| Basic Information | |
|---|---|
| Family ID | F093784 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MTTAVAEALEALVHLRAEHGALTPADVADAVLTHDLDEAEAEA |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 42.45 % |
| % of genes near scaffold ends (potentially truncated) | 99.06 % |
| % of genes from short scaffolds (< 2000 bps) | 98.11 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.63 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.962 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.151 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.132 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (46.226 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.70% β-sheet: 0.00% Coil/Unstructured: 49.30% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.63 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF02511 | Thy1 | 89.62 |
| PF01904 | DUF72 | 2.83 |
| PF12974 | Phosphonate-bd | 0.94 |
| PF07704 | PSK_trans_fac | 0.94 |
| PF04542 | Sigma70_r2 | 0.94 |
| PF05425 | CopD | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 89.62 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 2.83 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.94 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.94 |
| COG1276 | Putative copper export protein | Inorganic ion transport and metabolism [P] | 0.94 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.94 |
| COG4423 | Uncharacterized conserved protein | Function unknown [S] | 0.94 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.96 % |
| Unclassified | root | N/A | 16.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459009|GA8DASG01CDHP8 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 548 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1062534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 528 | Open in IMG/M |
| 3300000893|AP72_2010_repI_A001DRAFT_1064322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 577 | Open in IMG/M |
| 3300000956|JGI10216J12902_109662405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 597 | Open in IMG/M |
| 3300000956|JGI10216J12902_111518730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 526 | Open in IMG/M |
| 3300002568|C688J35102_118309074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 547 | Open in IMG/M |
| 3300002568|C688J35102_118516091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 567 | Open in IMG/M |
| 3300004081|Ga0063454_101645248 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300004153|Ga0063455_100306905 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300004153|Ga0063455_100551373 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300005337|Ga0070682_100635240 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300005339|Ga0070660_101813709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
| 3300005355|Ga0070671_100327765 | All Organisms → cellular organisms → Bacteria | 1305 | Open in IMG/M |
| 3300005367|Ga0070667_101988691 | Not Available | 547 | Open in IMG/M |
| 3300005367|Ga0070667_102114720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 530 | Open in IMG/M |
| 3300005436|Ga0070713_102359000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 515 | Open in IMG/M |
| 3300005439|Ga0070711_100792718 | Not Available | 803 | Open in IMG/M |
| 3300005467|Ga0070706_101519609 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300005564|Ga0070664_100988352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 791 | Open in IMG/M |
| 3300005566|Ga0066693_10410127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 551 | Open in IMG/M |
| 3300005568|Ga0066703_10539838 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300005586|Ga0066691_10941511 | Not Available | 508 | Open in IMG/M |
| 3300005718|Ga0068866_11386185 | Not Available | 513 | Open in IMG/M |
| 3300006028|Ga0070717_10702539 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300006028|Ga0070717_11545376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 602 | Open in IMG/M |
| 3300006031|Ga0066651_10722189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 536 | Open in IMG/M |
| 3300006031|Ga0066651_10782543 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300006638|Ga0075522_10100343 | All Organisms → cellular organisms → Bacteria | 1570 | Open in IMG/M |
| 3300006755|Ga0079222_10951024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 730 | Open in IMG/M |
| 3300006854|Ga0075425_103116882 | Not Available | 505 | Open in IMG/M |
| 3300006871|Ga0075434_101568530 | Not Available | 667 | Open in IMG/M |
| 3300006914|Ga0075436_101038300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 616 | Open in IMG/M |
| 3300007788|Ga0099795_10572076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 535 | Open in IMG/M |
| 3300009012|Ga0066710_100126616 | All Organisms → cellular organisms → Bacteria | 3496 | Open in IMG/M |
| 3300009089|Ga0099828_11604247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 573 | Open in IMG/M |
| 3300009093|Ga0105240_11458445 | Not Available | 718 | Open in IMG/M |
| 3300009162|Ga0075423_12849819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 530 | Open in IMG/M |
| 3300009545|Ga0105237_11211340 | Not Available | 761 | Open in IMG/M |
| 3300009551|Ga0105238_10366916 | All Organisms → cellular organisms → Bacteria | 1430 | Open in IMG/M |
| 3300010133|Ga0127459_1005190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 644 | Open in IMG/M |
| 3300010333|Ga0134080_10516411 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300010362|Ga0126377_11459504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 757 | Open in IMG/M |
| 3300010373|Ga0134128_12874095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 530 | Open in IMG/M |
| 3300012004|Ga0120134_1069101 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300012189|Ga0137388_11115510 | Not Available | 726 | Open in IMG/M |
| 3300012189|Ga0137388_11334746 | Not Available | 656 | Open in IMG/M |
| 3300012200|Ga0137382_10108813 | All Organisms → cellular organisms → Bacteria | 1838 | Open in IMG/M |
| 3300012202|Ga0137363_11703331 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300012208|Ga0137376_11337481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 607 | Open in IMG/M |
| 3300012210|Ga0137378_10603648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1007 | Open in IMG/M |
| 3300012211|Ga0137377_11294429 | Not Available | 659 | Open in IMG/M |
| 3300012212|Ga0150985_113587292 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300012469|Ga0150984_110057541 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300012918|Ga0137396_11176557 | Not Available | 542 | Open in IMG/M |
| 3300012925|Ga0137419_10911506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 724 | Open in IMG/M |
| 3300012927|Ga0137416_11379916 | Not Available | 638 | Open in IMG/M |
| 3300012930|Ga0137407_11074707 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300012951|Ga0164300_10768312 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300012951|Ga0164300_11045538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 529 | Open in IMG/M |
| 3300012985|Ga0164308_10846245 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300012986|Ga0164304_10034349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2629 | Open in IMG/M |
| 3300012987|Ga0164307_11568013 | Not Available | 557 | Open in IMG/M |
| 3300012989|Ga0164305_12057684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
| 3300013104|Ga0157370_11736268 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300013307|Ga0157372_12005908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 665 | Open in IMG/M |
| 3300013763|Ga0120179_1095124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 659 | Open in IMG/M |
| 3300014052|Ga0120109_1062288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 848 | Open in IMG/M |
| 3300015372|Ga0132256_102851692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 581 | Open in IMG/M |
| 3300015373|Ga0132257_101245408 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300017936|Ga0187821_10295768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 642 | Open in IMG/M |
| 3300018468|Ga0066662_12507827 | Not Available | 544 | Open in IMG/M |
| 3300018482|Ga0066669_12069919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 536 | Open in IMG/M |
| 3300024283|Ga0247670_1068718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 644 | Open in IMG/M |
| 3300025912|Ga0207707_10260090 | All Organisms → cellular organisms → Bacteria | 1506 | Open in IMG/M |
| 3300025912|Ga0207707_10717725 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300025914|Ga0207671_11035469 | Not Available | 646 | Open in IMG/M |
| 3300025919|Ga0207657_10814470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 722 | Open in IMG/M |
| 3300025928|Ga0207700_11466846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 606 | Open in IMG/M |
| 3300025929|Ga0207664_11651155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 563 | Open in IMG/M |
| 3300025932|Ga0207690_11626004 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300025944|Ga0207661_11104699 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300026078|Ga0207702_12103619 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300026121|Ga0207683_10532536 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300027875|Ga0209283_10909773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
| 3300028146|Ga0247682_1075056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 620 | Open in IMG/M |
| 3300028778|Ga0307288_10128598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 941 | Open in IMG/M |
| 3300028799|Ga0307284_10328135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 617 | Open in IMG/M |
| 3300028872|Ga0307314_10084977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 845 | Open in IMG/M |
| 3300031668|Ga0318542_10572896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 588 | Open in IMG/M |
| 3300031713|Ga0318496_10066437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1893 | Open in IMG/M |
| 3300031720|Ga0307469_10876312 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300031747|Ga0318502_10196366 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
| 3300031769|Ga0318526_10042767 | All Organisms → cellular organisms → Bacteria | 1704 | Open in IMG/M |
| 3300031769|Ga0318526_10484286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 505 | Open in IMG/M |
| 3300031770|Ga0318521_10186461 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300031782|Ga0318552_10324597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 783 | Open in IMG/M |
| 3300031938|Ga0308175_100581073 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
| 3300031942|Ga0310916_10178189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1769 | Open in IMG/M |
| 3300031954|Ga0306926_13014505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 502 | Open in IMG/M |
| 3300031959|Ga0318530_10479793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
| 3300032010|Ga0318569_10075118 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
| 3300032041|Ga0318549_10088363 | All Organisms → cellular organisms → Bacteria | 1337 | Open in IMG/M |
| 3300032044|Ga0318558_10207066 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300032052|Ga0318506_10464458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 561 | Open in IMG/M |
| 3300032770|Ga0335085_10855183 | Not Available | 996 | Open in IMG/M |
| 3300033412|Ga0310810_10816438 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.15% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.66% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 4.72% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.77% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.77% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.89% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.94% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.94% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.94% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.94% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.94% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459009 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010133 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300012004 | Permafrost microbial communities from Nunavut, Canada - A30_5cm_6M | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013763 | Permafrost microbial communities from Nunavut, Canada - A15_65cm_0M | Environmental | Open in IMG/M |
| 3300014052 | Permafrost microbial communities from Nunavut, Canada - A23_35cm_12M | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F47_05319230 | 2170459009 | Grass Soil | LTEISMTAAVAETLDTLVHLRQEHGTLTPADVAEAVLTFDLDEAEAEALSQDACGARHCARAG |
| AP72_2010_repI_A100DRAFT_10625341 | 3300000837 | Forest Soil | LTDITMTTAVADALEALLHLRDEHGAITPADVADAVLSHDLDEAET |
| AP72_2010_repI_A001DRAFT_10643221 | 3300000893 | Forest Soil | LTDITMTTAVADALEALLHLRDEHGAITPADVADAVLSHDLDEAETEALNHELDAHGAAP |
| JGI10216J12902_1096624052 | 3300000956 | Soil | MTAAVAEALEALLLLRTEQGALTPADVADAVLTHD |
| JGI10216J12902_1115187302 | 3300000956 | Soil | MTGINTTAAVAEALEGLLHLREEHGAITPADVADAVLAHDLDEAEAESLA |
| C688J35102_1183090742 | 3300002568 | Soil | LTEISMTAISTTAAVAEALEGLLHLRDEHGAITPADVADA |
| C688J35102_1185160912 | 3300002568 | Soil | MTAAVAEALDTLIHLRQEHGALTPADVADAVLTHDLDEAEAETLALELTAHDI |
| Ga0063454_1016452482 | 3300004081 | Soil | MTTAVAEALDALVHLRGEHGALTPADVAEAVLTHDLDESEAEALNLEL |
| Ga0063455_1003069051 | 3300004153 | Soil | MTTAVHDALEALLALRLEHGTILPADVAEAVLTHDLDETEAEAL |
| Ga0063455_1005513731 | 3300004153 | Soil | LTEISMTAAVAEALDTLVHLRGEHGALTPADVADAVLTHDLDEA |
| Ga0070682_1006352401 | 3300005337 | Corn Rhizosphere | MTPAVHDALEALLALRAEHNVLTAADVADAVLTNDLDEAEAEEL |
| Ga0070660_1018137091 | 3300005339 | Corn Rhizosphere | MTAISTSKAVAEAFEGLIHLRDEHGAITPADVADAVLAHDLDEAEAEILTLELDAHG |
| Ga0070671_1003277651 | 3300005355 | Switchgrass Rhizosphere | MTAATAEALDALIHLRQEHGALTPADVAEAVLTHDLDEAE |
| Ga0070667_1019886911 | 3300005367 | Switchgrass Rhizosphere | MTTAVHDALEALLALRLEHGTITPADVAEAVLTHDLDETESEAL |
| Ga0070667_1021147202 | 3300005367 | Switchgrass Rhizosphere | LTDISMTAISTSKAVAEAFEALILVRDEHGAITPADVADAVLA |
| Ga0070713_1023590001 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MTAAVAEALETLIHLREEHGVLTPADVAEAVLTFELDEPEAEALN |
| Ga0070711_1007927181 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MTAATAEALDTLVLLHAEHSVLTPADVADAVLTFDLDEAEAEALAAELKAHEIAPE |
| Ga0070706_1015196091 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPAVHDALEALLALRAEHNVLTAADVADAVLTNDLDEAEAEELA |
| Ga0070664_1009883521 | 3300005564 | Corn Rhizosphere | MTAISTSKAVAEAFEALILVRDEHGAITPADVADAVLAHDLDDAEAEILTLELDAHGAAPEQEEE |
| Ga0066693_104101272 | 3300005566 | Soil | LTEISMTAAVAEALDTLIHLRGEHGSLTPADVADAV |
| Ga0066703_105398381 | 3300005568 | Soil | MTAAVAEALEALLHVRDEHGAITPADVADAVLAHDLDE |
| Ga0066691_109415112 | 3300005586 | Soil | LTEISMTAAVAEALEALLHLRGEHGALTPADVADAVLT |
| Ga0068866_113861851 | 3300005718 | Miscanthus Rhizosphere | LTDISMTTAVHDALEALLALRLEHGTITPADVAEAVLTHDLDETESEALALEL |
| Ga0070717_107025392 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LTEISMTAAVAEALEALLTLRTEHGSITPADVADAVLTHDLDEAE |
| Ga0070717_115453762 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LTEINLTAAVADALYALHLPPTENGAITAADVADQVLTHDLDENEA |
| Ga0066651_107221891 | 3300006031 | Soil | MTTAVHDALEALLHLRAENGALTPADLADAVLTHDLDEVEAETLAHELENHGA |
| Ga0066651_107825432 | 3300006031 | Soil | LTEITMTTAVAEALEALLHLRDEHGAITPADIADAVLAHDLDEAEAEALQHELDAH |
| Ga0075522_101003433 | 3300006638 | Arctic Peat Soil | LTEISMTAAVAEALEGLLTLRTEHGALTPADVADA |
| Ga0079222_109510242 | 3300006755 | Agricultural Soil | MTAISTSKAVAEAFEALIHLRDEHGAITPADVADAVLAHDLDDAEAEILTLELDAHGAAPEQE |
| Ga0075425_1031168822 | 3300006854 | Populus Rhizosphere | LTDISMTTAVHDALEALLAHRLEHGTITPADVAEAVLTHD |
| Ga0075434_1015685302 | 3300006871 | Populus Rhizosphere | LTDISMTTAVHDALEALLAHRLEHGTITPADVAEAVLTHDLDETEAEALARELEDHGAAPEP |
| Ga0075436_1010383001 | 3300006914 | Populus Rhizosphere | MTTAVAEALDALVHLREEHGALTPADVADAVLTHDLDETEAEALNLELA |
| Ga0099795_105720761 | 3300007788 | Vadose Zone Soil | MTPAVHDALEALLALRTEHNVLTAADVADAVLTNDLDEAEAV |
| Ga0066710_1001266161 | 3300009012 | Grasslands Soil | MTAAVAEALEALLHLRDEHGVITPADVADAVLAHD |
| Ga0099828_116042471 | 3300009089 | Vadose Zone Soil | LTNISLTEISTTQAVAEALEALLHLRDEHGAITPADIADAVLSHDLDEAEAEALA |
| Ga0105240_114584452 | 3300009093 | Corn Rhizosphere | MTPAVHDALEALLALRAEHNVLTAADVADAVLTNDLDE |
| Ga0075423_128498192 | 3300009162 | Populus Rhizosphere | LTEITMTTAVAEALEALLHLRDEHGSITPADIADAVLAHDLDEAETEALQH |
| Ga0105237_112113402 | 3300009545 | Corn Rhizosphere | MTPAVHDALEALLALRAEHNVLTAADVADAVLTNDLDETEAEELAHEL |
| Ga0105238_103669163 | 3300009551 | Corn Rhizosphere | LTEIAMTAATAEALDALIHLRQEHGALTPADVAEAVLTHD |
| Ga0127459_10051902 | 3300010133 | Grasslands Soil | LTEISMTAAVAEALDTLIHLRQEHGALTPADVADAVLTHDLDEAEAETLALELTAQDIAP |
| Ga0134080_105164111 | 3300010333 | Grasslands Soil | LTEITMTAAVAEALDALMHLRTEHGSLTPADVADAVLTHD |
| Ga0126377_114595041 | 3300010362 | Tropical Forest Soil | MTTAVAEALDALVHLRQEHGALTPADVADAVITHDLDETEAEALNLE |
| Ga0134128_128740951 | 3300010373 | Terrestrial Soil | MVRRSLTEISMTGINTTAAVAEALEGLLHLREEHGAITPADVADAVLAHDLDEAEAE |
| Ga0120134_10691011 | 3300012004 | Permafrost | LTNISMTEISTTQAVAEALEALLHLRDEHGVITPADVADAVLSHDLDEAETEALAHELDA |
| Ga0137388_111155102 | 3300012189 | Vadose Zone Soil | MTPAVHDALEALLALRAEHNVLTAADVADAVLTNDLDEGEAEELAHELESHGAAPEAEE |
| Ga0137388_113347462 | 3300012189 | Vadose Zone Soil | MTAAVAEALEALLHLRGEHGALTPADVADAVLTHDLDD |
| Ga0137382_101088133 | 3300012200 | Vadose Zone Soil | LTHITMTTAVHDALEALLHLRAENGAITPANLADAVLTHDLDEVEAETL |
| Ga0137363_117033312 | 3300012202 | Vadose Zone Soil | MTPAVHDALEALLALRAEHNVLTAADVADAVLTNDLDEAEAEELAHELESHGAAP |
| Ga0137376_113374812 | 3300012208 | Vadose Zone Soil | LTNISLTEISTTQAVAEALEALLHLRDEHGVITPADVADAVLSHDLDE |
| Ga0137378_106036481 | 3300012210 | Vadose Zone Soil | MTAAVADALDALLHLRDEHGSITPADVADAVLTHDLDEAESE |
| Ga0137377_112944291 | 3300012211 | Vadose Zone Soil | MTAAVAEALEALLHLRGEHGALTPADVADAVLTTTSTTPR |
| Ga0150985_1135872923 | 3300012212 | Avena Fatua Rhizosphere | MTTAVHDALEALLALRLEHGTITPADVAEAVLTHDLDETEAE |
| Ga0150984_1100575413 | 3300012469 | Avena Fatua Rhizosphere | MTTAVHDALEALLALRLEHGTITPADVAEAVLTHDLDETEAEALA |
| Ga0137396_111765572 | 3300012918 | Vadose Zone Soil | MTAAVHDALEALLHLRSEHGTITPADVADAVLTNDLDEGEA |
| Ga0137419_109115061 | 3300012925 | Vadose Zone Soil | MTPAVHDALEALLALRSEHNVLTAADVADAVLTNDLDEAEAEELAHELESH |
| Ga0137416_113799161 | 3300012927 | Vadose Zone Soil | MTAAVHDALEALLHLRSEHGTITPADVADAVLTNDLDEGEAETLAHELEEHGAAPEAEEE |
| Ga0137407_110747071 | 3300012930 | Vadose Zone Soil | MTTAVAEALEALVHLRAEHGALTPADVADAVLTHDLDEAEAEA |
| Ga0164300_107683121 | 3300012951 | Soil | MTTAVAEALDALVHLRQEHGALTPADVAEAVLTHDLD |
| Ga0164300_110455381 | 3300012951 | Soil | MTTAVAEALEALLHLRDEHGAITPADIADAVLAHDLDEAETEALALELD |
| Ga0164308_108462452 | 3300012985 | Soil | LTDIRMTGISTTTAVAEGLEGLLQLRDEHGALPPA |
| Ga0164304_100343494 | 3300012986 | Soil | LTDISMTTAVHDALEALLALRLEHGTITPADVAEAVLTHDLDETESEALALELE |
| Ga0164307_115680132 | 3300012987 | Soil | MTAAVADALEGLLTLRTEHGALTPADVADAVLTHDLDEAE |
| Ga0164305_120576842 | 3300012989 | Soil | LTDIRMTGISTTTAVAEALEGLLHLRDEHGALTPADVADAVLAHDL |
| Ga0157370_117362681 | 3300013104 | Corn Rhizosphere | MTTAVAEALDALVHLRQEHGALTPADVADAVITHDLDENE |
| Ga0157372_120059082 | 3300013307 | Corn Rhizosphere | LTEITLTAATAEALDALIHLREEHGALTSADVADAVLTHDLDEAEAETLAHELATHEIAP |
| Ga0120179_10951241 | 3300013763 | Permafrost | MTPAVHDALEALLALRSEHHVLTAADVADAVLTNDLDQAEA |
| Ga0120109_10622882 | 3300014052 | Permafrost | LTNISLTEISTTQAVAEALEALLHLRDEHGVITPADVADAVLSHDLDEAETEALAHELDA |
| Ga0132256_1028516921 | 3300015372 | Arabidopsis Rhizosphere | LTDISMTAISTSKAVAEAFEGLIHLRDEHGAITPADVAD |
| Ga0132257_1012454082 | 3300015373 | Arabidopsis Rhizosphere | MTAISTSKAVAEAFEGLIHLRDEHGAITPADVADAVLAHDLDDAEAEILTLELDAHGAAPEQE |
| Ga0187821_102957682 | 3300017936 | Freshwater Sediment | MTTAAVQEALEALLHLRDEHGSLTPADVADAVLAHDLDDAEAETLQAELEA |
| Ga0066662_125078272 | 3300018468 | Grasslands Soil | LTDTRMTTAAVHDALEALLALRDEQGSLTPADVADAVLTNDL |
| Ga0066669_120699192 | 3300018482 | Grasslands Soil | LTEIAMTPATAEAFDTLIHLRQEHGALTPAALADAVLAHAVA |
| Ga0247670_10687181 | 3300024283 | Soil | MTPAVHDALEALLALRAEHNVLTAADVADAVLTNDLDETEAEE |
| Ga0207707_102600903 | 3300025912 | Corn Rhizosphere | MTPAVHDALEALLALRAEHNVLTAADVADAVLTNDLDEAEAEELAHELESHGAAPEAE |
| Ga0207707_107177251 | 3300025912 | Corn Rhizosphere | MTTAVAEALDALVHLRQEQGALAPADVAEAVLTHDLDE |
| Ga0207671_110354691 | 3300025914 | Corn Rhizosphere | MTPAVHDALEALLALRAEHNVLTAADVADAVLTNDLDETEAEELAHELE |
| Ga0207657_108144702 | 3300025919 | Corn Rhizosphere | MTAAVSEALEALLALRAEHGALTPADVADAVLTHDLDEAEAEALAQEL |
| Ga0207700_114668461 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LTEISMTAAVAEALETLIHLREEHGVLTPADVAEAVLTFELDEPEAEALN |
| Ga0207664_116511551 | 3300025929 | Agricultural Soil | MTAATAEALDALIHLRQEHGALTPADVAEAVLTHDLDEAEAEALSLELAAHDI |
| Ga0207690_116260041 | 3300025932 | Corn Rhizosphere | LTDISMTAISTSKAVAEAFEGLIHLRDEHGAITPADVADAVLAHDLDE |
| Ga0207661_111046991 | 3300025944 | Corn Rhizosphere | MTTAVAEALDALVHLREEHGALTPADVADAVLTHDLDETEAEALNLELAAHDI |
| Ga0207702_121036191 | 3300026078 | Corn Rhizosphere | MTTAVAEALDALVHLREEHGALTPADVADAVLNHDLDETEAEALNLELA |
| Ga0207683_105325361 | 3300026121 | Miscanthus Rhizosphere | MTAATAEALDALIHLRQEHGALTPADVAEAVLTHDLDEAEAE |
| Ga0209283_109097732 | 3300027875 | Vadose Zone Soil | LTNISLTEISTTQAVAEALEALLHLRDEHGAITPADIADAVLSHD |
| Ga0247682_10750562 | 3300028146 | Soil | MTPAVHDALEALLALRAEHNVLTAADVADAVLTNDLDETEA |
| Ga0307288_101285983 | 3300028778 | Soil | MTAISTSKAVAEAFEALIHLRDEHGAITPADVADAVIAHDLDDA |
| Ga0307284_103281352 | 3300028799 | Soil | MTPAVHDALEALLALRAEHNVLTAADVADAVLTNDLDEAEAEELAHELESHGAAPEAEE |
| Ga0307314_100849773 | 3300028872 | Soil | MTAISTSKAVAEAFEALIHLRDEHGAITPADVADAVLAHDLDEAEAEGLALE |
| Ga0318542_105728962 | 3300031668 | Soil | MISAAVSDALEALLALRDEHGSLTPDDVADQVPTHDLDDAE |
| Ga0318496_100664371 | 3300031713 | Soil | MISAAVSDALEALLALRDEHGSLTPDDVADQVLTHDLDDAEAEALGAELDAHGAAP |
| Ga0307469_108763122 | 3300031720 | Hardwood Forest Soil | MTAATAEALDALIHLRQEHGALTPADVADAVLTHDLDE |
| Ga0318502_101963662 | 3300031747 | Soil | MTTAVAEALEQLLNLRAEHGSITPAEVADTVLAHDLDEQEAE |
| Ga0318526_100427671 | 3300031769 | Soil | MTTAVAEALEQLLNLRAEHGSITPAEVADTVLAHDLDEQEAEALEHELEAHGAAPELEEE |
| Ga0318526_104842861 | 3300031769 | Soil | MISAAVSDALEALLALRDEHGSLTPDDVADQVLTHDLDDAEAEALGAELD |
| Ga0318521_101864612 | 3300031770 | Soil | MISAAVSDALEALLALRDEHGSLTPDDVADQVLTHDLDDAEA |
| Ga0318552_103245971 | 3300031782 | Soil | MTTAVAEALEQLLNLRAEHGSITPAEVADAVLAHDLDEQEAETLEHELEAHGAA |
| Ga0308175_1005810731 | 3300031938 | Soil | MTTAVAEALDALVHLRGEHGALTPADVAEAVLTHDLDENEAEAL |
| Ga0310916_101781894 | 3300031942 | Soil | MTTAVAEALEQLLNLRAEHGSITPAEVADTVLAHDLDEQEAEALEHELE |
| Ga0306926_130145051 | 3300031954 | Soil | MTTAVAEALEQLLNLRAEHGSITPAEVADTVLAHDLDEQEAEALEHELEAHGAAP |
| Ga0318530_104797932 | 3300031959 | Soil | MTTAVAEALEQLLNLRAEHGSITPAEVADTVLAHDLDEQEAEALEHELEAHGAA |
| Ga0318569_100751181 | 3300032010 | Soil | MISAAVSDALEALLALRDEHGSLTPDDVADQVLTHDLDDAE |
| Ga0318549_100883633 | 3300032041 | Soil | MISAAVSDALEALLALRDEHGSLTPDDVADQVLTHDLDDAEAE |
| Ga0318558_102070661 | 3300032044 | Soil | MISAAVSDALEALLALRDEHGSLTPDDVADQVLTHDLDDAEAEALGV |
| Ga0318506_104644582 | 3300032052 | Soil | MTTAVAEALEQLLNLRAEHGSITPAEVADTVLAHDLDEQEAEALE |
| Ga0335085_108551832 | 3300032770 | Soil | MTAATAEALDTLVLLHAEHSVLTPADVADAVLTFDLDEAEAEALQAELKAH |
| Ga0310810_108164381 | 3300033412 | Soil | MTTAVAEALDALVHLREEHGALTPADVADAVLTHD |
| ⦗Top⦘ |