514All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811389Open in IMG/M
3300021791|Ga0226832_10004173Not Available4514Open in IMG/M
(restricted) 3300024057|Ga0255051_10058417All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811339Open in IMG/M
(restricted) 3300024517|Ga0255049_10126521All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811161Open in IMG/M
(restricted) 3300024518|Ga0255048_10001252Not Available18077Open in IMG/M
(restricted) 3300024518|Ga0255048_10090217All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811519Open in IMG/M
3300025049|Ga0207898_1001404All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2812521Open in IMG/M
3300025050|Ga0207892_1015567Not Available826Open in IMG/M
3300025052|Ga0207906_1017329All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811002Open in IMG/M
3300025069|Ga0207887_1044374All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281723Open in IMG/M
3300025128|Ga0208919_1006955Not Available4918Open in IMG/M
3300025128|Ga0208919_1113117All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281866Open in IMG/M
3300025264|Ga0208029_1087335Not Available582Open in IMG/M
3300025277|Ga0208180_1064798All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281894Open in IMG/M
3300025280|Ga0208449_1033519All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811487Open in IMG/M
3300025301|Ga0208450_1090232All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281683Open in IMG/M
3300025305|Ga0208684_1053073Not Available1108Open in IMG/M
3300025873|Ga0209757_10072273All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811034Open in IMG/M
3300028018|Ga0256381_1012418All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811392Open in IMG/M
3300028022|Ga0256382_1120537All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281630Open in IMG/M
3300028487|Ga0257109_1164556All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281644Open in IMG/M
3300031757|Ga0315328_10114587All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811558Open in IMG/M
3300031801|Ga0310121_10080710All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2812118Open in IMG/M
3300031801|Ga0310121_10235153All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811099Open in IMG/M
3300031801|Ga0310121_10598686All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281597Open in IMG/M
3300031802|Ga0310123_10299743All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811057Open in IMG/M
3300031803|Ga0310120_10116361All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811517Open in IMG/M
3300031861|Ga0315319_10110064All Organisms → Viruses → Predicted Viral1352Open in IMG/M
3300031886|Ga0315318_10278600All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281958Open in IMG/M
3300032130|Ga0315333_10079436All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811505Open in IMG/M
3300032145|Ga0315304_1214465All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281505Open in IMG/M
3300032278|Ga0310345_10917690All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281854Open in IMG/M
3300032820|Ga0310342_101028273Not Available967Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine28.30%
MarineEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine26.42%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean13.21%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine5.66%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine4.72%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater4.72%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater3.77%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.89%
Marine OceanicEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic1.89%
Background SeawaterEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater1.89%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.89%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.94%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.94%
Hydrothermal Vent FluidsEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids0.94%
Diffuse Hydrothermal Flow Volcanic VentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent0.94%
Diffuse Hydrothermal FluidsEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Fluids0.94%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.94%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002511Marine viral communities from the Pacific Ocean - ETNP_2_1000EnvironmentalOpen in IMG/M
3300002760Marine viral communities from the Pacific Ocean - ETNP_6_1000EnvironmentalOpen in IMG/M
3300003542Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS900_Dependable_DNAEnvironmentalOpen in IMG/M
3300005398Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV201EnvironmentalOpen in IMG/M
3300005514Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263EnvironmentalOpen in IMG/M
3300006076Microbial communities in diffuse hydrothermal fluids of Manus Basin, Bismarck Sea ? fluid AEnvironmentalOpen in IMG/M
3300006090Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP124EnvironmentalOpen in IMG/M
3300006306Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_0500mEnvironmentalOpen in IMG/M
3300006308Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0500mEnvironmentalOpen in IMG/M
3300006310Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_3_0500mEnvironmentalOpen in IMG/M
3300006311Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_1000mEnvironmentalOpen in IMG/M
3300006313Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0770mEnvironmentalOpen in IMG/M
3300006315Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_0770mEnvironmentalOpen in IMG/M
3300006324Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0500mEnvironmentalOpen in IMG/M
3300006325Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0500mEnvironmentalOpen in IMG/M
3300006326Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0770mEnvironmentalOpen in IMG/M
3300006336Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0500mEnvironmentalOpen in IMG/M
3300006338Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_1_0770mEnvironmentalOpen in IMG/M
3300006339Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_3_0500mEnvironmentalOpen in IMG/M
3300006340Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770mEnvironmentalOpen in IMG/M
3300006341Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT236_2_0770mEnvironmentalOpen in IMG/M
3300006344Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0500mEnvironmentalOpen in IMG/M
3300006736Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaGEnvironmentalOpen in IMG/M
3300006738Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaGEnvironmentalOpen in IMG/M
3300006753Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaGEnvironmentalOpen in IMG/M
3300006754Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006900Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_AEnvironmentalOpen in IMG/M
3300006902Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_250_ad_251m_LV_AEnvironmentalOpen in IMG/M
3300006926Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaGEnvironmentalOpen in IMG/M
3300006929Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaGEnvironmentalOpen in IMG/M
3300007758Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample CTDPlume_2015_DNA CLC_assemblyEnvironmentalOpen in IMG/M
3300007963Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2)EnvironmentalOpen in IMG/M
3300008216Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_GeostarEnvironmentalOpen in IMG/M
3300008217Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215EnvironmentalOpen in IMG/M
3300008219Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05EnvironmentalOpen in IMG/M
3300009412Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2EnvironmentalOpen in IMG/M
3300009413Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12EnvironmentalOpen in IMG/M
3300009414Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906EnvironmentalOpen in IMG/M
3300009595Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3635_2500EnvironmentalOpen in IMG/M
3300009602Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231EnvironmentalOpen in IMG/M
3300009603Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904EnvironmentalOpen in IMG/M
3300009604Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16EnvironmentalOpen in IMG/M
3300009619Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3827_250EnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300010155Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaGEnvironmentalOpen in IMG/M
3300017775Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17EnvironmentalOpen in IMG/M
3300020434Marine microbial communities from Tara Oceans - TARA_B100001013 (ERX555944-ERR599071)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021442Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015EnvironmentalOpen in IMG/M
3300021791Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmerEnvironmentalOpen in IMG/M
3300024057 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_9EnvironmentalOpen in IMG/M
3300024517 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3EnvironmentalOpen in IMG/M
3300024518 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2EnvironmentalOpen in IMG/M
3300025049Marine viral communities from the Pacific Ocean - LP-55 (SPAdes)EnvironmentalOpen in IMG/M
3300025050Marine viral communities from the Pacific Ocean - LP-54 (SPAdes)EnvironmentalOpen in IMG/M
3300025052Marine viral communities from the Pacific Ocean - LP-37 (SPAdes)EnvironmentalOpen in IMG/M
3300025069Marine viral communities from the Pacific Ocean - LP-38 (SPAdes)EnvironmentalOpen in IMG/M
3300025109Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025118Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025128Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025264Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 (SPAdes)EnvironmentalOpen in IMG/M
3300025277Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 (SPAdes)EnvironmentalOpen in IMG/M
3300025280Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 (SPAdes)EnvironmentalOpen in IMG/M
3300025301Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 (SPAdes)EnvironmentalOpen in IMG/M
3300025305Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 (SPAdes)EnvironmentalOpen in IMG/M
3300025873Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes)EnvironmentalOpen in IMG/M
3300028018Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 1600mEnvironmentalOpen in IMG/M
3300028022Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750mEnvironmentalOpen in IMG/M
3300028487Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_2000mEnvironmentalOpen in IMG/M
3300031757Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315EnvironmentalOpen in IMG/M
3300031801Marine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986EnvironmentalOpen in IMG/M
3300031802Marine microbial communities from Western Arctic Ocean, Canada - CB6_AW_1057EnvironmentalOpen in IMG/M
3300031803Marine microbial communities from Western Arctic Ocean, Canada - CB27_AW_983EnvironmentalOpen in IMG/M
3300031861Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 3416EnvironmentalOpen in IMG/M
3300031886Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 3416EnvironmentalOpen in IMG/M
3300032130Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 34915EnvironmentalOpen in IMG/M
3300032145Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_1000m_313 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300032278Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MGEnvironmentalOpen in IMG/M
3300032820Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MGEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI25131J35506_100677933300002511MarineMEEEFDSVEKAHNQIQASTKAKVEIVDQRIISSNVKLLKEDKADGLRSKEDKGVGGSSTGTN*
JGI25136J39404_100291243300002760MarineMQKCKKVWRYELVALMEEEFDSVEKAHNQIQASTKAKVEIVDQRIISSNVKLLKEDKADGLRSKKDKGVGGSSTGTNQADV*
FS900DNA_1003053123300003542Diffuse Hydrothermal Flow Volcanic VentMTVAMEQDFDSPELAANQIQPSDKAKVKEITGQRILFSTVKLLKEDKADGLRSKEDKGVRGSSTGTN*
Ga0066858_1006980123300005398MarineMTVVMEQDFDSLELAAKQFLASDKSRVKEITHQRFMSSTVKLLKEDEADGVRSKEGKGA*
Ga0066866_1018278033300005514MarineQDFDSLELAAKQFLASDKSRVKEITHQRFMSSTVKLLKEDEADGVRSKEGKGA*
Ga0081592_107647553300006076Diffuse Hydrothermal FluidsKKVWNLEMTVAMEQDFDSPELAANQIQPSDKAKVKEITSQRILFSAVKLLKEDKADGLRSKEDKGARGSSTGTN*
Ga0082015_100267533300006090MarineMTVIMEQDFDSLELAAKQFLASDKSRVKEITHQRFMSSTVKLLKEDEADGVRSKEGKGA*
Ga0068469_108600923300006306MarineMQKCKKVWNLEMTVAMEQDFDSPELAANQIQPSDKAKVKEITGQRILFSTVKLLKEDKADGLRSKEDKGVRGSSTGTN*
Ga0068470_109461933300006308MarineMTVAMEQDFDSPELAANQIQPSDKAKVKEITGQRILFSTVKLLKEDKTDGLRSKEDKGARGSSTGTN*
Ga0068470_114943523300006308MarineMQKCKKVWRYELVALMEEEFDSVEKAHNQIQASTKAKVEIADQRIVSSNVKLLKEDKADGLRSKEDKGVGGSSTGTN*
Ga0068471_105676053300006310MarineMQKCKKVWNIEMTVAMEQDFDSPELAANQIQPSDKAKVKEITGQRILFSTVKLLKEDKTDGLRSKEDKGARGSSTGTN*
Ga0068471_121739373300006310MarineMQKCKKVWNIEMTVAMEQDFDSPELAANQIQPSDKAKVKEITGQRIIFSTVKLLKEDKADGLRSKENKGVRGSSTGTN*
Ga0068471_157252763300006310MarineKCKKVWNLEMTVAMEQDFDSPELAANQLQPSDKSKVKAITGQRILFSTVKLLKEDKAADGLRSKKNKGVGGTSSGTNQADV*
Ga0068471_158005523300006310MarineMQKCKKVWNLEMTVAMEQDFDSPELAANQIQPSDKAKVKEITGQRIIFSTVKLLKEDKTDGLRSKENKGARGSSTGTN*
Ga0068471_158846033300006310MarineVALMEEEFDSVEKAHNQIQASTKAKVEIVDQRIISSNVKLLKEDKADGLRSKEDKGVGGSGTGTN*
Ga0068478_109841913300006311MarineMQKCKKVWNLEMTVAMEQDFDSPELAANQIQPSDKAKVKEITSQRIVFSTVKLLKEDKADGLRSKKD
Ga0068472_1075921313300006313MarineMQKCKKVWNLEMTVAMEQDFDSPELAANQIQPSDKAKVKEITSQRIIFSNVKLLKEDKADGLRPKEDQGASGSGKKGDQANV
Ga0068487_100417333300006315MarineMSKCKKLWNYEMTVVMEQDFDSPEKAANQHQASDKSRVKEVTSKRFMYSTVKLLKEDKTEDGVRSKKVKELEDEVQKE
Ga0068476_1064988203300006324MarineMQKCKKVWNIEMTVAMEQDFDSPELAANQIQPSDKAKVKEITGQRILFSTVKLLKEDKADGLRSKENKGARGSSTGTN*
Ga0068476_106769523300006324MarineMQKCKKVWRYELVALMEEEFDSVEKAHNQIQASTKAKVEIVDQRIISSNVKLLKEDKADGLRSKEDKGVRGSGTGTN*
Ga0068476_123813933300006324MarineMQKCKKVWNLEMTVAMEQDFDSPELAANQIQPSDKAKVKEITGQRIIFSTVKLLKEDKTDGLRSKENKGARGASTGTN*
Ga0068501_109384913300006325MarineVALMEEEFDSVEKAHNQIQASTKAKVEIVDQRIISSNVKLLKEDKADGLRSKEDKGVGGSSTGTNQADV*
Ga0068501_110905833300006325MarineMQKCKKVWNLEMTVAMEQDFDSPELAANQIQPSDKAKVKEITGQRILFSTVKLLKEDKTDGLRSKEDKGARGSSTGTNKADV*
Ga0068501_126784323300006325MarineMQKCKKVWNLEMTVAMEQDFDSPELAANQIQPSDKAKVKEITGQRILFSTVKLLKEDKADGLRSKENKGARGSSTGTN*
Ga0068477_125991023300006326MarineMKCKKVWNYELAATMEEEFDSVEKAHNQIQASSKAKVKITDQRIIFSNVKLLKEDKADGLRPKEDQGASGSGKKGDQANV*
Ga0068502_112551653300006336MarineMQKCKKVWNLEMTVAMEQDFDSPELAANQIQPSDKAKVKEITGQRILFSTVKLLKEDKADGLRSKEDKGVGGSSTGTNQADV*
Ga0068502_1129600113300006336MarineMQKCKKVWNLEMTVAMEQDFDSPELAANQIQPSDKAKVKEITSQRIIFSTVKLLKEDKADGLRSKENKGVRGSGTGTN*
Ga0068502_114448933300006336MarineMQKCKKVWNLEMTVAMEQDFDSPELAANQIQPSDKAKVKEITGQRILFSTVKLLKEDKTDGLRSKENKGARGSSTGTN*
Ga0068502_119177853300006336MarineMQKCKKVWRYELVALMEEEFDSVEKAHNQIQASTKAKVEIVDQRIISSNVKLLKEDKADGLRSKEDKGVRGSSTGTN*
Ga0068482_118734283300006338MarineMQKCKKVWNLEMTVAMEQDFDSPELAANQIQPSDKAKVKEITGQRIIFSTVKLLKEDKADGLRSKEDKGVGGSSTGTN*
Ga0068482_170235033300006338MarineMKCKKVWNYELAATMEEEFDSVEKAHNQIQASSKAKVKITDQRIIFSNVKLLKEDKADGLRPKEDQG
Ga0068481_149821683300006339MarineMQKCKKVWRYELVALMEEEFDSVEKAHNQIQASTKAKVEIVDQRIVSSNVKLLKEDKADGLRSKEDKGVGGSSTGTN*
Ga0068481_1511501103300006339MarineMQKCKKVWNIEMTVAMEQDFDSPELAANQIQPSDKAKVKEITGQRILFSTVKLLKEDKADGLRSKEDKGVRGSSTGTN*
Ga0068503_1018300923300006340MarineMQKCKKVWNLEMTVAMEQDFDSPELAANQIQPSDKAKVKEITGQRILFSTVKLLKEDKADGLRSKKDKGVGGSSTGTNQADV*
Ga0068503_1032850833300006340MarineVALMEEEFDSVEKAHNQIQASTKAKVEIVDQRIVSSNVKLLKEDKADGLRSKEDKGVGGSSTGTNQADV*
Ga0068503_1051560423300006340MarineMQKCKKVWNLEMTVAMEQDFDSPELAANQIQPSDKAKVKEITGQRIIFSTVKLLKEDKADGLRSKENKGVGGSSTGTNQADV*
Ga0068503_1056901413300006340MarineMQKCKKVWNLEMTVAMEQDFDSPELAANQFQPSDKSKVKAITGQRILFSTVKLLKEDKTDGLRSKENKGARGSSTGTN*
Ga0068493_1022831733300006341MarineMQKCKKVWNLEMTVAMEQDFDSPELAANQIQPSDKAKVKEITGQRIIFSTVKLLKEDKADGLRSKEDKGVGGSSTGTNQADV*
Ga0068493_1029170833300006341MarineMQKCKKVWRYELVALMEEEFDSVEKAHNQIQASTKAKVEIVDQRIVSSNVKLLKEDKADGLRSKKDKGVGGSSTGTNQADV*
Ga0099695_106671843300006344MarineMQKCKKVWNLEMTVAMEQDFDSPELAANQIQPSDKAKVKEITSQRIIFSTVKLLKEDKADGLRSKEDKGARGSSTGTN*
Ga0098033_113147213300006736MarineMQKCKKVWNIEMTVAMEQDFDSPELAANQLQPSDKAKVKAITGQRILFSTVKLLKEDKTDGLRSKENKGARGSSTGTN*
Ga0098035_107034843300006738MarineMQKCKKVWNIEMTVAMEQDFDSPELAANQLQPSDKSKVKAITGQRILFSTVKLLKEDKADGLRSKENKGARGSSTGTN*
Ga0098039_104730123300006753MarineMQKCKKVWNLEMTVAMEQDFDSPELAANQIQPSDKAKVKAITGQRILFSTVKLLKEDKTDGLRSKENKGVGGTSSGTN*
Ga0098044_123421813300006754MarineMEQDFESPELAANQFQPSDKAKVKEITGQRIIFSTVKLLKEDKTDGLRSKENKGARGSSTGTN*
Ga0098054_111237033300006789MarineMQKCKKLWNLEITVTMEQDFDSPELAANQIQPSDKAKVKEITGQRIIFSTVKLLKEDKADGLRSKENKGVGGTSSGTN*
Ga0066376_1042470723300006900MarineMKCKKVWNYELAATMEEEFDSVEKAHNQIQASSKAKVKITDQRIVFSNVKLLKEDKADGLRPKEDQGASGSGKKGDQANV*
Ga0066372_1009653823300006902MarineMQKCKKVWNLEMTVAMEQDFDSPELAANQLQPSDKSKVKAITGQRILFSTVKLLKEDKTDGLRSKENKGARGSSTGTN*
Ga0098057_110616413300006926MarineMQKCKKVWNIEMTVVMEQDFDSPELAANQFQPSDKAKVKEITGQRIIFSTVKLLKEDKADGLRSKENKGVGGTSSGTN*
Ga0098036_1001451223300006929MarineMSKCKKLWNYEMTVVMEQDFDSPEKAANQHQASDKSRVKEVTSKRFMYSTVKLLKEDKTEDGVRSEKNKRT*
Ga0098036_102736453300006929MarineMQKCKKVWNIEMTVAMEQDFDSPELAANQIQPSDKAKVKEITGQRIIFSTVKLLKEDKADGLRSKKNKGVGGTSSGTN*
Ga0105668_114307343300007758Background SeawaterMQKCKKVWRCELVALMEEEFDSVEKAHNQIQASTKAKVEIVDQRIVSSNVKLLKEDKADGLRSKEDKGVRGSGTGTN*
Ga0105668_116945233300007758Background SeawaterMTVAMEQDFDSPELAANQIQPSDKAKVKEITGQRILFSTVKLLKEDKADGLRSKEDKGVGGSSAGTN*
Ga0110931_109198513300007963MarineMQKCKKVWNIEMTVAMEQDFDSPELAANQFQPSDKAKVKEITGQRIIFSTVKLLKEDKADGLRSKENKGARGSSTGTN*
Ga0110931_118211533300007963MarineQKCKKVWNIEMTVAMEQDFDSPELAANQLQPSDKSKVKEITGQRIIFSTVKLLKEDKTADGLRSKKNKGVGGTSSGTN*
Ga0114898_101658533300008216Deep OceanMTVAMEQDFDSPELAANQLQPSDKAKVKAITGQRILFSTVKLLKEDKTDGLRSKENKGARGSSTGTNQTDV*
Ga0114899_100471333300008217Deep OceanMTVAMEQDFDSPELAANQLQPSDKSKVKEITGQRIIFSTVKLLKEDKTADGLRSKKNKGVGGTSSGTN*
Ga0114905_104713913300008219Deep OceanIMQKCKKVWNIEMTVAMEQDFDSPELAANQLQPSDKSKVKEITGQRIIFSTVKLLKEDKTADGLRSKKNKGVGGTSSGTN*
Ga0114903_102931333300009412Deep OceanMTVAMEQDFDSPELAANQLQPSDKSKVKEITGQRIIFSTVKLLKEDKTADGLRSKKNKGVGGTSSGTNQADV*
Ga0114902_107782633300009413Deep OceanMQKCKKVWNIEMTVAMEQDFDSPELAANQLQPSDKAKVKAITGQRILFSTVKLLKEDKTADGLRSKKNKGVGGTSSGTN*
Ga0114909_103676733300009414Deep OceanMQKCKKVWDLEMTVAMEQDFDSPELAANQLQPSDKSKVKAITGQRILFSTVKLLKEDKAADGLRSKKNKGVGGTSSGTNQADV*
Ga0105214_10901023300009595Marine OceanicMQKCKKVWRYELVALMEEEFDSVEKAHNQIQASTKAKVEIVDQRIISSNVKLLKEDKADGLRSKEDKGVGGSSTGTN*
Ga0114900_103084923300009602Deep OceanMQKCKKFWNYEMTVVMEQEFDNVEDAANQIQASDKSKVREISGQRILFSTVKLLKEDKTADGLRSKKNKGVGGTSSGTNQADV*
Ga0114911_105892643300009603Deep OceanMTVAMEQDFDSPELAANQLQPSDKAKVKAITGQRIIFSTVKLVKEDKTADGLRSKKNKGVGGTSSGTN
Ga0114901_104537253300009604Deep OceanFDSPELAANQFQPSDKAKVKAITGQRIIFSTVKLLKEDKAADGLRSKKNKGVGGTSSGTN
Ga0105236_102727923300009619Marine OceanicMTVAMEQDFDSPELAANQLQPSDKAKVKEITSQRIIFSTVKLLKEDKADGLRSKENKGARGSSTGTN*
Ga0098059_113204133300010153MarineMTVAMEQDFDSPELAANQFQPSDKAKVKEITGQRIIFSTVKLLKEDKADGLRSKENKGARGSSTGTN*
Ga0098047_1041029723300010155MarineMQKCKKLWNLEITVTMEQDFDSPELAANQIQPSDKAKVKEITSQRIIFSTVKLLKEDKADGLRSKENKGVGGTSSGTN*
Ga0181432_115032333300017775SeawaterMQKCKKVWRYELVALMEEEFDSVEKAHNQIQASSKAKVKITDQRIIFSNVKLLKEDKADGLRPKEDQGASGSGKKG
Ga0211670_1008629513300020434MarineMQKCKKVWNLEMTVAMEQDFDSPELAANQFQPSDKAKVKAITGQRILFSTVKLLKEDKADGLRSKEDKGARGSSTGTN
Ga0206688_1001630733300021345SeawaterMTVAMEQDFDSPELAANQIQPSDKAKVKEITGQRILLSTVKLLKEDKTDGLRSKEDKGARGSGTGTN
Ga0206685_1004751423300021442SeawaterMQKCKKVWNIEMTVAMEQDFDSPELAANQIQPSDKAKVKEITGQRILFSTVKLLKEDKTDGLRSKEDKGARGSSTGTN
Ga0226832_10004173143300021791Hydrothermal Vent FluidsMQKCKKVWNLEMTVAMEQDFDSPELAANQLQPSDKSKVKAITGQRILFSTVKLLKEDKAADGLRSKKNKGVGGTSSGTNQADV
(restricted) Ga0255051_1005841723300024057SeawaterMQKCKKVWNLEMTVAMEQDFDSPELAANQLQPSDKAQVKAITGQRILFSTVKLLKEDKADGLRSKENKGARGSSTGTN
(restricted) Ga0255049_1012652133300024517SeawaterMQKCTKVWNIELTAVMEQDFDSVEEAANQLEASDKSRVKEISGQRTVFSTVKLLKEDKVDGLRSKKDKGVGGSSTK
(restricted) Ga0255048_1000125293300024518SeawaterMQKCTKVWNIELTAVMEQDFDNVEEAANQLEASDKSRVKEISGQRTVFSTVKLLKEDKVDGLRSKKDKGVGGSSTK
(restricted) Ga0255048_1009021713300024518SeawaterMQKCKKVWNLEMTVAMEQDFDSPELAANQLQPSDKAKVKAITGQRILFSTVKLLKEDKTDGLRSKEDKGARGSSTGTN
Ga0207898_100140453300025049MarineMKCKKVWNYELAATMEEEFDSVERAHNQIQASSKAKVKITDQRIVFSNVKLLKEDKADGLRSKEDKGVGGSSTGTN
Ga0207892_101556733300025050MarineMQKCKKLWNLEITVTMEQDFDSPELAANQIQPSDKAKVKEITSQRIIFSTVKLLKEDKADGLRSKEDKGVGGSSTGTNQADV
Ga0207906_101732933300025052MarineMTVAMEQDFDSPELAANQLQPSDKSKVKAITGQRILFSTVKLLKEDKADGLRSKEDKGARGSGTGTN
Ga0207887_104437423300025069MarineMQKCKKVWNLEMTVAMEQDFDSPELAANQIQPSDKAKVKEITGQRIIFSTVKLLKEDKADGLRSKEDKGVGGSSTGTN
Ga0208553_1003286133300025109MarineMTVVMEQDFDSLELAAKQFLASDKSRVKEITHQRFMSSTVKLLKEDEADGVRSKEGKGA
Ga0208790_1003048143300025118MarineMTVIMEQDFDSLELAAKQFLASDKSRVKEITHQRFMSSTVKLLKEDEADGVRSKEGKGA
Ga0208919_1006955113300025128MarineMSKCKKLWNYEMTVVMEQDFDSPEKAANQHQASDKSRVKEVTSKRFMYSTVKLLKEDKTEDGVRSEKNKRT
Ga0208919_111311733300025128MarineMQKCKKVWNIEMTVAMEQDFDSPELAANQFQPSDKAKVKEITGQRIIFSTVKLLKEDKADGLRSKENKGARGSSTGTN
Ga0208029_108733523300025264Deep OceanMQKCKKVWNIEMTVAMEQDFDSPELAANQLQPSDKSKVKEITGQRIIFSTVKLLKEDKTADGLRSKKNKGVGGTSSGTN
Ga0208180_106479813300025277Deep OceanVWNIEMTVAMEQDFDSPELAANQFQPSDKAKVKAITGQRIIFSTVKLLKEDKAADGLRSKKNKGVGGTSSGTN
Ga0208449_103351933300025280Deep OceanMTVAMEQDFDSPELAANQLQPSDKSKVKEITGQRIIFSTVKLLKEDKTADGLRSKKNKGVGGTSSGTN
Ga0208450_109023233300025301Deep OceanMQKCKKVWNLEMTVAMEQDFDSPELAANQLQPSDKSKVKEITGQRIIFSTVKLLKEDKTADGLRSKKNKGVGGTSSGTNQADV
Ga0208684_105307343300025305Deep OceanMQKCKKVWNIEMTVAMEQDFDSPELAANQLQPSDKSKVKEITGQRIIFSTVKLLKEDKTADGLRSKKNKGVGGTSSGTNQADV
Ga0209757_1007227333300025873MarineMKCKKVWNYELAATMEEEFDSVEKAHNQIQASSKAKVKITDQRIIFSNVKLLKEDKADGLRPKEDQGASGSGKKGDQANV
Ga0209757_1031062823300025873MarineMTVIMEQDFDSLELAAKQFLASDKSRVKEITHQRFMSSTVKLLKEDGADGVRSKEGKGA
Ga0256381_101241823300028018SeawaterMQKCKKVWNLEMTVAMEQDFDSPELAANQLQPSDKSKVKAITGQRILFSTVKLLKEDKTDGLRSKENKGARGSSTGTN
Ga0256382_112053713300028022SeawaterMSKCKKLWNYEMTVVMEQDFDSPEKAANQHQASDKSRVKEVTSKRFMYSTVKLLKEDKTEDGVRSEKSKRT
Ga0257109_116455633300028487MarineMRCKKVWNLEMTVAMEQDFDSPELAANQIQPSDKAKVKEITGQRILFSTVKLLKEDKADGLRSKEDKGVRGSGTGTN
Ga0315328_1011458743300031757SeawaterMQKCKKLWNLEISVTMEQDFDSPELAANQIQPSDKAKVKEITGQRILFSTVKLLKEDKTDGLRSKEDKGARGSSTGTN
Ga0310121_1008071023300031801MarineMQKCKKVWNLEMTVAMEQDFDSPELAANQIQPSDKAKVKEITGQRIIFSTVKLLKEDKADGLRSKEDKGARGSSTGTN
Ga0310121_1023515333300031801MarineMQKCTKVWNIELTAVMEQDFDSVEEAANQLEASDKSRVKEISNQRTVFSTVKLLKEDKADGLRSKKDKGVGGSSTGTNQADV
Ga0310121_1059868623300031801MarineMQKCKKVWRYELVALMEEEFDSVEKAHNQIQASTKAKVEIVDQRIISSNVKLLKEDKADGLRSKEDKGVRGSSTGTN
Ga0310123_1029974353300031802MarineMRCKKVWNLEMTVAMEQDFDSPELAANQIQPSDKAKVKEITGQRIIFSTVKLLKEDKADGLRSKEDKGVG
Ga0310120_1011636143300031803MarineMRCKKVWNLEMTVAMEQDFDSPELAANQIQPSDKAKVKEITGQRIIFSTVKLLKEDKADGLRSKEDKGARGSSTGTN
Ga0315319_1011006433300031861SeawaterMEEEFDSVEKAHNQIQASTKAKVEIVDQRIISSNVKLLKEDKADGLRSKEDKGVRGSGTGTN
Ga0315318_1027860033300031886SeawaterMTVAMEQDFDSPELAANQIQPSDKAKVKEITGQRILFSTVKLLKEDKTDGLRSKEDKGARGSSTGTN
Ga0315333_1007943653300032130SeawaterMQKCKKLWNLEISVTMEQDFDSPELAANQIQPSDKAKVKEITGQRILFSTVKLLKEDKTDGLRSKENKGARGSSTGTN
Ga0315304_121446513300032145MarineKKVWNYELAATMEEEFDSVEKAHNQIQASTKAKVEIVDQRIVSSNVKLLKEDKADGLRSKEDKGVRGSGTGTN
Ga0310345_1091769013300032278SeawaterKVWNLEMTVAMEQDFDSPELAANQIQPSDKAKVKEITGQRILFSTVKLLKEDKTDGLRSKEDKGARGSSTGTN
Ga0310342_10102827333300032820SeawaterMQKCKKVWNLEMTVAMEQDFDSPELAANQIQPSDKAKVKEITGQRILFSTVKLLKEDKADGLRSKEDKGVGGSSTGTNQADV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.