NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F093748

Metagenome / Metatranscriptome Family F093748

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F093748
Family Type Metagenome / Metatranscriptome
Number of Sequences 106
Average Sequence Length 40 residues
Representative Sequence MNTPRHSIARSAFGAAWSLALGMVGVAGKRQAGNGPAPI
Number of Associated Samples 91
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.77 %
% of genes near scaffold ends (potentially truncated) 34.91 %
% of genes from short scaffolds (< 2000 bps) 89.62 %
Associated GOLD sequencing projects 82
AlphaFold2 3D model prediction Yes
3D model pTM-score0.31

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (70.755 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(15.094 % of family members)
Environment Ontology (ENVO) Unclassified
(55.660 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(66.981 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: Yes Secondary Structure distribution: α-helix: 44.78%    β-sheet: 0.00%    Coil/Unstructured: 55.22%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.31
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF01960ArgJ 45.28
PF07690MFS_1 27.36
PF05977MFS_3 17.92
PF01071GARS_A 0.94
PF13302Acetyltransf_3 0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG1364Glutamate N-acetyltransferase (ornithine transacetylase)Amino acid transport and metabolism [E] 45.28
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 17.92
COG0458Carbamoylphosphate synthase large subunitAmino acid transport and metabolism [E] 1.89
COG0026Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase)Nucleotide transport and metabolism [F] 0.94
COG0027Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase)Nucleotide transport and metabolism [F] 0.94
COG0045Succinyl-CoA synthetase, beta subunitEnergy production and conversion [C] 0.94
COG0151Phosphoribosylamine-glycine ligaseNucleotide transport and metabolism [F] 0.94
COG0439Biotin carboxylaseLipid transport and metabolism [I] 0.94
COG1038Pyruvate carboxylaseEnergy production and conversion [C] 0.94
COG1181D-alanine-D-alanine ligase or related ATP-grasp enzymeCell wall/membrane/envelope biogenesis [M] 0.94
COG4770Acetyl/propionyl-CoA carboxylase, alpha subunitLipid transport and metabolism [I] 0.94

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms70.75 %
UnclassifiedrootN/A29.25 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918007|ConsensusfromContig155788Not Available646Open in IMG/M
3300003579|Ga0007429J51699_1106634All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. HMWF004545Open in IMG/M
3300004282|Ga0066599_100897087Not Available634Open in IMG/M
3300005164|Ga0066815_10054041Not Available670Open in IMG/M
3300005327|Ga0070658_10165148All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1858Open in IMG/M
3300005327|Ga0070658_11023118Not Available719Open in IMG/M
3300005328|Ga0070676_10001230All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales12876Open in IMG/M
3300005331|Ga0070670_100092499All Organisms → cellular organisms → Bacteria2600Open in IMG/M
3300005331|Ga0070670_100108780All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium2389Open in IMG/M
3300005333|Ga0070677_10126916All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1159Open in IMG/M
3300005333|Ga0070677_10145563Not Available1097Open in IMG/M
3300005347|Ga0070668_100015147All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium5761Open in IMG/M
3300005355|Ga0070671_100057220All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales3245Open in IMG/M
3300005356|Ga0070674_100322728All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin0181238Open in IMG/M
3300005356|Ga0070674_101481408All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. HMWF004609Open in IMG/M
3300005364|Ga0070673_101271928Not Available690Open in IMG/M
3300005367|Ga0070667_100519576All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. HMWF0041092Open in IMG/M
3300005455|Ga0070663_100575118All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales944Open in IMG/M
3300005459|Ga0068867_101090060Not Available729Open in IMG/M
3300005539|Ga0068853_100484979All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. HMWF0041166Open in IMG/M
3300005539|Ga0068853_101048630All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. HMWF004786Open in IMG/M
3300005547|Ga0070693_100170241All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium1394Open in IMG/M
3300005564|Ga0070664_101377758All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. HMWF004667Open in IMG/M
3300005578|Ga0068854_100118548All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium2006Open in IMG/M
3300005834|Ga0068851_10073125All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1777Open in IMG/M
3300005841|Ga0068863_100612109All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1079Open in IMG/M
3300005842|Ga0068858_101093680All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. HMWF004782Open in IMG/M
3300006028|Ga0070717_11434821All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. HMWF004627Open in IMG/M
3300006031|Ga0066651_10481523All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. HMWF004658Open in IMG/M
3300006046|Ga0066652_100114032All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2205Open in IMG/M
3300006642|Ga0075521_10021775All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium2619Open in IMG/M
3300006881|Ga0068865_100930154All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. HMWF004758Open in IMG/M
3300009029|Ga0066793_10718883All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. HMWF004567Open in IMG/M
3300009137|Ga0066709_103132110Not Available604Open in IMG/M
3300009148|Ga0105243_10819846All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. HMWF004919Open in IMG/M
3300009148|Ga0105243_12291106Not Available577Open in IMG/M
3300009156|Ga0111538_10646797All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1340Open in IMG/M
3300009176|Ga0105242_12787276All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. HMWF004539Open in IMG/M
3300009177|Ga0105248_10363076All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium1630Open in IMG/M
3300010036|Ga0126305_10448379All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. HMWF004856Open in IMG/M
3300010325|Ga0134064_10454659Not Available523Open in IMG/M
3300012212|Ga0150985_102674469All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. HMWF004606Open in IMG/M
3300012212|Ga0150985_117781094All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. HMWF004710Open in IMG/M
3300012493|Ga0157355_1036842Not Available531Open in IMG/M
3300012509|Ga0157334_1064772Not Available536Open in IMG/M
3300012898|Ga0157293_10035655All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1031Open in IMG/M
3300012902|Ga0157291_10243564All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. HMWF004594Open in IMG/M
3300012905|Ga0157296_10067341All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. HMWF004893Open in IMG/M
3300012910|Ga0157308_10360815Not Available552Open in IMG/M
3300012951|Ga0164300_10473314Not Available709Open in IMG/M
3300013102|Ga0157371_10117616All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1889Open in IMG/M
3300013102|Ga0157371_10321873All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. HMWF0041122Open in IMG/M
3300013105|Ga0157369_10171565All Organisms → cellular organisms → Bacteria2285Open in IMG/M
3300013105|Ga0157369_11074688All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. HMWF004823Open in IMG/M
3300013296|Ga0157374_10427819All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium1323Open in IMG/M
3300013306|Ga0163162_12039768Not Available657Open in IMG/M
3300014745|Ga0157377_10559542All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales809Open in IMG/M
3300015075|Ga0167636_1030125Not Available686Open in IMG/M
3300015085|Ga0167632_1004668All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2008Open in IMG/M
3300015373|Ga0132257_100814233Not Available1166Open in IMG/M
3300015373|Ga0132257_103188394All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. HMWF004597Open in IMG/M
3300015374|Ga0132255_100483491All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1817Open in IMG/M
3300017792|Ga0163161_10486696All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. HMWF0041002Open in IMG/M
3300017965|Ga0190266_10100156All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1188Open in IMG/M
3300018083|Ga0184628_10217433All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. HMWF0041001Open in IMG/M
3300018469|Ga0190270_10334608All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1368Open in IMG/M
3300018476|Ga0190274_11841031All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. HMWF004700Open in IMG/M
3300018920|Ga0190273_10628967All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria817Open in IMG/M
3300019356|Ga0173481_10379696All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. HMWF004684Open in IMG/M
3300019361|Ga0173482_10577055Not Available561Open in IMG/M
3300019767|Ga0190267_10319770All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales817Open in IMG/M
3300021082|Ga0210380_10252765Not Available800Open in IMG/M
3300023275|Ga0247776_10387314All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. HMWF004514Open in IMG/M
3300025315|Ga0207697_10036812All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2004Open in IMG/M
3300025321|Ga0207656_10063442All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1626Open in IMG/M
3300025321|Ga0207656_10397711All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. HMWF004692Open in IMG/M
3300025893|Ga0207682_10478176All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. HMWF004590Open in IMG/M
3300025899|Ga0207642_10615649Not Available677Open in IMG/M
3300025901|Ga0207688_10126442All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1495Open in IMG/M
3300025903|Ga0207680_10273839All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. HMWF0041171Open in IMG/M
3300025909|Ga0207705_10707418Not Available783Open in IMG/M
3300025909|Ga0207705_11172249Not Available590Open in IMG/M
3300025920|Ga0207649_10779069All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. HMWF004745Open in IMG/M
3300025925|Ga0207650_10263589All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1398Open in IMG/M
3300025925|Ga0207650_10905112All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. HMWF004749Open in IMG/M
3300025935|Ga0207709_10855203Not Available737Open in IMG/M
3300025937|Ga0207669_10453861All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. HMWF0041016Open in IMG/M
3300025938|Ga0207704_11142905Not Available663Open in IMG/M
3300025941|Ga0207711_10701096Not Available944Open in IMG/M
3300026075|Ga0207708_10752045Not Available837Open in IMG/M
3300026078|Ga0207702_10294395All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1539Open in IMG/M
3300026088|Ga0207641_10589857All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium1087Open in IMG/M
3300026121|Ga0207683_10229810All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin0181691Open in IMG/M
3300026294|Ga0209839_10097003All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1009Open in IMG/M
3300028596|Ga0247821_10402987All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. HMWF004854Open in IMG/M
3300028596|Ga0247821_11245751Not Available507Open in IMG/M
3300028803|Ga0307281_10220506Not Available689Open in IMG/M
3300028809|Ga0247824_10296733All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales909Open in IMG/M
3300031096|Ga0308193_1085080Not Available524Open in IMG/M
3300031226|Ga0307497_10184041All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales893Open in IMG/M
3300031854|Ga0310904_10431265All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. HMWF004870Open in IMG/M
3300031858|Ga0310892_10648150Not Available720Open in IMG/M
3300031938|Ga0308175_102437914Not Available586Open in IMG/M
3300031939|Ga0308174_10119501All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1919Open in IMG/M
3300031939|Ga0308174_10340878All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium1192Open in IMG/M
3300032075|Ga0310890_10673759All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales808Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil15.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil8.49%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere8.49%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere6.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere6.60%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere6.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.77%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.77%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.77%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.83%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.83%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere2.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.89%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.89%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.94%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.94%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.94%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.94%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.94%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.94%
Glacier Forefield SoilsEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soils0.94%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.94%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.94%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.94%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918007Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_allEnvironmentalOpen in IMG/M
3300003579Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only)Host-AssociatedOpen in IMG/M
3300004282Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sedimentEnvironmentalOpen in IMG/M
3300005164Soil and rhizosphere microbial communities from Laval, Canada - mgLACEnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012493Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610EnvironmentalOpen in IMG/M
3300012509Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012902Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015075Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G5C, Northern proglacial tributary margin, adjacent to top of river)EnvironmentalOpen in IMG/M
3300015085Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4B, Ice margin, adjacent to proglacial lake)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300023275Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L199-509C-5EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026294Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)EnvironmentalOpen in IMG/M
3300028596Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300031096Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
A_all_C_027057802140918007SoilMNTPRLTIARSASGAAWSLAHGCGMRLAGNGPAPI
Ga0007429J51699_110663413300003579Avena Fatua RhizosphereMNTPRHSIARSAFRAAWSLALGMVGVAGKREAGNGPAPI*
Ga0066599_10089708723300004282FreshwaterMNTTRLTTARSASGAAWSLAHGFGGVAVKRVAGNGPAPI*
Ga0066815_1005404113300005164SoilMNTPRLTIARCASGAAWSLAHGFCGVTGTGLAGNSPAPI*
Ga0070658_1016514823300005327Corn RhizosphereMNTPRHSIARSAFGAAWSLALGRVGVAGKRQSGNGPAPI*
Ga0070658_1102311813300005327Corn RhizosphereMPALESPQSMNTPRHSIARSAFGAAWSLALGRVGVADERQAGNGPAPI*
Ga0070676_10001230143300005328Miscanthus RhizosphereMNTPRHSIARSAFGAAWSLALGMVGVAGERQAGNGPAPI*
Ga0070670_10009249913300005331Switchgrass RhizosphereMNTPRHPIVRSAFRAAGSLALGKVGVAANGQAGNGPAPI*
Ga0070670_10010878033300005331Switchgrass RhizosphereMNTPRHSTARSASSAAWSLALGMVGVAGKRQAGNGPAPI*
Ga0070677_1012691623300005333Miscanthus RhizosphereMNTPRHSIARSAFGAAWSLALGMVGVAGKRQSGNGPAPI*
Ga0070677_1014556323300005333Miscanthus RhizosphereMNTPRHSIARSAFSAAWSLALGLVGVAGKRQAGNGPAPI*
Ga0070668_10001514773300005347Switchgrass RhizosphereQPMNTPRHSIARSAFGAAWSLALGMVGVAGERQAGNGPAPI*
Ga0070671_10005722033300005355Switchgrass RhizosphereMNTPRHSIARSAFGAAWSLALGVVGVAGKRESGNGSAPI*
Ga0070674_10032272823300005356Miscanthus RhizosphereMNTPRHSIARSAFGAAWSLALGVVGVAGKRESGNGPAPI*
Ga0070674_10148140823300005356Miscanthus RhizosphereLLESPHPMNTPRHSIARSAFGAAWSLALGMVGVAGKRQSGNGPAPI*
Ga0070673_10127192813300005364Switchgrass RhizosphereMNTPRHSIARSAFSAAWSLALGMVGVAGKRQAGNGPAPI*
Ga0070667_10051957613300005367Switchgrass RhizosphereQPMNTPRHSIARSAFGAAWSLALGMVGVAGKRQSGNGPAPI*
Ga0070663_10057511823300005455Corn RhizosphereMSTPRHSIARSAFGAAWSLALGRVGIAGKRQSGNGPAPI*
Ga0068867_10109006023300005459Miscanthus RhizosphereMNTPRHSIARSASGAAWSLALGMVGVAGKRQAGNGPAPI*
Ga0068853_10048497923300005539Corn RhizospherePMNTPRHSIARSAFGAAWSLALGMVGVAGERQAGNGPAPI*
Ga0068853_10104863013300005539Corn RhizospherePMNTPRHSIARSAFGAAWSLALGMVGVAGKRQAGNGPAPI*
Ga0070693_10017024123300005547Corn, Switchgrass And Miscanthus RhizosphereMNTPRHSIARSAFGAAWSLALGMVGVAGKRQAGNGPAPI*
Ga0070664_10137775813300005564Corn RhizosphereRHSIARSAFGAAWSLALGMVGVAGERQAGNGPAPI*
Ga0068854_10011854813300005578Corn RhizosphereKARNMNTPRHSIARSAFSAAWSLALGLVGVAGKRQAGNGPAPI*
Ga0068851_1007312523300005834Corn RhizosphereMNTPRHSIARSAFGAAWSLALGMVGVAGQRESGNGPAPI*
Ga0068863_10061210923300005841Switchgrass RhizosphereMNTLRHSIARSAFGAAWSLALGRVGVAGKRQSGNGPAPI*
Ga0068858_10109368013300005842Switchgrass RhizospherePQPMNTPRHSIARSAFGAAWSLALGMVGVAGKRQSGNGPAPI*
Ga0070717_1143482113300006028Corn, Switchgrass And Miscanthus RhizosphereRHSIARSAFGAAWSLALGMVGVAGKREAGNGPAPI*
Ga0066651_1048152323300006031SoilPHPMNTPRHSIARSAFGAAWSLALGRVGVAGKRQSGNGPAPI*
Ga0066652_10011403223300006046SoilMNTPRHSIARSAFGAAWSLALGMVGVAGKREAGNGPAPI*
Ga0075521_1002177543300006642Arctic Peat SoilMNRTPFTTARSAFGAAWPLVLGTVGIAGKRLSGMAPAQI*
Ga0068865_10093015413300006881Miscanthus RhizosphereMSTPRHSIARSAFGAAWSLALGRVGVAGKRQSGNGPAPI*
Ga0066793_1071888313300009029Prmafrost SoilNTPRLTIARSASGAAWSLAHGFGGVAGKRLASIGPAPI*
Ga0066709_10313211033300009137Grasslands SoilMNTPRHSIARSALGAAWSLALGTGVGVAGKREAGNGPAPI*
Ga0105243_1081984613300009148Miscanthus RhizosphereRHSIARSAFGAAWSLALGVVGVAGKRESGNGPAPI*
Ga0105243_1229110623300009148Miscanthus RhizosphereMNTPRHSIARSASGAAWSLALGMVGVAGTRQAGNGPAPI*
Ga0111538_1064679713300009156Populus RhizosphereLESPQPMNTPRHSIARSASGAARSLALGMVGVAGKRQAGNGPAPI*
Ga0105242_1278727623300009176Miscanthus RhizosphereESPHPMNTPRHPIARSAFGAAWSLALGRVGVAGKRQSGNGPAPI*
Ga0105248_1036307623300009177Switchgrass RhizosphereMNTPRHSTARSALSAAWSLALGMVGVAGKRQAGNGPAPI*
Ga0126305_1044837923300010036Serpentine SoilMNTPRHSIARSAFRAAWSLALGMVGVAGQRHVGNGPAPI*
Ga0134064_1045465923300010325Grasslands SoilMNTPRHSIARSAFGAAWSLALGMVGVAGKREAVNGPAPI*
Ga0150985_10267446913300012212Avena Fatua RhizosphereQPMNTPRHSIARSAFGAAWSLALGRVGVAGKRQSGNGPAPI*
Ga0150985_11778109423300012212Avena Fatua RhizosphereKPAPMNTPRHSIARSAFGAAWSLALGMVGVAGKREAGNGPAPI*
Ga0157355_103684223300012493Unplanted SoilMNTPRHSIARSASGAAWSLALGMVGVAGKRQSGNGPAPI*
Ga0157334_106477223300012509SoilMNTPRHSIARSAFGAAWSLALGMVGVADKRESGNGPAPI*
Ga0157293_1003565523300012898SoilMNTPRHPIARSAFGAAWSLALGMVGVAGKRQSGNGPAPI*
Ga0157291_1024356423300012902SoilKARNMNTPRHSIVRSAFSAAWSLALGMVGVAGKRQAGNGPAPI*
Ga0157296_1006734113300012905SoilTPRHSIARSAFGAARSLALGMVGVAGKRQAGNGPAPI*
Ga0157308_1036081523300012910SoilMNTPRHPIARSAFGAAWSLALGMVGVAGKRQSGNGPAPT*
Ga0164300_1047331413300012951SoilMNTPRHPIARSASGAAWSLALGMVGVAGKRQAGNGPAPI*
Ga0157371_1011761623300013102Corn RhizosphereMPALESPQSMNTPRHSIARSAFGAAWSLALGMVGVAGQRESGNGPVPI*
Ga0157371_1032187313300013102Corn RhizosphereESPQSMNTPRHSIARSAFGAAWSLALGRVGVAGKRQSGNGPAPI*
Ga0157369_1017156523300013105Corn RhizosphereMNTPRHSIARSAFGAAWSLALGRVGVADERQAGNGPAPI*
Ga0157369_1107468823300013105Corn RhizosphereCLLLESPQSMNMSRHSIARSAFGAAWSLALGMVGVAGKRQAGNGPAPI*
Ga0157374_1042781923300013296Miscanthus RhizosphereMNMSRHSIARSAFGAAWSLALGRVGVAGKRQSGNGPAPI*
Ga0163162_1203976823300013306Switchgrass RhizosphereMNTPRHSIARSAFGAAWSLALGMVGVAGTRQAGNGPAPI*
Ga0157377_1055954223300014745Miscanthus RhizosphereMNTPRHSIARSAFGAAWSLALGMVGVAGKRESGNGPAPI*
Ga0167636_103012523300015075Glacier Forefield SoilsMNTPRLTIARSASGAAWSLAHGFGGVAGKRLASIGPAPI*
Ga0167632_100466823300015085Glacier Forefield SoilMNTPRLTIARSASGAAWSLAHGFGGVSAQRFSGNGPAPI*
Ga0132257_10081423323300015373Arabidopsis RhizosphereMNTPRHSIARSAFSAAWLLALGMVGVAGKRQAGNGPAPI*
Ga0132257_10318839413300015373Arabidopsis RhizosphereMNTSRHSIARSAFGAARSLALGMVGVAGERQAGNGPAPT*
Ga0132255_10048349123300015374Arabidopsis RhizosphereMNTPRHSIVRSAFGAARSLALGMVGVAGERQAGNGPAPT*
Ga0163161_1048669623300017792Switchgrass RhizospherePRKPQPMNTPRHSIARSAFGAAWSLALGMVGVAGERQAGNGPAPI
Ga0190266_1010015623300017965SoilMNTPRHSIARSAFGAAWSLALGMVGVAGKRQSGNGPAPI
Ga0184628_1021743323300018083Groundwater SedimentMNTPRHSIARSAFGAAWSLAFGMVGVAGKRESGNGPAPI
Ga0190270_1033460823300018469SoilMNTPRHPIARSAFGAAWSLALGMVGVAGKRESGNGPAPI
Ga0190274_1184103113300018476SoilNTPRHSIARSAFGAAWSLALGMVGVAGKRQAGNGPAPI
Ga0190273_1062896723300018920SoilMITARLTIARSAFGAAWSLAHGFGGVAGKRLAANRPAPI
Ga0173481_1037969613300019356SoilMNTPRHSIARSAFGAARSLALGMVGVAGKRQAGNGPAPI
Ga0173482_1057705513300019361SoilMNTPRHSIARSAFGAAWSLALGRVGVAGKRQAGNGPAPI
Ga0190267_1031977023300019767SoilMNTPRHSIVSSAFGAAWSLALGTVGVAGKRQAGNGPAPI
Ga0210380_1025276523300021082Groundwater SedimentMNTPRHSIARSAFGAAWSLAFGMVGVAGKRQSGNGPAPI
Ga0247776_1038731413300023275Plant LitterPMNTPRHSIARSAFGAAWSLALGMVGVAGKRQSGNGPAPI
Ga0207697_1003681223300025315Corn, Switchgrass And Miscanthus RhizosphereMNTPRHSIARSAFGAAWSLALGMVGVAGERQAGNGPAPI
Ga0207656_1006344223300025321Corn RhizosphereNPAATMRAPRKPQPMNTPRHSIARSAFGAAWSLALGMVGVAGQRESGNGPAPI
Ga0207656_1039771113300025321Corn RhizosphereMNTPRHSIARSAFGAAWSLALGRVGVAGKRQSGNGPAPI
Ga0207682_1047817613300025893Miscanthus RhizospherePRHSIARSAFGAAWSLALGMVGVAGERQAGNGPAPI
Ga0207642_1061564913300025899Miscanthus RhizosphereMNTPRHSIARSAFGAAWSLALGMVGVAGTRQAGNGPAPI
Ga0207688_1012644213300025901Corn, Switchgrass And Miscanthus RhizosphereMNTPRHPIVRSAFRAAGSLALGKVGVAANGQAGNGPAPI
Ga0207680_1027383923300025903Switchgrass RhizosphereSLLESPQPMNTPRHSIARSAFGAAWSLALGMVGVAGKRQSGNGPAPI
Ga0207705_1070741823300025909Corn RhizosphereMPALESPQSMNTPRHSIARSAFGAAWSLALGRVGVADERQAGNGPAPI
Ga0207705_1117224923300025909Corn RhizosphereMNTPRHSIARSAFGAAWSLALGMVGVAGQRESGNGPA
Ga0207649_1077906923300025920Corn RhizospherePQPMNTPRHSIARSAFGAAWSLALGMVGVAGERQAGNGPAPI
Ga0207650_1026358923300025925Switchgrass RhizosphereMNTPRHSTARSASSAAWSLALGMVGVAGKRQAGNGPAPI
Ga0207650_1090511223300025925Switchgrass RhizosphereRSFLLESPHPMNTPRHSIARSAFGAAWSLALGRVGVAGKRQSGNGPAPI
Ga0207709_1085520313300025935Miscanthus RhizosphereMNTPRHSIARSASGAAWSLALGMVGVAGTRQAGNGPAPI
Ga0207669_1045386113300025937Miscanthus RhizosphereLESPQPMNTPRHAIARSAFGAAWSLALGMVGVAGKRQSGNGPAPI
Ga0207704_1114290523300025938Miscanthus RhizosphereMNTPRHSIARSAFGAAWSLALGVVGVAGKRESGNGPAPI
Ga0207711_1070109613300025941Switchgrass RhizosphereMNTPRHSTARSALSAAWSLALGMVGVAGKRQAGNGPAPI
Ga0207708_1075204513300026075Corn, Switchgrass And Miscanthus RhizosphereMNTPRHSIARSAFGAAWSLALGRVGVAGKRQSGNGPA
Ga0207702_1029439523300026078Corn RhizosphereESPQSMNTPRHSIARSAFGAAWSLALGMVGVAGKRQAGNGPAPI
Ga0207641_1058985723300026088Switchgrass RhizosphereMNTLRHSIARSAFGAAWSLALGRVGVAGKRQSGNGPAPI
Ga0207683_1022981023300026121Miscanthus RhizosphereMNTPRHSIARSAFSAAWSLALGMVGVAGKRQAGNGPAPI
Ga0209839_1009700323300026294SoilMNPTCHTTARSALRAAWPLALGMGGVAGKRLTGVGPAPI
Ga0247821_1040298723300028596SoilPMNTPRHPIARSAFGAAWSLALGMVGVAGKRESGNGPAPI
Ga0247821_1124575123300028596SoilMNTPRHSIARSASGAARSLALGMVGVAGKRQAGNGPAPI
Ga0307281_1022050613300028803SoilMNTPRLTIARSASGAARSLAHGCGMRLAGNGPAPI
Ga0247824_1029673323300028809SoilMNTPRHPIARSAFGAAWSLALGMVGVAGKRQSGNGPAPI
Ga0308193_108508023300031096SoilSTPRHSIARSAFGAAWSLALGRVGIAGKRQSGNGPAPI
Ga0307497_1018404123300031226SoilVNTPRHSIARSASGAAWSLALGMVGVAGKRQSGNGPAPI
Ga0310904_1043126513300031854SoilSLLLESPQAMNTPRHPIVRSAFRAAGSLALGKVGVAANGQAGNGPAPI
Ga0310892_1064815013300031858SoilMNTPRHSIARSASGAAWSLALGMVGVAGERQAGNGPAPI
Ga0308175_10243791423300031938SoilMPALESPQSMNTPRHSIARSAFGAAWSLALGRVGVADKRQAGNGPAPI
Ga0308174_1011950123300031939SoilMNTPRHSIARSAFDAAWSLALGMVGVAGKREAGNGPAPI
Ga0308174_1034087823300031939SoilMNTPRHSIARSAFGAARSLALGSVGLAGKREAGNGPAPI
Ga0310890_1067375923300032075SoilMNTPRHPIARSASGAAWSLALGMVGVAGKRQAGNGPAPI

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.