 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F093924 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 45 residues |
| Representative Sequence | LHSVDKISRSEERGFAASERKAAAQELYRDYTIERNRYKKPLN |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.89 % |
| % of genes near scaffold ends (potentially truncated) | 98.11 % |
| % of genes from short scaffolds (< 2000 bps) | 93.40 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (74.528 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (13.207 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.585 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.943 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.58% β-sheet: 0.00% Coil/Unstructured: 70.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF13519 | VWA_2 | 19.81 |
| PF12700 | HlyD_2 | 0.94 |
| PF02623 | FliW | 0.94 |
| PF00529 | CusB_dom_1 | 0.94 |
| PF16576 | HlyD_D23 | 0.94 |
| PF13534 | Fer4_17 | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG1699 | Flagellar assembly factor FliW | Cell motility [N] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 74.53 % |
| All Organisms | root | All Organisms | 25.47 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.21% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.60% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.60% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.66% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 5.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.72% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.83% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.89% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.94% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.94% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.94% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.94% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.94% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.94% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004104 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF218 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009257 | Microbial communities of water from Amazon river, Brazil - RCM22 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010141 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012401 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014878 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10D | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1053164222 | 3300000364 | Soil | KISRSEERGFAASERSKGAGQDLYRDYQMERNRYKKPLN* |
| F14TC_1018422932 | 3300000559 | Soil | AAAEMILEGLYSVDKISRSEERGFIASDRKASSQELYRDYTMDRNRYKKPLN* |
| JGI1027J11758_122566482 | 3300000789 | Soil | LEGLHATDKISRSEERGFAASERSKGAXQDLYRDXXXERNRYKKPLN* |
| Ga0058891_14707522 | 3300004104 | Forest Soil | IDKISRSEERGYTAPERKAASQDLYRDYTMERNRYKKPLN* |
| Ga0063356_1000187851 | 3300004463 | Arabidopsis Thaliana Rhizosphere | SDKIGRSEERGFIAAERKGPSQDLYRDYTLERSRSKKPLN* |
| Ga0066395_100122444 | 3300004633 | Tropical Forest Soil | AAGEMVLEGLHSMDKISRSEERGFAASERKVPGAQELYRDYTLERNRYKKPLN* |
| Ga0062591_1005138361 | 3300004643 | Soil | LYASDKIGRSEERGFIGVERKTPTQELYRDYTLERGRSKKPLN* |
| Ga0058862_121321392 | 3300004803 | Host-Associated | LHSVDKISRSEERGFAASERKAAAQELYRDYTIERNRYKKPLN* |
| Ga0066680_105231292 | 3300005174 | Soil | HSMDKISRSEERGFAAPDRKTSQELYRDYTGERNRYKKPLN* |
| Ga0066684_110066241 | 3300005179 | Soil | YSIEKISRSEERGYAAVDRKASQELYRDYTMERNRYKKPLN* |
| Ga0066676_108368601 | 3300005186 | Soil | ILEGLYSIEKISRSEERGYTAAERKASQDLYRDYTMERNRYKKPLN* |
| Ga0066675_101441761 | 3300005187 | Soil | ELILEGLYSIEKISRSEERGYSAIDRKASQELYRDYTMERNRYKKPLN* |
| Ga0066675_111744051 | 3300005187 | Soil | EMILEGLHATDKISRSEERGFAASERSKGASQDLYRDYQMERNRYKKPLN* |
| Ga0070670_1014042742 | 3300005331 | Switchgrass Rhizosphere | SVDKISRSDERGFGAADRKAAAGAQELYRDYTLERNRYKKPLN* |
| Ga0066388_1019018261 | 3300005332 | Tropical Forest Soil | MDKISRSEERGFAASDRKVPGSQELYRDYTLERNRYKKPLN* |
| Ga0070669_1008307281 | 3300005353 | Switchgrass Rhizosphere | VDKISRSDERGFGAADRKAAAGAQELYRDYTLERNRYKKPLN* |
| Ga0070710_102634102 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | GLHSIDKIGRSEERGFAATERKAAAQELYRDYTMERNRYKKPLN* |
| Ga0070701_107012011 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | ILEGLYASDKIGRSEERGFIGVERKSQAQELYRDYTIERSRSKKPLN* |
| Ga0070700_1016819332 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MILEGLHSVDKISRSDERGFGAADRKAAAGAQELYRDYTLERNRYKKPLN* |
| Ga0066682_101829221 | 3300005450 | Soil | DKISRSEERGYAASERKSSSQELYRDYTIERNRYKKPLN* |
| Ga0070678_1021485843 | 3300005456 | Miscanthus Rhizosphere | HSIDKVGRSEERGYSGMERKSTPDMYRDYTKDLNRYKKPLN* |
| Ga0066700_100686761 | 3300005559 | Soil | GEMILEGLYSIEKISRSEERGYAASERKPAQELYRDYNMERNRYKKPLN* |
| Ga0066699_103096791 | 3300005561 | Soil | AAGEMILEGLHATDKISRSEERGFAASERTKGAAQDLYRDYQMERNRYKKPLN* |
| Ga0070664_1003481541 | 3300005564 | Corn Rhizosphere | SEERGFIGVERKTPTQELYRDYTLDRGRSKKPLN* |
| Ga0066705_103291592 | 3300005569 | Soil | ILEGLYSIEKISRSEERGYAAVDRKATQELYRDYTMERNRYKKPLN* |
| Ga0066694_100457333 | 3300005574 | Soil | LEGLYSIEKISRSEERGYAAVDRKATQELYRDYTMERNRYKKPLN* |
| Ga0066706_103357191 | 3300005598 | Soil | EGLYSMDKISRSEERGYAASERKQPSQELYRDYTIERNRYKKPLN* |
| Ga0066903_1057523702 | 3300005764 | Tropical Forest Soil | AGEMVLEGLHSIDKISRSEERGFAATERKAAAQDLYRDYTMERNRYKKPLN* |
| Ga0066903_1063237551 | 3300005764 | Tropical Forest Soil | ISRSEERGFAASERSKGASQDLYRDYQMERNRYKKPLN* |
| Ga0068871_1014132581 | 3300006358 | Miscanthus Rhizosphere | EGLHSIDKIGRSEERGFAAVERKAPAEMYRDYTKDINRYKKPLN* |
| Ga0066660_115824962 | 3300006800 | Soil | AAGEMILEGLYSIDKISRSEERGYTAPERKSAAQELYRDYTMERNRYKKPLN* |
| Ga0075428_1006253892 | 3300006844 | Populus Rhizosphere | DKISRSDERGFAASDRKSAATQELYRDYTMEKNRYKKPLN* |
| Ga0075420_1013260701 | 3300006853 | Populus Rhizosphere | RSEERGFAASDRKVPGAQELYRDYTLERNRYKKPLN* |
| Ga0075434_1002715943 | 3300006871 | Populus Rhizosphere | RSEERGFGAAERKAPGSQELYRDYTMERNRYKKPLN* |
| Ga0075436_1002356582 | 3300006914 | Populus Rhizosphere | ISRSEERGFAASDLKAPGAQELYRDYTLERNRYKKPLN* |
| Ga0079218_138039541 | 3300007004 | Agricultural Soil | NRVAIGEFILEGLCANDKIGRSEERGFVALERKAAAQDLYRDYNLERNRHKKPLN* |
| Ga0099791_104122831 | 3300007255 | Vadose Zone Soil | RTEERGYAASERKPAQELYRDYNMERNRYKKPLN* |
| Ga0099827_103542131 | 3300009090 | Vadose Zone Soil | EMILEGLHSVDKISRSEERGFTASSERKQSQDLYRDYSMERNRHNKPLN* |
| Ga0075418_105800041 | 3300009100 | Populus Rhizosphere | YASDKIGRSEERGFVGVERKSQAQELYRDYTLERSRSKKPLN* |
| Ga0066709_1033983052 | 3300009137 | Grasslands Soil | AAAAEMILEGLHSVDKISRSEERGFAATDRKGSQELYRDYTIERNRYKKPLN* |
| Ga0066709_1044160732 | 3300009137 | Grasslands Soil | AAAAEMILEGLHSVDKISRSEERGFAATDRKGSQELYRDYTMERNRYKKPLN* |
| Ga0114129_122566502 | 3300009147 | Populus Rhizosphere | LHSIDKISRSEDRGFAAPDRRTSQDLYRDYTMERNRNKKPLN* |
| Ga0105243_115329671 | 3300009148 | Miscanthus Rhizosphere | GLYASDKIGRSEERGFIGVERKSQAQELYRDYTIERSRSKKPLN* |
| Ga0075423_106509631 | 3300009162 | Populus Rhizosphere | SPTGYRAAAAEMLLEGLYSMDKITRSEERGFAASERKPSGGQELYRDYTMERNRYKKPLN |
| Ga0103869_101112371 | 3300009257 | River Water | VSAGEMILEGLHSIDKLNRSEEKGFTAPEKRVAQELYRDYSAERNRHKKPLN* |
| Ga0126382_114999192 | 3300010047 | Tropical Forest Soil | AAELILEGLHSIDKISRSEERGFTAIDRKGSQELYRDYTIERNRYKKPLN* |
| Ga0126373_126640742 | 3300010048 | Tropical Forest Soil | EERGFAASERKVPGAQELYRDYTLERNRYKKPLN* |
| Ga0127499_12103602 | 3300010141 | Grasslands Soil | EGLYSIEKIGRSEERGYTASERKATQELYRDYTVERNRYKKPLN* |
| Ga0134082_100487222 | 3300010303 | Grasslands Soil | YSIEKISRSEERGYSAIDRKASQELYRDYTMERNRYKKPLN* |
| Ga0134063_101465811 | 3300010335 | Grasslands Soil | LEGLYSIEKISRSEERGYSAIDRKASQELYRDYTMERNRYKKPLN* |
| Ga0126370_111867322 | 3300010358 | Tropical Forest Soil | EGLHSIDKISRSEERGFAATERKAAAQDLYRDYTMERNRYKKPLN* |
| Ga0126372_110247922 | 3300010360 | Tropical Forest Soil | RSEERGFAATERKAAAQDLYRDYTMERNRYKKPLN* |
| Ga0126377_116601262 | 3300010362 | Tropical Forest Soil | EKISRSEERGFAASERKAAGAQELYRDYTIERNRYKKPLN* |
| Ga0126379_135603642 | 3300010366 | Tropical Forest Soil | EMVLEGLHSMDKISRSEERGFAASDRKVPGSQELYRDYTMERNRYKKPLN* |
| Ga0126383_123986521 | 3300010398 | Tropical Forest Soil | EMVLEGLHSMDKISRSEERGFAASDRKVSGSQELYRDYTLERNRYKKPLN* |
| Ga0105246_114138531 | 3300011119 | Miscanthus Rhizosphere | EGLHAIDKIGRSEERGYAAMERKATAEMYRDYTKDLNRYKKPLN* |
| Ga0150983_109536282 | 3300011120 | Forest Soil | GEMILEGLYSIDKISRSEERGYTAPERKSATQDLYRDYTMERNRYKKPLN* |
| Ga0150983_152721282 | 3300011120 | Forest Soil | MILEGLYSVEKISRSEERGYAASERKGAAQELYRDYNMERNRYKKPLN* |
| Ga0137393_109197342 | 3300011271 | Vadose Zone Soil | LYSIDKISRSEERGYTAPERKSASQELYRDYTMERNRYKKPLN* |
| Ga0134055_13518181 | 3300012401 | Grasslands Soil | IRVAAGELILEGLYSIEKISRSEERGYSAIDRKASQELYRDYTMERNRYKKPLN* |
| Ga0150984_1140050721 | 3300012469 | Avena Fatua Rhizosphere | DLDKLNRSEERGFSAAERRAPSQELYRDYTIERNRHKKPLN* |
| Ga0157309_102761693 | 3300012895 | Soil | KVGRSEERGFSAIERKASADMYRDYTKDINRYKKPLN* |
| Ga0137395_108098901 | 3300012917 | Vadose Zone Soil | LHSIDKVGRSEERGYSAIERKASADMYRDFTKDLNRYKKPLN* |
| Ga0134075_105819272 | 3300014154 | Grasslands Soil | SGVRAAAAEMILEGLHSVDKISRSEERGFAATDRKGSQELYRDYTMERNRYKKPLN* |
| Ga0163163_102386881 | 3300014325 | Switchgrass Rhizosphere | KVGRTEERGYGAMERKASSDMYRDYTKDMNRYKKPLN* |
| Ga0163163_122499582 | 3300014325 | Switchgrass Rhizosphere | DERGFAATERRAAGSQELYRDYSIERNRYKKPLN* |
| Ga0180065_11688292 | 3300014878 | Soil | AAEMILEGLHSMDKISRSEERGFTAASERKAAGAQELYRDYTMERNRHKKPLN* |
| Ga0132258_105282411 | 3300015371 | Arabidopsis Rhizosphere | AEAEFILEGLYASDKIGRSEERGFVGVERKTPAQELYRDYTIERSRSKKPLN* |
| Ga0132258_120516722 | 3300015371 | Arabidopsis Rhizosphere | VTPDSPVGLRAASGEMILEGLHSIDKISRSEERGFAAPDRRASQDLYRDYTIERNRNKKPLN* |
| Ga0132256_1020598272 | 3300015372 | Arabidopsis Rhizosphere | SIDKINRSEERGFTASDRKAAQDLYRDYTVERNRYKKPLN* |
| Ga0132256_1032489461 | 3300015372 | Arabidopsis Rhizosphere | EERGFAASDRKAPSSQELYRDYTMERNRYKKPLN* |
| Ga0132257_1008452002 | 3300015373 | Arabidopsis Rhizosphere | ATAEFILEGLHSLDKIGRSEERGFVANERKQAGQDLYRDYSMERTRYKKPLN* |
| Ga0132257_1046432762 | 3300015373 | Arabidopsis Rhizosphere | LEGLHATDKISRSEERGFSASERSKGAGQDLYRDYQMERNRYKKPLN* |
| Ga0132255_1010640481 | 3300015374 | Arabidopsis Rhizosphere | PDSPVGLRAASGEMILEGLHSIDKISRSEERGFAAPDRRASQDLYRDYTIERNRNKKPLN |
| Ga0132255_1040407241 | 3300015374 | Arabidopsis Rhizosphere | EKISRSEERGFAAIDRKGTQELYRDYTMERNRYKKPLN* |
| Ga0182035_117670792 | 3300016341 | Soil | LHSIDKLSRSEERGFTASERKAAAQELYRDYTMERNRYKKPLN |
| Ga0134083_100124073 | 3300017659 | Grasslands Soil | SRSEERGYTAAERKATQDLYRDYTIERNRYKKPLN |
| Ga0184634_103105871 | 3300018031 | Groundwater Sediment | NDSRGLYATDKITRSEERGFCAPERSKGAGQELYRDYQMERNRYKKPLN |
| Ga0066667_100915353 | 3300018433 | Grasslands Soil | ELILEGLYSIEKISRSEERGYAAVDRKATQELYRDYTMERNRYKKPLN |
| Ga0190271_134621231 | 3300018481 | Soil | AEAEFILEGLYASDKIGRSEERGFVGVDRKPPPQELYRDYTLERSRSKKPLN |
| Ga0066669_100505563 | 3300018482 | Grasslands Soil | VAAGELILEGLYSIEKISRSEERGYAAVDRKATQELYRDYTMERNRYKKPLN |
| Ga0210408_113919812 | 3300021178 | Soil | YSVDKISRSEERGYAASERKGAGQELYRDYNMERNRYKKPLN |
| Ga0247666_10737282 | 3300024323 | Soil | GLYSVEKISRSEERGFSATERKAAAQELYRDYTMERNRYKKPLN |
| Ga0207663_110587742 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | LEGLHSIDKIGRSEERGFAATERKAAAQELYRDYTMERNRYKKPLN |
| Ga0207659_107793531 | 3300025926 | Miscanthus Rhizosphere | QGEFILEGLYASDKIGRSEERGFIGVERKSQAQELYRDYTIERSRSKKPLN |
| Ga0207701_104553023 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | SIDKVGRSEERGYSGMERKSTPDMYRDYTKDLNRYKKPLN |
| Ga0207686_112459111 | 3300025934 | Miscanthus Rhizosphere | YASDKIGRSEERGFVGIERKSAAQELYRDYTLERGRSKKPLN |
| Ga0207686_114435512 | 3300025934 | Miscanthus Rhizosphere | AEAEFILEGLYASDKIGRSEERGFIGVERKTPTQELYRDYTLERGRSKKPLN |
| Ga0207677_111641891 | 3300026023 | Miscanthus Rhizosphere | YKIGRSEERGFVSIERKAPTQELYRDYTLERSRSKKPLN |
| Ga0209235_12669791 | 3300026296 | Grasslands Soil | YSSCAGLYSIEKISRSEERGYAASERKPAQELYRDYNMERNRYKKPLN |
| Ga0209236_11306702 | 3300026298 | Grasslands Soil | MILEGLYSIEKISRSEERGYAASERKPAQELYRDYNMERNRYKKPLN |
| Ga0209236_11970801 | 3300026298 | Grasslands Soil | GEMILEGLYSIEKISRSEERGYTAADRKATQELYRDYTIERNRYKKPLN |
| Ga0209814_103615772 | 3300027873 | Populus Rhizosphere | VLEGLHSLDKISRSEERGFAASDRKVPGAQELYRDYTLERNRYKKPLN |
| Ga0209465_100219411 | 3300027874 | Tropical Forest Soil | HAAAGEMVLEGLHSMDKISRSEERGFAASERKVPGAQELYRDYTLERNRYKKPLN |
| Ga0209486_105054231 | 3300027886 | Agricultural Soil | GRSEERGFVGVERKPQPQDLYRDYTLERSRSKKPLN |
| Ga0308178_11639331 | 3300030990 | Soil | ISRSEERGFSASERSKGASQDLYRDYQMERNRYKKPLN |
| Ga0310813_106709712 | 3300031716 | Soil | SRSEERGFTSSDRKGGGGSQELYRDYTLERNRYKKPLN |
| Ga0306923_109365192 | 3300031910 | Soil | KISRSEERGFTSAERKGGGSQELYRDYTLERNRYKKPLN |
| Ga0310913_103590411 | 3300031945 | Soil | ISRSEERGYAASERKSSQEMYRDYTIERNRYKKPLN |
| Ga0310890_116956741 | 3300032075 | Soil | LEGLHSMDKISRSEERGFAASDRKAAATQELYRDYTMEKNRYKKPLN |
| Ga0306924_114016501 | 3300032076 | Soil | AAAAEMILEGLHSIDKLSRSEERGFSASDRKAAAQELYRDYTMERNRYKKPLN |
| Ga0306924_119348192 | 3300032076 | Soil | LDKISRSEERGYAASERKSSQEMYRDYTIERNRYKKPLN |
| Ga0315912_105523251 | 3300032157 | Soil | EGLHAIDKVGRSEERGYAAMERKATSEMYRDYTKDINRYKKPLN |
| Ga0310889_101083751 | 3300032179 | Soil | AQGEFILEGLYASDKIGRSEERGFIGVERKSQAQELYRDYTIERSRSKKPLN |
| Ga0306920_1005848711 | 3300032261 | Soil | IDKISRSEERGFTSAERKGGGSQELYRDYTLERNRYKKPLN |
| Ga0326723_0281806_2_127 | 3300034090 | Peat Soil | HSIDKINRSEERGFTASDRKAAQDLYRDYTVERNRYKKPLN |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |