| Basic Information | |
|---|---|
| Family ID | F093846 |
| Family Type | Metagenome |
| Number of Sequences | 106 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MEIAIVIGAAGLALVGASLATILTNGTDDWAGQVKKAEKSRAKMKKALSK |
| Number of Associated Samples | 71 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 89.62 % |
| % of genes near scaffold ends (potentially truncated) | 20.75 % |
| % of genes from short scaffolds (< 2000 bps) | 56.60 % |
| Associated GOLD sequencing projects | 62 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.604 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (24.528 % of family members) |
| Environment Ontology (ENVO) | Unclassified (71.698 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (68.868 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 61.54% β-sheet: 0.00% Coil/Unstructured: 38.46% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF02467 | Whib | 21.70 |
| PF12705 | PDDEXK_1 | 8.49 |
| PF01370 | Epimerase | 3.77 |
| PF05257 | CHAP | 2.83 |
| PF13481 | AAA_25 | 1.89 |
| PF01555 | N6_N4_Mtase | 1.89 |
| PF00589 | Phage_integrase | 0.94 |
| PF02945 | Endonuclease_7 | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 1.89 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 1.89 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 1.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.60 % |
| All Organisms | root | All Organisms | 43.40 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002408|B570J29032_109459246 | Not Available | 780 | Open in IMG/M |
| 3300002408|B570J29032_109907332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2328 | Open in IMG/M |
| 3300003277|JGI25908J49247_10001109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8502 | Open in IMG/M |
| 3300003277|JGI25908J49247_10008171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3297 | Open in IMG/M |
| 3300005581|Ga0049081_10017688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2701 | Open in IMG/M |
| 3300005581|Ga0049081_10122714 | Not Available | 961 | Open in IMG/M |
| 3300006484|Ga0070744_10112113 | Not Available | 787 | Open in IMG/M |
| 3300006805|Ga0075464_10011676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4352 | Open in IMG/M |
| 3300006805|Ga0075464_10126372 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1488 | Open in IMG/M |
| 3300006805|Ga0075464_10434341 | Not Available | 800 | Open in IMG/M |
| 3300006805|Ga0075464_10552623 | Not Available | 707 | Open in IMG/M |
| 3300007734|Ga0104986_1006 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10042 | Open in IMG/M |
| 3300007734|Ga0104986_1425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14909 | Open in IMG/M |
| 3300007734|Ga0104986_1612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 19387 | Open in IMG/M |
| 3300008266|Ga0114363_1012174 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6620 | Open in IMG/M |
| 3300008266|Ga0114363_1012814 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3898 | Open in IMG/M |
| 3300008266|Ga0114363_1078348 | Not Available | 1238 | Open in IMG/M |
| 3300008450|Ga0114880_1053458 | Not Available | 1697 | Open in IMG/M |
| 3300009068|Ga0114973_10098652 | Not Available | 1662 | Open in IMG/M |
| 3300009152|Ga0114980_10013132 | Not Available | 5271 | Open in IMG/M |
| 3300009155|Ga0114968_10032901 | Not Available | 3456 | Open in IMG/M |
| 3300009158|Ga0114977_10033853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3199 | Open in IMG/M |
| 3300009159|Ga0114978_10065167 | Not Available | 2464 | Open in IMG/M |
| 3300009163|Ga0114970_10216668 | Not Available | 1120 | Open in IMG/M |
| 3300009164|Ga0114975_10065472 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2124 | Open in IMG/M |
| 3300009165|Ga0105102_10100311 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1359 | Open in IMG/M |
| 3300009165|Ga0105102_10874582 | Not Available | 516 | Open in IMG/M |
| 3300009169|Ga0105097_10580026 | Not Available | 630 | Open in IMG/M |
| 3300009169|Ga0105097_10860947 | Not Available | 519 | Open in IMG/M |
| 3300009183|Ga0114974_10015306 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5492 | Open in IMG/M |
| 3300009183|Ga0114974_10163615 | Not Available | 1383 | Open in IMG/M |
| 3300009184|Ga0114976_10058081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2265 | Open in IMG/M |
| 3300010885|Ga0133913_11485464 | Not Available | 1718 | Open in IMG/M |
| 3300011113|Ga0151517_1427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15763 | Open in IMG/M |
| 3300011335|Ga0153698_1218 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 26980 | Open in IMG/M |
| 3300011995|Ga0153800_1033598 | Not Available | 543 | Open in IMG/M |
| 3300013004|Ga0164293_10102408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2196 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10165294 | Not Available | 1439 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10511742 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 658 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10573171 | Not Available | 610 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10044884 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3916 | Open in IMG/M |
| 3300014050|Ga0119952_1009976 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3818 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10587116 | Not Available | 613 | Open in IMG/M |
| 3300017701|Ga0181364_1057183 | Not Available | 606 | Open in IMG/M |
| 3300017722|Ga0181347_1030661 | Not Available | 1673 | Open in IMG/M |
| 3300017736|Ga0181365_1114613 | Not Available | 648 | Open in IMG/M |
| 3300017761|Ga0181356_1022808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2284 | Open in IMG/M |
| 3300017761|Ga0181356_1132962 | Not Available | 784 | Open in IMG/M |
| 3300017777|Ga0181357_1172909 | Not Available | 784 | Open in IMG/M |
| 3300017784|Ga0181348_1101011 | Not Available | 1126 | Open in IMG/M |
| 3300017788|Ga0169931_10040684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5231 | Open in IMG/M |
| 3300017788|Ga0169931_10112198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2572 | Open in IMG/M |
| 3300019784|Ga0181359_1009644 | Not Available | 3393 | Open in IMG/M |
| 3300019784|Ga0181359_1207823 | Not Available | 625 | Open in IMG/M |
| 3300020183|Ga0194115_10004812 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14305 | Open in IMG/M |
| 3300020527|Ga0208232_1011835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1333 | Open in IMG/M |
| 3300020536|Ga0207939_1002861 | Not Available | 3585 | Open in IMG/M |
| 3300021962|Ga0222713_10111178 | Not Available | 1946 | Open in IMG/M |
| 3300021962|Ga0222713_10379353 | Not Available | 876 | Open in IMG/M |
| 3300021963|Ga0222712_10282740 | Not Available | 1047 | Open in IMG/M |
| 3300022407|Ga0181351_1208758 | Not Available | 645 | Open in IMG/M |
| 3300022752|Ga0214917_10011582 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8127 | Open in IMG/M |
| 3300022752|Ga0214917_10071713 | Not Available | 2173 | Open in IMG/M |
| 3300022752|Ga0214917_10145383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1265 | Open in IMG/M |
| 3300022752|Ga0214917_10219489 | Not Available | 916 | Open in IMG/M |
| 3300022752|Ga0214917_10349203 | Not Available | 633 | Open in IMG/M |
| 3300023174|Ga0214921_10129035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1788 | Open in IMG/M |
| 3300023174|Ga0214921_10200307 | Not Available | 1249 | Open in IMG/M |
| 3300023179|Ga0214923_10001617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 31779 | Open in IMG/M |
| 3300023184|Ga0214919_10249091 | Not Available | 1275 | Open in IMG/M |
| 3300023184|Ga0214919_10369147 | Not Available | 947 | Open in IMG/M |
| 3300024346|Ga0244775_11191619 | Not Available | 594 | Open in IMG/M |
| 3300025896|Ga0208916_10099184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1231 | Open in IMG/M |
| 3300025896|Ga0208916_10241281 | Not Available | 785 | Open in IMG/M |
| 3300025896|Ga0208916_10386184 | Not Available | 611 | Open in IMG/M |
| 3300027608|Ga0208974_1171203 | Not Available | 539 | Open in IMG/M |
| 3300027659|Ga0208975_1005887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4474 | Open in IMG/M |
| 3300027693|Ga0209704_1135290 | Not Available | 710 | Open in IMG/M |
| 3300027733|Ga0209297_1050223 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1886 | Open in IMG/M |
| 3300027734|Ga0209087_1075137 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1479 | Open in IMG/M |
| 3300027736|Ga0209190_1025423 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3253 | Open in IMG/M |
| 3300027736|Ga0209190_1189700 | Not Available | 856 | Open in IMG/M |
| 3300027756|Ga0209444_10151544 | Not Available | 888 | Open in IMG/M |
| 3300027759|Ga0209296_1273526 | Not Available | 683 | Open in IMG/M |
| 3300027759|Ga0209296_1391789 | Not Available | 523 | Open in IMG/M |
| 3300027772|Ga0209768_10240714 | Not Available | 790 | Open in IMG/M |
| 3300027798|Ga0209353_10040356 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2156 | Open in IMG/M |
| 3300027798|Ga0209353_10044041 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2056 | Open in IMG/M |
| 3300027971|Ga0209401_1296895 | Not Available | 562 | Open in IMG/M |
| 3300028025|Ga0247723_1010933 | Not Available | 3508 | Open in IMG/M |
| 3300028025|Ga0247723_1017627 | Not Available | 2493 | Open in IMG/M |
| 3300028025|Ga0247723_1108436 | Not Available | 692 | Open in IMG/M |
| (restricted) 3300028571|Ga0247844_1055354 | Not Available | 2219 | Open in IMG/M |
| 3300031758|Ga0315907_10001323 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 33742 | Open in IMG/M |
| 3300031857|Ga0315909_10058438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3520 | Open in IMG/M |
| 3300031857|Ga0315909_10902144 | Not Available | 545 | Open in IMG/M |
| 3300031951|Ga0315904_10096215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3125 | Open in IMG/M |
| 3300031951|Ga0315904_10168038 | Not Available | 2197 | Open in IMG/M |
| 3300032116|Ga0315903_10771075 | Not Available | 707 | Open in IMG/M |
| 3300034061|Ga0334987_0028391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4918 | Open in IMG/M |
| 3300034061|Ga0334987_0608684 | Not Available | 643 | Open in IMG/M |
| 3300034062|Ga0334995_0055399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3209 | Open in IMG/M |
| 3300034071|Ga0335028_0231358 | Not Available | 1129 | Open in IMG/M |
| 3300034101|Ga0335027_0006146 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10526 | Open in IMG/M |
| 3300034104|Ga0335031_0185259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1419 | Open in IMG/M |
| 3300034106|Ga0335036_0070115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2629 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 24.53% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 16.98% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 15.09% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.60% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.66% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.66% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.72% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.77% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.83% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.83% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.83% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 2.83% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.89% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.89% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011113 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Sep | Environmental | Open in IMG/M |
| 3300011335 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman | Environmental | Open in IMG/M |
| 3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020536 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29032_1094592463 | 3300002408 | Freshwater | MEIAIVIGAAGLALVGASLATILTNGTDDWAGQVKKAEKSRAKMKRALSK* |
| B570J29032_1099073321 | 3300002408 | Freshwater | MEIAIMIGAAGLALIGASLASLLTNGTDDWAGQVKKAEKNRAKMKKALSK* |
| JGI25908J49247_100011099 | 3300003277 | Freshwater Lake | MEIAIMIGAAGLALVGASLASILTNGTDDWAGQVKKAERSRAKMKKALSK* |
| JGI25908J49247_100081717 | 3300003277 | Freshwater Lake | MEIAIVIGAAALALVGANFATILTNGTDDWAGQVKKADRSRAKMKKALGK* |
| Ga0049081_100176885 | 3300005581 | Freshwater Lentic | MEIAIVIGAALAGLTGAYFATLATNGTQDWAGQVKKAERSRAAMKKALSK* |
| Ga0049081_101227143 | 3300005581 | Freshwater Lentic | MEIGIVIGAALAGLIGAYFATGATNGTQDWAGQVKKAERSRAAMKKALTK* |
| Ga0070744_101121132 | 3300006484 | Estuarine | MEIAIVIGAAALALVGANFATILTNGTDDWAGQVKKAERNRAKMKKALSK* |
| Ga0075464_100116762 | 3300006805 | Aqueous | MEIGIVIGAALAGLTGAYFATLATNGTQDWAGQVKKAERSRAAMKKALSK* |
| Ga0075464_101263724 | 3300006805 | Aqueous | VEIGIVIVAAVIALAGASLASLLTNGTDDWAGQVKKAEKNRAKMKKALSK* |
| Ga0075464_104343412 | 3300006805 | Aqueous | MEIAIMIGAAGLALIGASLASLLTNGTDDWAGQVKKAERSRAKMKRALSK* |
| Ga0075464_105526232 | 3300006805 | Aqueous | MEIAIMIGAAGLALIGASLASLLTNGTDDWAGQVKKAERSRAKMKKALSK* |
| Ga0104986_100619 | 3300007734 | Freshwater | VEIAVMIGAAGLALVGAYFATILTNGTDDWSGQVKKAQRSRAKMKKALSK* |
| Ga0104986_142521 | 3300007734 | Freshwater | MEIAVMAGAAALALVGAYFATILTNGSDDWAGQVKKAQRSRAKMKKALEK* |
| Ga0104986_161222 | 3300007734 | Freshwater | MEIAILIGVAGAALMGASLASRLTNGTDDWAGQVKKAERSRAKMKKALEK* |
| Ga0114363_10121749 | 3300008266 | Freshwater, Plankton | MEIAIMIGAAGLALIGASLASILTNGTDDWAGQVKKAEKSRAKMKKALSK* |
| Ga0114363_10128149 | 3300008266 | Freshwater, Plankton | MEIAIVIGAAGLALAGASLATILTNGTDDWAGQVKKAEKSRAKMKKALSK* |
| Ga0114363_10783483 | 3300008266 | Freshwater, Plankton | MEITIMIGAAGLALIGASLASILTNGTDDWAGQVKKADRSRAKMKKALSK* |
| Ga0114880_10534581 | 3300008450 | Freshwater Lake | MEIAIMIGAAGLALIGASLASILTNGTDDWAGQVKKAD |
| Ga0114973_100986524 | 3300009068 | Freshwater Lake | MEIAIVIGAALAGLIGAYFATLATNGTQDWAGQVKKAERSRAAMKKALSK* |
| Ga0114980_100131325 | 3300009152 | Freshwater Lake | VEIGIVLVAAVLALAGTSLATILTNGTDDWAGQVKRAEKSRAKIKKALGK* |
| Ga0114968_100329012 | 3300009155 | Freshwater Lake | VEIGIVMVAAVLALAGTSLATMLTNGTDDWAGQVKRAEKSRAKMKKALSK* |
| Ga0114977_100338535 | 3300009158 | Freshwater Lake | VEIGIVLVAAVLALAGTSLATMLTNGTDDWAGQVKRAEKSRAKMKKALGK* |
| Ga0114978_100651671 | 3300009159 | Freshwater Lake | VEIGIVLVAAVLALAGTSLATMLTNGSDDWAEQVKRAEKSRAKMKKALGK* |
| Ga0114970_102166684 | 3300009163 | Freshwater Lake | MEMAIVIGAALAGLVGAYFATGATNGTQDWAGQVKKAERSRAAMKKALSK* |
| Ga0114975_100654721 | 3300009164 | Freshwater Lake | LGLKGGNEVEIGIVIVAAVLALAGTSLATMLTNGTDDWAGQVKRAEKSRAKMKKALGK* |
| Ga0105102_101003114 | 3300009165 | Freshwater Sediment | MEIGIVIGAAVIALIGAYFATKLTNGTEDWAGQVEKAERSRAKMKRALSK* |
| Ga0105102_108745822 | 3300009165 | Freshwater Sediment | MEMAIMASAALLALLGAYFATILTNGVDVVAQVKKAEKSRAKMKKALTK* |
| Ga0105097_105800262 | 3300009169 | Freshwater Sediment | MEMAIMAGAALLALLGAYFATILTNGVDVVAQVKKAEKSRAKMKKALTK* |
| Ga0105097_108609472 | 3300009169 | Freshwater Sediment | MEIGIVIGAAVIALIGAYFATKLTNGTEDWAGQVEKAERSRAKMKKALSK* |
| Ga0114974_1001530610 | 3300009183 | Freshwater Lake | LGLKGGNEVEIGIVIVAAVLALAGTSLATMLTNGTDDWAGQVKRAEKSRAKMKKALSK* |
| Ga0114974_101636154 | 3300009183 | Freshwater Lake | MEIGIVIGAALAGLVGAYFATGATNGTSDWAGQVKKAERSRAAMKKALSK* |
| Ga0114976_100580811 | 3300009184 | Freshwater Lake | LGLKGGNEVEIGIVIVAAVLALAGTSLATMLTNGTDDWAGQVKRA |
| Ga0133913_114854647 | 3300010885 | Freshwater Lake | VEIGIVMVAAVLALAGTSLATMLTNGTDDWAGQVKRAEKSRAKMKKA |
| Ga0151517_142718 | 3300011113 | Freshwater | MEIAIVIGAAGLALVGASIASSLTNGTDDWAGQVKKAEKSRAKMKKALNK* |
| Ga0153698_121832 | 3300011335 | Freshwater | MEMALMAGAAALALVGAYFATILTNGSDDWAGQVKKAERSRAKMKKALEK* |
| Ga0153800_10335982 | 3300011995 | Freshwater | MEIGIVIGAALAGLVGAYFATGATNGTQDWAGQVKKAERSRAAMKKALGK* |
| Ga0164293_101024082 | 3300013004 | Freshwater | MEIAIVIGAAGLALVGASLATILTNGTDDWAGQVKKAEKSRAKMKKALSK* |
| (restricted) Ga0172367_101652944 | 3300013126 | Freshwater | MEIGIVIGAAVIALMGAYFATNLTNGTEDWAGQVKKAERNRAKMKKALTK* |
| (restricted) Ga0172367_105117422 | 3300013126 | Freshwater | MEIAIVIGAAGLALLGAFLATNLTNGTDDWAGQVKKAERSRAKMKKALTK* |
| (restricted) Ga0172367_105731712 | 3300013126 | Freshwater | MEIAIVIGAAGLALLGASLATNLTNGTDDWAGQVKKAERSRA |
| (restricted) Ga0172373_100448845 | 3300013131 | Freshwater | MEIAIVIGAAGLALLGASLATNLTNGTDDWAGQVKKAERSRAKMKKALNK* |
| Ga0119952_10099768 | 3300014050 | Freshwater | VEIGIVLVAAVLALAGTSLATMLTNGTDDWAGQVKKAEKSRAKMKKALGK* |
| (restricted) Ga0172376_105871162 | 3300014720 | Freshwater | MEIAIVIGAAGLALLGASLATILTNGTDDWAGQVKKAERSRAKMKKALNK* |
| Ga0181364_10571832 | 3300017701 | Freshwater Lake | MEIAIVIGAAALALVGANFATILTNGTDDWAGQVKKA |
| Ga0181347_10306611 | 3300017722 | Freshwater Lake | MEIVIVIGAAALALVGANFATILTNGTDDWAGQVKKAERGRANMKRALGK |
| Ga0181365_11146132 | 3300017736 | Freshwater Lake | MEIGIVIGAALAGLIGAYFATGATNGTQDWAGQVKKAERSRAAMKKALSK |
| Ga0181356_10228081 | 3300017761 | Freshwater Lake | IVIGAAALALVGANFATILTNGTDDWAGQVKKAERSRAKMKKALSK |
| Ga0181356_11329623 | 3300017761 | Freshwater Lake | MEIAIVIGAAALALIGANFATILTNGTDDWAGQVKKADRSRAKMK |
| Ga0181357_11729092 | 3300017777 | Freshwater Lake | MEIGIVIGAALAGLIGAYFATGATNGTSDWAGQVKKAERSRAAMKKAL |
| Ga0181348_11010113 | 3300017784 | Freshwater Lake | MEIAIVIGAAALALVGANFATILTNGTDDWAGQVKKADRSRAKMK |
| Ga0169931_1004068411 | 3300017788 | Freshwater | MEIAIVIGGAGLALLGASLATILTNGTDDWAGQVKKAERSRAKMKKALNK |
| Ga0169931_101121985 | 3300017788 | Freshwater | MEIAIVIGAAGLALLGAFLATNLTNGTDDWAGQVKKAERSRAKMKKALTK |
| Ga0181359_10096449 | 3300019784 | Freshwater Lake | MEIAIMIGAAGLALVGASLASILTNGTDDWAGQVKKAERSRAKMKKALSK |
| Ga0181359_12078232 | 3300019784 | Freshwater Lake | MEIAIVIGAAALALVGANFATILTNGTDDWAGQVKKADRSRAKMKKALSK |
| Ga0194115_1000481217 | 3300020183 | Freshwater Lake | MEIGIVIGAAVIALIGAYFASNLTNGTEDWAGQVKKAERSRAKMKKALTK |
| Ga0208232_10118354 | 3300020527 | Freshwater | MEIAIVIGAAGLALVGASLATILTNGTDDWAGQVKKAEKSRAKMKRALSK |
| Ga0207939_10028613 | 3300020536 | Freshwater | MEIAIVIGAAGLALIGASLASLLTNGTDDWAGQVKKAEKNRAKMKKALSK |
| Ga0222713_101111785 | 3300021962 | Estuarine Water | MEIAIVIGAAALALVGANFATILTNGTDDWAGQVKKAEKSRAKMKKALSK |
| Ga0222713_103793531 | 3300021962 | Estuarine Water | MEIAIVIGAALAGLTGAYFATLASNGTQDWAGQVKKAERSRAAMKKALSK |
| Ga0222712_102827404 | 3300021963 | Estuarine Water | MEIGIVIGAALAGLIGAYFATGATNGTQDWAGQVKKAERSRAAMK |
| Ga0181351_12087583 | 3300022407 | Freshwater Lake | MEIAIVIGAAALALVGANFATILTNGTDDWAGQVKKADRSRAKMKKA |
| Ga0214917_1001158215 | 3300022752 | Freshwater | MEIAILIGAALAGLTGAYFATLATNGTQDWAGQVKKAERSRAAMKKALGK |
| Ga0214917_1007171311 | 3300022752 | Freshwater | VEIGIVIVAAVLALAGASLASLLTNGTDDWAGQVKKAEKNRAKMKKALSK |
| Ga0214917_101453835 | 3300022752 | Freshwater | MEIGIVLVAAVLALAGTSLATMLTNGTDDWAGQVKRAEKSRAKMKKALGK |
| Ga0214917_102194893 | 3300022752 | Freshwater | VEIGIVMVAAVLALAGASLASLLTNGTDDWAGQVKKAEKNRAKMKKALSK |
| Ga0214917_103492032 | 3300022752 | Freshwater | VEIGIVMVAAVLALAGASLASLLTNGTDDWAGQVKKAEKSRAKMKKALSK |
| Ga0214921_101290356 | 3300023174 | Freshwater | LGLKGGNEVEIGIVLVAAVLALAGTSLATMLTNGTDDWAGQVKRAEKSRAKMKKALGK |
| Ga0214921_102003075 | 3300023174 | Freshwater | MEIAIIIVVAALALVGANFATILTNGTDDWAAQVKSAEKNRAKMKRALGK |
| Ga0214923_1000161740 | 3300023179 | Freshwater | VEIGIVAAVAVLALAGASLATILTNGTDDWAGQVKRAEKSRAKMKRALNK |
| Ga0214919_102490914 | 3300023184 | Freshwater | MPQLLHTQEPGLKGGNAVEIGIVMVAAVLALAGASLASLLTNGTDDWAGQV |
| Ga0214919_103691473 | 3300023184 | Freshwater | VEIGIVMVAAVLALAGASLASLLTNGTDDWAGQVKKAEKSRAKM |
| Ga0244775_111916192 | 3300024346 | Estuarine | MEIAIVIGAAALALVGANFATILTNGTDDWAGQVKKAERNRAKMKKALSK |
| Ga0208916_100991841 | 3300025896 | Aqueous | MEIAIMIGAAGLALIGASLASLLTNGTDDWAGQVKK |
| Ga0208916_102412811 | 3300025896 | Aqueous | MEIAIMIGAAGLALIGASLASLLTNGTDDWAGQVKKAERSRAKMKKALSK |
| Ga0208916_103861841 | 3300025896 | Aqueous | EIAIVIGAALAGLTGAYFATLATNGTQDWAGQVKKAERSRAAMKKALSK |
| Ga0208974_11712032 | 3300027608 | Freshwater Lentic | MEIGIVIGAALAGLIGAYFATGATNGTQDWAGQVKKAERSRAAMKKALTK |
| Ga0208975_100588712 | 3300027659 | Freshwater Lentic | MEIAIVIGAALAGLTGAYFATLATNGTQDWAGQVKKAERSRAAMKKALSK |
| Ga0209704_11352902 | 3300027693 | Freshwater Sediment | MEIGIVIGAAVIALIGAYFATKLTNGTEDWAGQVEKAERSRAKMKRALSK |
| Ga0209297_10502232 | 3300027733 | Freshwater Lake | VEIGIVLVAAVLALAGTSLATMLTNGTDDWAGQVKRAEKSRAKMKKALGK |
| Ga0209087_10751377 | 3300027734 | Freshwater Lake | LGLKGGNEVEIGIVIVAAVLALAGTSLATMLTNGTDDWAGQVKRAEKS |
| Ga0209190_10254235 | 3300027736 | Freshwater Lake | MAIVIGAALAGLVGAYFATGATNGTQDWAGQVKKAERSRAAMKKALSK |
| Ga0209190_11897001 | 3300027736 | Freshwater Lake | VEIGIVMVAAVLALAGTSLATMLTNGTDDWAGQVKRAEKSRAKMKKALSK |
| Ga0209444_101515441 | 3300027756 | Freshwater Lake | MELAIVIGAALAGLIGAYFATGATNGTSDWAGQVKKAERSRAAMKKALGK |
| Ga0209296_12735262 | 3300027759 | Freshwater Lake | MEIGIVIGAALAGLVGAYFATGATNGTSDWAGQVKKAERSRAAMKKALSK |
| Ga0209296_13917891 | 3300027759 | Freshwater Lake | IVAAVLALAGTSLATMLTNGTDDWAGQVKRAEKSRAKMKKALSK |
| Ga0209768_102407141 | 3300027772 | Freshwater Lake | MEIGIVIGAALAGLIGAYFATGATNGTQDWAGQVKKAERSRAAMKKALGK |
| Ga0209353_100403561 | 3300027798 | Freshwater Lake | MEIGIVIGAALAGLIGAYFATGATNGTSDWAGQVKKAERSRAAMKKALGK |
| Ga0209353_100440415 | 3300027798 | Freshwater Lake | MEIAIVIGAAALALVGANFATILTNGTDDWAGQVKKAERGRANMKRALGK |
| Ga0209401_12968951 | 3300027971 | Freshwater Lake | MEIAIVIGAALAGLIGAYFATLATNGTQDWAGQVKKAERSRAAMKKALSK |
| Ga0247723_10109338 | 3300028025 | Deep Subsurface Sediment | VEIGIVIVAAVLALAGTSLATMLTNGTDDWAGQVKRAEKSRAKMKKALSK |
| Ga0247723_10176278 | 3300028025 | Deep Subsurface Sediment | MEIVIMAGAAIAALVGTYVATNSSNGRDVVVQVKKAQKGRAKMKKALEK |
| Ga0247723_11084361 | 3300028025 | Deep Subsurface Sediment | MEIAIVIGAAGLALLGASFASLMTNGTDDWAGQVKKAERSRAKMKKALNK |
| (restricted) Ga0247844_10553542 | 3300028571 | Freshwater | MEIAILIGVAGAALMGASLASRMTNGTDDWSGQVKKAQRSTAKMKKALEK |
| Ga0315907_1000132341 | 3300031758 | Freshwater | MEIAIMIGAAGLALIGASLASILTNGTDDWAGQVKKAEKSRAKMKKALSK |
| Ga0315909_100584389 | 3300031857 | Freshwater | IAIVIGAAGLALAGASLATILTNGTDDWAGQVKKAEKSRAKMKKALSK |
| Ga0315909_109021441 | 3300031857 | Freshwater | MEIAIVIGAAGLALVGASLATILTNGTDDWAGQVKKAEKSRAKMKK |
| Ga0315904_100962157 | 3300031951 | Freshwater | MEIAIVIGAAGLALAGASLATILTNGTDDWAGQVKKAEKSRAKMKKALSK |
| Ga0315904_101680383 | 3300031951 | Freshwater | MEIAIVIGAAGLALVGASLATILTNGTDDWAGQVKKAEKSRAKMKKALSK |
| Ga0315903_107710752 | 3300032116 | Freshwater | MEIAIVIGAAGLALAGASLATILTNGTDDWAGQVKKAEKSRAKMKKA |
| Ga0334987_0028391_245_397 | 3300034061 | Freshwater | MEIAIVIGAAGLALVGASLATILTNGTDDWAGQVKKAEKNRAKMKKALSK |
| Ga0334987_0608684_297_446 | 3300034061 | Freshwater | MEMAIMAGAALLALLGAYFATNLTNGVDVVAQVKKAEKSRAKMKKALTK |
| Ga0334995_0055399_1973_2125 | 3300034062 | Freshwater | MEIAIMIGAAGLALIGASLASLLTNGTDDWAGQVKKAEKNRAKMKKALSK |
| Ga0335028_0231358_303_455 | 3300034071 | Freshwater | MEIAIVIGAAVLALAGASLASLLTNGTDDWAGQVKKAEKSRAKMKKALSK |
| Ga0335027_0006146_2196_2345 | 3300034101 | Freshwater | MEMAIMAGAAILALLGAYFATILTNGVDVVAQVKKAEKSRAKMKKALTK |
| Ga0335031_0185259_849_1001 | 3300034104 | Freshwater | MEIGIVIGAAVIALIGAYFATKLTNGTEDWAGQVEKAERSRAKMKKALSK |
| Ga0335036_0070115_84_236 | 3300034106 | Freshwater | VEIGIVIVAAVLALVGTSLATMLTNGTDDWAGQVKRAEKSRAKMKKALSK |
| ⦗Top⦘ |