| Basic Information | |
|---|---|
| Family ID | F093956 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 43 residues |
| Representative Sequence | FLSEKPERAQIYESFLAFVPGIAGAYGGAVGRGVVDNLFAGK |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 83.96 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.113 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (16.038 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.340 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.170 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.14% β-sheet: 0.00% Coil/Unstructured: 52.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF12706 | Lactamase_B_2 | 20.75 |
| PF00753 | Lactamase_B | 16.98 |
| PF00069 | Pkinase | 5.66 |
| PF08327 | AHSA1 | 4.72 |
| PF07676 | PD40 | 4.72 |
| PF00440 | TetR_N | 4.72 |
| PF12840 | HTH_20 | 3.77 |
| PF14534 | DUF4440 | 2.83 |
| PF13181 | TPR_8 | 1.89 |
| PF02517 | Rce1-like | 1.89 |
| PF00557 | Peptidase_M24 | 1.89 |
| PF03572 | Peptidase_S41 | 0.94 |
| PF02012 | BNR | 0.94 |
| PF01212 | Beta_elim_lyase | 0.94 |
| PF13304 | AAA_21 | 0.94 |
| PF09844 | DUF2071 | 0.94 |
| PF00132 | Hexapep | 0.94 |
| PF00905 | Transpeptidase | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 22.64 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 1.89 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 1.89 |
| COG1167 | DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain | Transcription [K] | 1.89 |
| COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 0.94 |
| COG4992 | Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase | Amino acid transport and metabolism [E] | 0.94 |
| COG3033 | Tryptophanase | Amino acid transport and metabolism [E] | 0.94 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.94 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.94 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.94 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.94 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.94 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.94 |
| COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 0.94 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.94 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.94 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.94 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.94 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.94 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.94 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.06 % |
| Unclassified | root | N/A | 0.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10129492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1003 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101409836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300003219|JGI26341J46601_10217790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300005440|Ga0070705_101757513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300005555|Ga0066692_10042092 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2494 | Open in IMG/M |
| 3300005555|Ga0066692_10210293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1220 | Open in IMG/M |
| 3300005591|Ga0070761_10111639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1582 | Open in IMG/M |
| 3300005610|Ga0070763_10682798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300006052|Ga0075029_100438953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 854 | Open in IMG/M |
| 3300006162|Ga0075030_100110073 | All Organisms → cellular organisms → Bacteria | 2243 | Open in IMG/M |
| 3300006162|Ga0075030_100628735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 851 | Open in IMG/M |
| 3300006354|Ga0075021_10365902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 900 | Open in IMG/M |
| 3300006893|Ga0073928_10152978 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1858 | Open in IMG/M |
| 3300009088|Ga0099830_10549508 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300009520|Ga0116214_1338025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300009523|Ga0116221_1017601 | All Organisms → cellular organisms → Bacteria | 3849 | Open in IMG/M |
| 3300009523|Ga0116221_1184192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 906 | Open in IMG/M |
| 3300009549|Ga0116137_1154714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300009635|Ga0116117_1093279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300009641|Ga0116120_1023268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2246 | Open in IMG/M |
| 3300009641|Ga0116120_1173346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
| 3300009645|Ga0116106_1017030 | All Organisms → cellular organisms → Bacteria | 2579 | Open in IMG/M |
| 3300009665|Ga0116135_1132919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae | 920 | Open in IMG/M |
| 3300009683|Ga0116224_10098604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1417 | Open in IMG/M |
| 3300009700|Ga0116217_10428078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 837 | Open in IMG/M |
| 3300009824|Ga0116219_10629785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300009839|Ga0116223_10077086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2133 | Open in IMG/M |
| 3300010339|Ga0074046_10024088 | All Organisms → cellular organisms → Bacteria | 4222 | Open in IMG/M |
| 3300010359|Ga0126376_10848395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 897 | Open in IMG/M |
| 3300010379|Ga0136449_100719987 | All Organisms → cellular organisms → Bacteria | 1669 | Open in IMG/M |
| 3300010379|Ga0136449_102068741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 837 | Open in IMG/M |
| 3300011270|Ga0137391_11000422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 680 | Open in IMG/M |
| 3300012205|Ga0137362_11747521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 509 | Open in IMG/M |
| 3300012363|Ga0137390_10894040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 843 | Open in IMG/M |
| 3300012582|Ga0137358_10622972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 723 | Open in IMG/M |
| 3300012917|Ga0137395_10393494 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300012923|Ga0137359_10739220 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300014200|Ga0181526_10827417 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300014493|Ga0182016_10107013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1966 | Open in IMG/M |
| 3300014638|Ga0181536_10059766 | All Organisms → cellular organisms → Bacteria | 2418 | Open in IMG/M |
| 3300016750|Ga0181505_10472282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300017938|Ga0187854_10132718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1142 | Open in IMG/M |
| 3300017938|Ga0187854_10383240 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300017941|Ga0187850_10394479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300017966|Ga0187776_10960748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300018003|Ga0187876_1162194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 773 | Open in IMG/M |
| 3300018017|Ga0187872_10358573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300018021|Ga0187882_1035965 | All Organisms → cellular organisms → Bacteria | 2490 | Open in IMG/M |
| 3300018023|Ga0187889_10104221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1398 | Open in IMG/M |
| 3300018033|Ga0187867_10477588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300018033|Ga0187867_10805921 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300018034|Ga0187863_10519968 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300018037|Ga0187883_10067502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1881 | Open in IMG/M |
| 3300018038|Ga0187855_10029304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3533 | Open in IMG/M |
| 3300018040|Ga0187862_10825121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300018043|Ga0187887_10257007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae | 1034 | Open in IMG/M |
| 3300018047|Ga0187859_10664823 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300018057|Ga0187858_10109886 | All Organisms → cellular organisms → Bacteria | 1874 | Open in IMG/M |
| 3300018086|Ga0187769_10514433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 903 | Open in IMG/M |
| 3300018086|Ga0187769_10737577 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300018088|Ga0187771_11329760 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300018090|Ga0187770_11496721 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300019787|Ga0182031_1231639 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300021168|Ga0210406_10028635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5064 | Open in IMG/M |
| 3300021170|Ga0210400_11404572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300021171|Ga0210405_10447956 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300021432|Ga0210384_10210961 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1747 | Open in IMG/M |
| 3300022524|Ga0224534_1009858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3031 | Open in IMG/M |
| 3300022533|Ga0242662_10010906 | All Organisms → cellular organisms → Bacteria | 1846 | Open in IMG/M |
| 3300023250|Ga0224544_1032655 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300026294|Ga0209839_10112529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 922 | Open in IMG/M |
| 3300026294|Ga0209839_10216750 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300027497|Ga0208199_1045216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 946 | Open in IMG/M |
| 3300027583|Ga0209527_1065186 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300027619|Ga0209330_1128836 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 573 | Open in IMG/M |
| 3300027648|Ga0209420_1136333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300027767|Ga0209655_10244251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300027829|Ga0209773_10317681 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300027857|Ga0209166_10587805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300027911|Ga0209698_10318848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1227 | Open in IMG/M |
| 3300028566|Ga0302147_10001021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 12827 | Open in IMG/M |
| 3300028780|Ga0302225_10304515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
| 3300029903|Ga0247271_105726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2188 | Open in IMG/M |
| 3300029952|Ga0311346_10020914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10455 | Open in IMG/M |
| 3300029990|Ga0311336_10635959 | Not Available | 912 | Open in IMG/M |
| 3300030054|Ga0302182_10234242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 781 | Open in IMG/M |
| 3300030294|Ga0311349_10031450 | All Organisms → cellular organisms → Bacteria | 4807 | Open in IMG/M |
| 3300030659|Ga0316363_10069124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1627 | Open in IMG/M |
| 3300030687|Ga0302309_10590729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300030991|Ga0073994_10036775 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300030991|Ga0073994_12190241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 693 | Open in IMG/M |
| 3300031525|Ga0302326_10696244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1487 | Open in IMG/M |
| 3300031525|Ga0302326_12318181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
| 3300031718|Ga0307474_10937543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
| 3300031902|Ga0302322_100741754 | All Organisms → cellular organisms → Archaea → TACK group | 1167 | Open in IMG/M |
| 3300031954|Ga0306926_11695075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 721 | Open in IMG/M |
| 3300032180|Ga0307471_101426143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 852 | Open in IMG/M |
| 3300032261|Ga0306920_101693863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 896 | Open in IMG/M |
| 3300032261|Ga0306920_103082419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300032782|Ga0335082_10959217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 719 | Open in IMG/M |
| 3300032892|Ga0335081_10113703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3982 | Open in IMG/M |
| 3300032892|Ga0335081_11628196 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300033433|Ga0326726_11013019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 807 | Open in IMG/M |
| 3300033982|Ga0371487_0135073 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1248 | Open in IMG/M |
| 3300034125|Ga0370484_0167553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300034282|Ga0370492_0254015 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 16.04% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 11.32% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.60% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 5.66% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.72% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.72% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.77% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.83% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.83% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.83% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.89% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.89% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.89% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.89% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.89% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.89% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.94% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.94% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009549 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 | Environmental | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300022524 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 20-24 | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028566 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300029903 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703 | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030687 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033982 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fraction | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_101294922 | 3300000567 | Peatlands Soil | VPVVEWLAYFLLSQKPDRAQVYESFLAFVPGIAGAYGGAMGRSVVDNLFTGK* |
| JGIcombinedJ26739_1014098362 | 3300002245 | Forest Soil | YFLAQKPDRAQIYESFLAFVPGIAGAFGGSVGRTVIDNLFAKK* |
| JGI26341J46601_102177901 | 3300003219 | Bog Forest Soil | LSEKPERAQIYESFLAFVPGIAGAYGGAVGRGVVENLFPKK* |
| Ga0070705_1017575131 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | AQKPERAQIYESFLAFLPGIVGAYSGAFGRGVVNNLLANK* |
| Ga0066692_100420921 | 3300005555 | Soil | LAYFVLSQKPERAQIYESFLAFLPGIAGAFGGALGRGLVDNLFAGK* |
| Ga0066692_102102931 | 3300005555 | Soil | ERAQIYESFLAFLPGTVGAYSGAFGRGVVNNLLANK* |
| Ga0070761_101116391 | 3300005591 | Soil | RAQIYESFLAFVPGIAGAYGASIGRNVVDNLFAKK* |
| Ga0070763_106827982 | 3300005610 | Soil | PIVDGLAYVFLSQKPERAQVYESFLAFLPGIAGAVGGAVGRGVVDNLFVKK* |
| Ga0075029_1004389531 | 3300006052 | Watersheds | PERAQIYESFLAFMPGIAGAFGGAMARGVVDNLFKKK* |
| Ga0075030_1001100734 | 3300006162 | Watersheds | SQKPERAQIYESFLAFIPGIAGAFGGSIGRGVVDNLFAGK* |
| Ga0075030_1006287351 | 3300006162 | Watersheds | KPERAQIYESFLAFVPGIAGAYGGAVGRGVVDNLFVKK* |
| Ga0075021_103659022 | 3300006354 | Watersheds | LSQKPMPAQIYESFLAFLPGIAGAYGGAMGRGVVNNLFPNK* |
| Ga0073928_101529781 | 3300006893 | Iron-Sulfur Acid Spring | PERAQIYESFLAFVPGIAGAFGGAMGRVLIDNLFARK* |
| Ga0099830_105495082 | 3300009088 | Vadose Zone Soil | AYFFLSQKPERAQIYESFLAFLPGIAGAFGGAMGRGLVDNLFAGK* |
| Ga0116214_13380252 | 3300009520 | Peatlands Soil | FLSEKPERAQIYESFLAFVPGIAGAYGGAVGRGVVDNLFAGK* |
| Ga0116221_10176011 | 3300009523 | Peatlands Soil | QKPERAQIYESFLAFLPGIAGAYGGAAGRDVVDKLFAGK* |
| Ga0116221_11841922 | 3300009523 | Peatlands Soil | LAYFFLSQKPGRAQIYESFLAFMPGIAGAFGGSIGRGVVDKLLTGK* |
| Ga0116137_11547141 | 3300009549 | Peatland | RAQIYESFLAFVPGIAGAFGGSVGRGVVDNLFGKK* |
| Ga0116117_10932792 | 3300009635 | Peatland | PVVEWLAYWFLTQKPERAQIYESFLAFLPGIAGAFGGSISRGVVDNLFGKK* |
| Ga0116120_10232681 | 3300009641 | Peatland | KPERAQIYESFLAFVPGIAGAFGGAMGRGVVDNLFARK* |
| Ga0116120_11733462 | 3300009641 | Peatland | VMEWLAYFFLSEKPPRAQIYESFLAFMPGIAGAYGGAAGRGVVDNLFAGK* |
| Ga0116106_10170301 | 3300009645 | Peatland | RAQIYESFLAFVPGIAGAYGGSIGRGVVDNLFAGK* |
| Ga0116135_11329191 | 3300009665 | Peatland | TRAQVYESFLGFVPGIAGAYGGAIGRGVVDNLSANK* |
| Ga0116224_100986042 | 3300009683 | Peatlands Soil | YFFLSQKPGRAQIYESFLAFMPGIAGAFGGSIGRGVVDKLLTGK* |
| Ga0116217_104280782 | 3300009700 | Peatlands Soil | AYFLLSQKPDRAQVYESFLAFVPGIAGAYGGAMGRSVVDNLFTGK* |
| Ga0116219_106297852 | 3300009824 | Peatlands Soil | VPLVDWLAYFFLSQKPGRAQIYESFLAIMPGIAGAFGGSIGRGVVDKLLTGK* |
| Ga0116223_100770861 | 3300009839 | Peatlands Soil | PTRAQIYESFLAFVPGIAGAFGGSVARGVIDNLFGKK* |
| Ga0074046_100240886 | 3300010339 | Bog Forest Soil | AQIYESFLAFLPGIAGAFGGAIGRGVVDNLFAGK* |
| Ga0126376_108483952 | 3300010359 | Tropical Forest Soil | RFLHQHLDRAQIYESYLAFMPGIAGAFGGSLGRGVVNNLFPTK* |
| Ga0136449_1007199873 | 3300010379 | Peatlands Soil | RAQIYESFLAFVPGIAGAYGGAVGRGVVDNLFAGK* |
| Ga0136449_1020687412 | 3300010379 | Peatlands Soil | PVVEWLAYFFLSEKPPRAQIYESFLAFMPGIAGAYGGAVGRGVVDNLFAGK* |
| Ga0137391_110004222 | 3300011270 | Vadose Zone Soil | VPVVEWLAYFFLSQKPARAQIYESFLAFLPGIAGAFGGAMGRGLVDNLFAGK* |
| Ga0137362_117475211 | 3300012205 | Vadose Zone Soil | VFVPVVEWLAYFFLSQKPERAQIYESFLAFLPGIAGAFGGALGRGLVDNLFAGK* |
| Ga0137390_108940401 | 3300012363 | Vadose Zone Soil | LVEWLAYFLLKQKPERAQIYESFLAFLPGIAGAYGGALGRGVVENLFPGK* |
| Ga0137358_106229721 | 3300012582 | Vadose Zone Soil | KPQRAQIYESFLAFVPGIAGAFGGAMGRGLVDNLFAKK* |
| Ga0137395_103934942 | 3300012917 | Vadose Zone Soil | WLAYFFLSQTPERAQIYESFLAFLPGIAGAFGGALGRGLVDNLFAGK* |
| Ga0137359_107392202 | 3300012923 | Vadose Zone Soil | FLSQKPERAQIYESFLAFLPGIAGAFGGALGRSLVDNLLTGK* |
| Ga0181526_108274171 | 3300014200 | Bog | FFLTEKPTRAQVYESFLGFVPGIAGAYGGAIARGVVDNLFPKK* |
| Ga0182016_101070132 | 3300014493 | Bog | EWLAYWFLTEKPERAQIYESFLAFLPGIAGAYGGAVARNVVDNLFARK* |
| Ga0181536_100597664 | 3300014638 | Bog | AYFFLSEKPERAQIYESFLAFVPGIAGAFGGSIGRGVVDNLFAGK* |
| Ga0181505_104722822 | 3300016750 | Peatland | VGWLAYFFLSQKPQRAQIYESFLAFMPGIAGAFGGSIGRGVVNNLFAGK |
| Ga0187854_101327181 | 3300017938 | Peatland | RAQIYGSLRAFVTGMGGAFGGAMGRSVVDNLFARK |
| Ga0187854_103832401 | 3300017938 | Peatland | KPERAQIYESFLAFLPGIAGAFGGSISRGVVDNLFGKK |
| Ga0187850_103944791 | 3300017941 | Peatland | PERAQIYESFLAFVPGIAGAYGAAVGRGVVDNLFAKK |
| Ga0187776_109607482 | 3300017966 | Tropical Peatland | VEWLAYLLLSQKPQPAQIYESFLAFLPGIAGAYGGAFGRGVVDNLFPGKG |
| Ga0187876_11621942 | 3300018003 | Peatland | PDRAQIYESFLAFVPGIAGAFGGAMGRGVVDNLFARK |
| Ga0187872_103585732 | 3300018017 | Peatland | WLAYFFLSEKPPRAQIYESFLAFMPGIAGAYGGAAGRGVVDNLFAGK |
| Ga0187882_10359654 | 3300018021 | Peatland | YFLSEKPERAQIYESFLAFVPGIAGAYGAAVGRGVVDNLFAKK |
| Ga0187889_101042213 | 3300018023 | Peatland | AYFFLSEKPPRAQIYESFLAFMPGIAGAYGGAAGRGVVDNLFAGK |
| Ga0187867_104775881 | 3300018033 | Peatland | RAQIYESFLAFVPGIAGAYGGSIGRGVVDNLFAGK |
| Ga0187867_108059212 | 3300018033 | Peatland | WLAYYFLSEKPTRAQIYESFLAFVPGIAGAFGGSVARGVVDNLFGKK |
| Ga0187863_105199682 | 3300018034 | Peatland | TRAQIYESFLAFVPGIAGAFGGSVARGVVDNLFGKK |
| Ga0187883_100675021 | 3300018037 | Peatland | FLSQKPDRAQIYESFLAFVPGIAGAFGGSVGRGVVDNLFAGK |
| Ga0187855_100293045 | 3300018038 | Peatland | FLSEKPTRAQIYESFLAFVPGIAGAFGGSVARGVVDNLFGKK |
| Ga0187862_108251212 | 3300018040 | Peatland | VEWLAYYFLSEKPTRAQIYESFLAFVPGIAGAFGGSIGRGVVDNLFAGK |
| Ga0187887_102570073 | 3300018043 | Peatland | LAYFFLTEKPTRAQVYESFLGFVPGIAGAYGGAIGRGVVDNLSANK |
| Ga0187859_106648231 | 3300018047 | Peatland | EWLAFFYLSEKPSRAQIYESFLAFMPGVAGAYGGSIGRGVVDNLFAGK |
| Ga0187858_101098864 | 3300018057 | Peatland | VEWLAYWFLTQKPERAQIYESFLAFLPGIAGAFGGSISRGVVDNLFGKK |
| Ga0187769_105144333 | 3300018086 | Tropical Peatland | VPVVEWLAYYFLSEKPTRAQVYESFLAFVPGIAGAFGGSVARGVVDNLYGKK |
| Ga0187769_107375773 | 3300018086 | Tropical Peatland | YRAQVYESFLAFLPGIAGAVGGAVGRGVVDNLFPKK |
| Ga0187771_113297602 | 3300018088 | Tropical Peatland | EWLAYFFLSQKPDRAQVYESFLAFLPGIAGAVGGAVGRGVVENLFRKK |
| Ga0187770_114967211 | 3300018090 | Tropical Peatland | RVQVYESFLAFLPGIAGAVGGAVGRGVVDNLFPKK |
| Ga0182031_12316392 | 3300019787 | Bog | WLAYWFLTQKPERAQIYESFLAFLPGIAGAFGGSISRGVVDNLFGKK |
| Ga0210406_100286358 | 3300021168 | Soil | FVPVVEWLAYFYLSQKPQRAQIYESFLAFLPGIAGAFGGALGRGLVDNLFAGE |
| Ga0210400_114045721 | 3300021170 | Soil | QKPGRAQIYESFLAFLPGIAGAFGGAMGRGLVDNLFAGK |
| Ga0210405_104479561 | 3300021171 | Soil | YFFLSQKPGRAQIYESFLAFLPGIAGAFGGAMGRGLVDNLFSGK |
| Ga0210384_102109612 | 3300021432 | Soil | FLTQKPERAQVYESFLAFLPGIAGAFGGSVGRGVVDNLFAKK |
| Ga0224534_10098585 | 3300022524 | Soil | LAYFFLSEKPERAQIYESFLAFVPGIAGAFGGSIGRGVVDNLFAGK |
| Ga0242662_100109061 | 3300022533 | Soil | PVVEWLAYFFLSQKPERAQIYESFLAFLPGIAGAFGGAIGRGLVDNLFAGK |
| Ga0224544_10326551 | 3300023250 | Soil | SEKPGRAQIYESFLAFVPGIAGAYGAAVGRNVFDNLFAKK |
| Ga0209839_101125291 | 3300026294 | Soil | PLVEWLAFAFLTQKPERAQIYESFLAFLPGIAGAYGGAMGRGVVDNLFAKK |
| Ga0209839_102167501 | 3300026294 | Soil | EWLAYYFLSEKPARAQIYESFLAFVPGIAGAYGGAVGRGVVDNLFPKK |
| Ga0208199_10452162 | 3300027497 | Peatlands Soil | SEKPERAQIYESFLAFVPGIAGAYGGAVGRGVVDNLFAGK |
| Ga0209527_10651861 | 3300027583 | Forest Soil | LTEKPYRAQIYESFLAFLPGIAGAFGGAMGRGLVDNLFAGK |
| Ga0209330_11288363 | 3300027619 | Forest Soil | PTRAQIYESFLAFLPGIAGAVGGALARTVLNNLFAKN |
| Ga0209420_11363331 | 3300027648 | Forest Soil | DWMAYYFFSQKPGRAQIYESLLAFVPGIAGAYGGSAGRNVLNNLYVNK |
| Ga0209655_102442512 | 3300027767 | Bog Forest Soil | EKPERAQIYESFLAFVPGIAGAYGAAVGRGVVDNLFGKK |
| Ga0209773_103176812 | 3300027829 | Bog Forest Soil | ERAQIYESFLTFVPGIAGAFGGAMGRNLVDNLLEKK |
| Ga0209166_105878052 | 3300027857 | Surface Soil | GVFVPLVEWLAYFFLTQKPQRAQIYESFLAFFPGIAGGAIGRGVVDNLFAKK |
| Ga0209698_103188483 | 3300027911 | Watersheds | DRAQIYESLLAFLPGIAGAYGAAVGRGVVDNLFVKK |
| Ga0302147_100010211 | 3300028566 | Bog | PVVEWLAYWFLTQKPERAQIYESFLAFLPGIAGAFGGSISRGVVDNLFGKK |
| Ga0302225_103045152 | 3300028780 | Palsa | VEWLAYYFLAEKPTRAQIYESFLAFVPGIAGAYGAAVGRGVLDHLFAKK |
| Ga0247271_1057264 | 3300029903 | Soil | TRAQVYESFVAFLPGIAGAYGGAIGRGAVENLFGKK |
| Ga0311346_100209148 | 3300029952 | Bog | EKPERAQIYESFLAFLPGIAGAYGGAVARNVVDNLFARK |
| Ga0311336_106359591 | 3300029990 | Fen | WFAYAVLSQKPDRAQIYESFLAFLPGIVGAYGGAFGRSVVKNLFPPKQGVS |
| Ga0302182_102342421 | 3300030054 | Palsa | AYVFLSQKPERAQVYESFLAFLPGIAGAVGGAVGRGVVDNLFVKK |
| Ga0311349_100314501 | 3300030294 | Fen | YVFLTQKPDRAQVSESVLAFLPGFAGAFGGAMGRGVVDNLFAKK |
| Ga0316363_100691243 | 3300030659 | Peatlands Soil | RAQIYESFLAFLPGIAGAYGGAAGRDVVDKLFAGK |
| Ga0302309_105907291 | 3300030687 | Palsa | LAEKPTRAQIYESFLAFVPGIAGAYGAAVGRGVLDHLFAKK |
| Ga0073994_100367751 | 3300030991 | Soil | FFLSQKPERAQIYESFLAFLPGIAGAFGGALGRGLVDNLFAGK |
| Ga0073994_121902411 | 3300030991 | Soil | LCRWWSGWLIFFLSQKPERAQIYESFLAFVPGIAGAVGGSVGRGVFDNLFAAK |
| Ga0302326_106962441 | 3300031525 | Palsa | EWLAFFYLSEKPSRAQIYESFLAFMPGIAGAYGGAIGRGVVDNLFAKK |
| Ga0302326_123181812 | 3300031525 | Palsa | WLAYFFLSEKPGRAQIYESFLAFVPGIAGAYGAAVGRNMFDNLFAKK |
| Ga0307474_109375431 | 3300031718 | Hardwood Forest Soil | QKPERAQIYESFLAFVPGIAGAFGGAMGRVLVDNLFAKK |
| Ga0302322_1007417541 | 3300031902 | Fen | VFLTQKPDRAQVSESVLAFLPGFAGAFGGAMGRGVVDNLFAKK |
| Ga0306926_116950752 | 3300031954 | Soil | TVKSYEFQIYSSFLVILPGLVGAYGGAFGRGVVDHLFAGK |
| Ga0307471_1014261432 | 3300032180 | Hardwood Forest Soil | LKPERAQIYESFLAFLPGIAGAYGGAFGRGVVDNLLANK |
| Ga0306920_1016938631 | 3300032261 | Soil | YFLLSQKPERAQIYESFLAFLPGIAGAYGGSIGRGVVDNLFAGN |
| Ga0306920_1030824191 | 3300032261 | Soil | IPVIEWLAYYFLSQKPERAQIYESFLAFMPGIAGAYGGALGRGVVNNLFPEK |
| Ga0335082_109592171 | 3300032782 | Soil | DRAQIYGSFLAFLPGIAGAYGGALGRGVVNNLFAKG |
| Ga0335081_101137031 | 3300032892 | Soil | PSRAQMYASCLIFLPGIAGAYGGAVFRNVVNNLLQGK |
| Ga0335081_116281961 | 3300032892 | Soil | FLLTQKPTTAQVYESFLAFLPGIAGAYGGALARTVVNNLFAKN |
| Ga0326726_110130192 | 3300033433 | Peat Soil | YFLSQKPERAQIYESFLAFMPGLAGAFGGAMGRGVVDNLFKK |
| Ga0371487_0135073_1127_1246 | 3300033982 | Peat Soil | EKPERAQVYESFLAFVPGIAGAFGGSVARGVVDNLFAGK |
| Ga0370484_0167553_475_594 | 3300034125 | Untreated Peat Soil | QKPERAQIYESFLAFVPGIAGAFGGAIGRGVVDNLFAGK |
| Ga0370492_0254015_2_142 | 3300034282 | Untreated Peat Soil | LAYFFLTQKPERAQVYESFLAFLPGIAGAYGGAMGRGVVDNLFPKK |
| ⦗Top⦘ |