| Basic Information | |
|---|---|
| Family ID | F093717 |
| Family Type | Metagenome |
| Number of Sequences | 106 |
| Average Sequence Length | 41 residues |
| Representative Sequence | TAPANNVARPMIEYPAAITDIDMADRNVSIVKNIIVF |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 91.51 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.25 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (48.113 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (18.868 % of family members) |
| Environment Ontology (ENVO) | Unclassified (68.868 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (86.792 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.31% β-sheet: 0.00% Coil/Unstructured: 67.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF01832 | Glucosaminidase | 79.25 |
| PF10263 | SprT-like | 6.60 |
| PF13759 | 2OG-FeII_Oxy_5 | 6.60 |
| PF09293 | RNaseH_C | 2.83 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.94 |
| PF00733 | Asn_synthase | 0.94 |
| PF04820 | Trp_halogenase | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 51.89 % |
| Unclassified | root | N/A | 48.11 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000116|DelMOSpr2010_c10147809 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 809 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10163884 | Not Available | 719 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10243060 | Not Available | 530 | Open in IMG/M |
| 3300001748|JGI11772J19994_1019715 | Not Available | 997 | Open in IMG/M |
| 3300001748|JGI11772J19994_1029134 | Not Available | 736 | Open in IMG/M |
| 3300005239|Ga0073579_1480341 | Not Available | 778 | Open in IMG/M |
| 3300005611|Ga0074647_1009490 | Not Available | 1900 | Open in IMG/M |
| 3300005933|Ga0075118_10160760 | Not Available | 748 | Open in IMG/M |
| 3300006735|Ga0098038_1277465 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 524 | Open in IMG/M |
| 3300006735|Ga0098038_1296803 | Not Available | 502 | Open in IMG/M |
| 3300006749|Ga0098042_1077629 | Not Available | 863 | Open in IMG/M |
| 3300006802|Ga0070749_10017958 | All Organisms → Viruses → Predicted Viral | 4505 | Open in IMG/M |
| 3300006802|Ga0070749_10459806 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300006810|Ga0070754_10016029 | All Organisms → Viruses → Predicted Viral | 4500 | Open in IMG/M |
| 3300006810|Ga0070754_10157778 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1080 | Open in IMG/M |
| 3300006874|Ga0075475_10011553 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 4446 | Open in IMG/M |
| 3300006874|Ga0075475_10330770 | Not Available | 623 | Open in IMG/M |
| 3300006902|Ga0066372_10333087 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 865 | Open in IMG/M |
| 3300006916|Ga0070750_10209724 | Not Available | 859 | Open in IMG/M |
| 3300006919|Ga0070746_10393512 | Not Available | 622 | Open in IMG/M |
| 3300006990|Ga0098046_1079605 | Not Available | 739 | Open in IMG/M |
| 3300007276|Ga0070747_1106152 | Not Available | 1033 | Open in IMG/M |
| 3300007344|Ga0070745_1080987 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1290 | Open in IMG/M |
| 3300007344|Ga0070745_1220959 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300007346|Ga0070753_1099593 | Not Available | 1136 | Open in IMG/M |
| 3300007538|Ga0099851_1164283 | Not Available | 821 | Open in IMG/M |
| 3300007725|Ga0102951_1183353 | Not Available | 591 | Open in IMG/M |
| 3300007778|Ga0102954_1136424 | Not Available | 699 | Open in IMG/M |
| 3300007778|Ga0102954_1168867 | Not Available | 633 | Open in IMG/M |
| 3300008097|Ga0111541_10415773 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 585 | Open in IMG/M |
| 3300009001|Ga0102963_1299546 | Not Available | 633 | Open in IMG/M |
| 3300009027|Ga0102957_1234739 | Not Available | 662 | Open in IMG/M |
| 3300009420|Ga0114994_10637531 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 697 | Open in IMG/M |
| 3300009425|Ga0114997_10368602 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 781 | Open in IMG/M |
| 3300009433|Ga0115545_1118024 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 947 | Open in IMG/M |
| 3300009443|Ga0115557_1297192 | Not Available | 609 | Open in IMG/M |
| 3300009507|Ga0115572_10193167 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1179 | Open in IMG/M |
| 3300009512|Ga0115003_10186969 | All Organisms → Viruses → Predicted Viral | 1248 | Open in IMG/M |
| 3300009512|Ga0115003_10946011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300009705|Ga0115000_10250096 | Not Available | 1157 | Open in IMG/M |
| 3300010148|Ga0098043_1150726 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 658 | Open in IMG/M |
| 3300010297|Ga0129345_1160319 | Not Available | 810 | Open in IMG/M |
| 3300010299|Ga0129342_1129275 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 932 | Open in IMG/M |
| 3300010299|Ga0129342_1148926 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 854 | Open in IMG/M |
| 3300010299|Ga0129342_1151865 | Not Available | 844 | Open in IMG/M |
| 3300010300|Ga0129351_1052085 | All Organisms → Viruses → Predicted Viral | 1672 | Open in IMG/M |
| 3300010318|Ga0136656_1102975 | Not Available | 1000 | Open in IMG/M |
| 3300010883|Ga0133547_10785625 | All Organisms → Viruses → Predicted Viral | 1872 | Open in IMG/M |
| 3300012920|Ga0160423_10632891 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 724 | Open in IMG/M |
| 3300012920|Ga0160423_11038588 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 548 | Open in IMG/M |
| 3300012954|Ga0163111_11152156 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 755 | Open in IMG/M |
| 3300017706|Ga0181377_1038370 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 958 | Open in IMG/M |
| 3300017721|Ga0181373_1020730 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1225 | Open in IMG/M |
| 3300017721|Ga0181373_1090824 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 541 | Open in IMG/M |
| 3300017728|Ga0181419_1080269 | Not Available | 817 | Open in IMG/M |
| 3300017732|Ga0181415_1124966 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 578 | Open in IMG/M |
| 3300017749|Ga0181392_1026264 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1842 | Open in IMG/M |
| 3300017750|Ga0181405_1020504 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1834 | Open in IMG/M |
| 3300017756|Ga0181382_1172583 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 555 | Open in IMG/M |
| 3300017764|Ga0181385_1150016 | Not Available | 708 | Open in IMG/M |
| 3300017772|Ga0181430_1101086 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 858 | Open in IMG/M |
| 3300017773|Ga0181386_1073655 | Not Available | 1080 | Open in IMG/M |
| 3300017779|Ga0181395_1212441 | Not Available | 598 | Open in IMG/M |
| 3300017786|Ga0181424_10268063 | Not Available | 712 | Open in IMG/M |
| 3300018416|Ga0181553_10645723 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 556 | Open in IMG/M |
| 3300018416|Ga0181553_10682075 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 538 | Open in IMG/M |
| 3300018428|Ga0181568_10607367 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 862 | Open in IMG/M |
| 3300019459|Ga0181562_10490379 | Not Available | 584 | Open in IMG/M |
| 3300020377|Ga0211647_10062132 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
| 3300020377|Ga0211647_10093327 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1042 | Open in IMG/M |
| 3300020386|Ga0211582_10015797 | Not Available | 2739 | Open in IMG/M |
| 3300020404|Ga0211659_10206757 | Not Available | 879 | Open in IMG/M |
| 3300020414|Ga0211523_10266653 | Not Available | 704 | Open in IMG/M |
| 3300020451|Ga0211473_10560423 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 580 | Open in IMG/M |
| 3300020474|Ga0211547_10235158 | Not Available | 936 | Open in IMG/M |
| 3300021335|Ga0213867_1055253 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1506 | Open in IMG/M |
| 3300021347|Ga0213862_10152220 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 813 | Open in IMG/M |
| 3300021958|Ga0222718_10051440 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2613 | Open in IMG/M |
| 3300021958|Ga0222718_10080795 | All Organisms → Viruses → Predicted Viral | 1961 | Open in IMG/M |
| 3300021959|Ga0222716_10437867 | Not Available | 750 | Open in IMG/M |
| 3300021960|Ga0222715_10058224 | All Organisms → Viruses | 2633 | Open in IMG/M |
| 3300021960|Ga0222715_10295043 | Not Available | 923 | Open in IMG/M |
| 3300021961|Ga0222714_10245808 | All Organisms → Viruses → Predicted Viral | 1006 | Open in IMG/M |
| 3300021962|Ga0222713_10502175 | Not Available | 725 | Open in IMG/M |
| 3300021964|Ga0222719_10513235 | Not Available | 716 | Open in IMG/M |
| 3300022053|Ga0212030_1048181 | Not Available | 604 | Open in IMG/M |
| 3300022149|Ga0196907_104561 | Not Available | 710 | Open in IMG/M |
| 3300023170|Ga0255761_10225452 | Not Available | 1034 | Open in IMG/M |
| 3300023172|Ga0255766_10206813 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1066 | Open in IMG/M |
| 3300023172|Ga0255766_10341669 | Not Available | 745 | Open in IMG/M |
| 3300023229|Ga0222661_1042610 | Not Available | 589 | Open in IMG/M |
| 3300025102|Ga0208666_1157692 | Not Available | 501 | Open in IMG/M |
| 3300025151|Ga0209645_1055476 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1377 | Open in IMG/M |
| 3300025653|Ga0208428_1102116 | Not Available | 807 | Open in IMG/M |
| 3300025767|Ga0209137_1091847 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1245 | Open in IMG/M |
| 3300025770|Ga0209362_1113230 | Not Available | 997 | Open in IMG/M |
| 3300025815|Ga0208785_1093521 | Not Available | 752 | Open in IMG/M |
| 3300025840|Ga0208917_1008421 | All Organisms → Viruses → Predicted Viral | 4626 | Open in IMG/M |
| 3300027779|Ga0209709_10369557 | Not Available | 580 | Open in IMG/M |
| 3300027788|Ga0209711_10393913 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 570 | Open in IMG/M |
| 3300029787|Ga0183757_1006814 | All Organisms → Viruses | 3623 | Open in IMG/M |
| 3300029787|Ga0183757_1058722 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 626 | Open in IMG/M |
| 3300031659|Ga0307986_10027666 | All Organisms → Viruses → Predicted Viral | 3167 | Open in IMG/M |
| 3300032006|Ga0310344_10779981 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 811 | Open in IMG/M |
| 3300032073|Ga0315315_10508259 | All Organisms → Viruses → Predicted Viral | 1116 | Open in IMG/M |
| 3300032136|Ga0316201_11061762 | Not Available | 680 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 18.87% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 16.98% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 9.43% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 8.49% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 7.55% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 6.60% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 5.66% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 2.83% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.83% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.83% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 2.83% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.89% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.89% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.89% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 1.89% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.94% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.94% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 0.94% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.94% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.94% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.94% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.94% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water And Sediment | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001748 | Saline surface water microbial communities from Etoliko Lagoon, Greece - surface water (0 m) | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005611 | Saline surface water microbial communities from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
| 3300005933 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKE | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006902 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_250_ad_251m_LV_A | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007725 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG | Environmental | Open in IMG/M |
| 3300007778 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG | Environmental | Open in IMG/M |
| 3300008097 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_DCM_ad_131m_LV_B (version 2) | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009443 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020377 | Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556007-ERR599065) | Environmental | Open in IMG/M |
| 3300020386 | Marine microbial communities from Tara Oceans - TARA_B100000609 (ERX555990-ERR599038) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020414 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022149 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300023170 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG | Environmental | Open in IMG/M |
| 3300023172 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG | Environmental | Open in IMG/M |
| 3300023229 | Saline water microbial communities from Ace Lake, Antarctica - #551 | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025767 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025770 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_165m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025815 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| 3300031659 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82 | Environmental | Open in IMG/M |
| 3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300032136 | Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_101478092 | 3300000116 | Marine | TTAPANNVASPTMEYPAAIIDIDMADMKVNSVKNIVIFI* |
| DelMOWin2010_101638841 | 3300000117 | Marine | IIGITAPANNVARPMIEYPAAITDIDMADRXVSXVKNIIXCYTLF* |
| DelMOWin2010_102430602 | 3300000117 | Marine | PIAIIGITAPANSVARPMIEYPAAITDIEMADRNVSIVKNIIVCYTLF* |
| JGI11772J19994_10197153 | 3300001748 | Saline Water And Sediment | IGITAPANNVARPMIEYPAAITDIDMADRNVSIVKNIIVCYTLF* |
| JGI11772J19994_10291341 | 3300001748 | Saline Water And Sediment | VARPMIEYPAAITDIDMADRNVSIVKNIILYYILL* |
| Ga0073579_14803411 | 3300005239 | Marine | KIIGTTAPANNVANPTMEYPAAIIDIDMADKNVNIVKNIIDSLF* |
| Ga0074647_10094901 | 3300005611 | Saline Water And Sediment | PANNVARPMIEYPAAITDIDMADRNVSIVKNIIVCYTLF* |
| Ga0075118_101607601 | 3300005933 | Saline Lake | VARPMIEYPAAITDIDMADKNVNIVRNILLIVFSNFG* |
| Ga0098038_12774652 | 3300006735 | Marine | IGITAPANNVARPIMEYPAAITEIEIADRKVSSVKNIVIFI* |
| Ga0098038_12968031 | 3300006735 | Marine | GTTAPANNVASPTIEYPAAITEIEIADRNVNNVKNILLIIFSNFA* |
| Ga0098042_10776291 | 3300006749 | Marine | ASPTIEYPAAITEIEIADRNVNNVKNILLIIFSNFA* |
| Ga0070749_100179581 | 3300006802 | Aqueous | PIAIIGITAPANNVARPMIEYPAAIIDIDMADRNVSIVKNIV* |
| Ga0070749_104598062 | 3300006802 | Aqueous | APANNVARPMIEYPAAITDIDMADRNVSIVKNIIVF* |
| Ga0070754_100160299 | 3300006810 | Aqueous | TAPANNVARPMIEYPAAIIDIDMADRNVSIVKNIV* |
| Ga0070754_101577781 | 3300006810 | Aqueous | IAIIGITAPANNVARPMIEYPAAITDIDMADRNVSIVKNIIVF* |
| Ga0075475_100115531 | 3300006874 | Aqueous | GITAPANNVARPMIEYPAAIIDIDMADRNVSIVKNIV* |
| Ga0075475_103307701 | 3300006874 | Aqueous | PANNVASPMIEYPAAITDIDMADRNVSIVKNIIIFYNLF* |
| Ga0066372_103330872 | 3300006902 | Marine | IAIIGIAAPANNVASPIIEYPAAIKDILIADIKVNIVKTI* |
| Ga0070750_102097241 | 3300006916 | Aqueous | IIGITAPANNVARPMIEYPAAITDIDMADRNVSIVKNIIVF* |
| Ga0070746_103935121 | 3300006919 | Aqueous | PANSVARPMIEYPAAITDIEMADRNVSIVKNIIVYYNLF* |
| Ga0098046_10796051 | 3300006990 | Marine | TAPANNVASHTMEYPAAIIDIDMADKNVNIVKNIIDSLF* |
| Ga0070747_11061521 | 3300007276 | Aqueous | PIAIIGITAPANNVARPMIEYPAAITDIDMADRNVSIVKNIILYYTRF* |
| Ga0070745_10809871 | 3300007344 | Aqueous | PIAIIGITAPANNVARPMIEYPAAIIDIDMADRNVSIVKNIVLYYLSILMVSF* |
| Ga0070745_12209591 | 3300007344 | Aqueous | TAPANNVARPMIEYPAAITDIDMADRNVSIVKNIIVF* |
| Ga0070753_10995931 | 3300007346 | Aqueous | IIGITAPANNVASPMIEYPAAITDIEMADRNVSIVKNIIVYYNLF* |
| Ga0099851_11642833 | 3300007538 | Aqueous | APANNVARPMIEYPAAITDIDMADRNVSIVKNII* |
| Ga0102951_11833531 | 3300007725 | Water | NSVASPIIEYPAAITDIDIADKNVSSVKNIIVFYTLF* |
| Ga0102954_11364241 | 3300007778 | Water | SNALPIAIIGIVAPANNVARPIIEYPAAIADIEMADINVIKIVNIFI* |
| Ga0102954_11688672 | 3300007778 | Water | ANSVASPMIEYPAAIIDILIADKNVNSVRNIALLFS* |
| Ga0111541_104157731 | 3300008097 | Marine | NNVAKPIIEYPAAITDMLMADIKVSNVKNIVIFI* |
| Ga0102963_12995462 | 3300009001 | Pond Water | IGTAAPANSVASPIIEYPAAIIDILIADKNVSIVKNIV* |
| Ga0102957_12347392 | 3300009027 | Pond Water | NVARPMIEYPAAITDILIADRNVSIVKNINLFYTLF* |
| Ga0114994_106375312 | 3300009420 | Marine | AEPINIIGITAPANNVARPMIEYPAAITDIDMADKKVNIVRNIVIFS* |
| Ga0114997_103686022 | 3300009425 | Marine | IIGITAPANNVASPTMEYPAAITEILIADRKVNIVKNIVIFS* |
| Ga0115545_11180241 | 3300009433 | Pelagic Marine | APANNVASPTMEYPAAIIDIDMADRKVSNVKNIVIFI* |
| Ga0115557_12971921 | 3300009443 | Pelagic Marine | TAPANNVARPMIEYPAAITDIDMADKNVNIVRNILLIVFSNFA* |
| Ga0115572_101931671 | 3300009507 | Pelagic Marine | GTTAPANNVASPTMEYPAAIIDIDMADRKVSNVKNIVIFI* |
| Ga0115003_101869691 | 3300009512 | Marine | APANNVARPMIEYPAAIIDIDMADKNVNIVKNINSLF* |
| Ga0115003_109460111 | 3300009512 | Marine | IIGITAPANNVARPMIEYPAAIIDIDIADKNVRIVKNI* |
| Ga0115000_102500961 | 3300009705 | Marine | NVASPMIEYPAAITDIDMADKKVNIVKNINYILF* |
| Ga0098043_11507262 | 3300010148 | Marine | IAIIGTKAPANNVAKPIIEYPAAITDILMADIKVSIVKNIVIFI* |
| Ga0129345_11603191 | 3300010297 | Freshwater To Marine Saline Gradient | TAPANNVARPMIEYPAAITDIDMADRNVSIVKNII* |
| Ga0129342_11292751 | 3300010299 | Freshwater To Marine Saline Gradient | PANKVANPTIEYPAAIIDIVMPESSVSIAKNIVYYLL* |
| Ga0129342_11489261 | 3300010299 | Freshwater To Marine Saline Gradient | TAPANSVASPMIEYPAAIIDILIADKNVNSVRNIVLFI* |
| Ga0129342_11518651 | 3300010299 | Freshwater To Marine Saline Gradient | TAPANNVARPMIEYPAAITDIDMADRNVSIVKNIIKF* |
| Ga0129351_10520855 | 3300010300 | Freshwater To Marine Saline Gradient | GITAPANNVARPMIEYPAAITDIDMADKNVNIVRNILLIVFSNFA* |
| Ga0136656_11029751 | 3300010318 | Freshwater To Marine Saline Gradient | IGITAPANNVARPMIEYPAAIIDIEMADRNVSIVKNIIIFYILF* |
| Ga0133547_107856251 | 3300010883 | Marine | PANNVARPMIEYPAAIIDIDMADKNVNIVKNIIVF* |
| Ga0160423_106328911 | 3300012920 | Surface Seawater | IKAPANKVAKPIIEYPAAITDILMADIKVSNVKNIVIFI* |
| Ga0160423_110385882 | 3300012920 | Surface Seawater | GTTAPANNVASPTIEYPAAITDILIADINVSKVKNMLIFS* |
| Ga0163111_111521562 | 3300012954 | Surface Seawater | KAPANKVAKPIIEYPAAITDILMADIKVSNVKNIVIFI* |
| Ga0181377_10383701 | 3300017706 | Marine | PMAMMGTTAPANNVANPTIEYPAAITEIEIADRKVNSVKNIVIFI |
| Ga0181373_10207301 | 3300017721 | Marine | ANNVASPTIEYPAAITEIEIADRKVNSVKNIVIFI |
| Ga0181373_10908241 | 3300017721 | Marine | EPIATIGIKAPANKVAKPIIEYPAAITDILMADIKVSNVKNIVIFI |
| Ga0181419_10802693 | 3300017728 | Seawater | KIIGTTAPANNVASPTMEYPAAIIDIDMADKNVNIVKNIIDSLF |
| Ga0181415_11249661 | 3300017732 | Seawater | IIGTTAPANNVASPTIEYPAAMTDILIADKKVSSVKNIVIFI |
| Ga0181392_10262641 | 3300017749 | Seawater | TAPANNVASPTMEYPAAITDIDMADRNVSIVKNIIVCYTLF |
| Ga0181405_10205041 | 3300017750 | Seawater | DPIKIIGTTAPANNVASPTMEYPAAITDIDMADRNVSIVKNIIVCYTLF |
| Ga0181382_11725832 | 3300017756 | Seawater | ANNVAKPIIEYPAAITDMLIADIKVNNVKNIVIFI |
| Ga0181385_11500161 | 3300017764 | Seawater | MAMIGTTAPANNVASPTIEYPAAITEIEIADRNVNNVKNILLIIFSNFA |
| Ga0181430_11010862 | 3300017772 | Seawater | EPIAIIGTTAPANNVASPTIEYPAAMTDILIADKKVSSVKNIVIFI |
| Ga0181386_10736551 | 3300017773 | Seawater | MMGTTAPANNVANPTIEYPAAITEIEIADKNVNSVKNIS |
| Ga0181395_12124412 | 3300017779 | Seawater | IGTTAPANNVASPTIEYPAAITEIEIADRNVNNVKNILLIIFSNFA |
| Ga0181424_102680633 | 3300017786 | Seawater | GTTAPANNVASPTMEYPAAIIDIDMADKNVNIVKNIIDSLF |
| Ga0181553_106457231 | 3300018416 | Salt Marsh | APANNVASPTIEYPAAITEIEIADRKVNSVKNIVIFI |
| Ga0181553_106820751 | 3300018416 | Salt Marsh | PIATIGIKAPANKVAKPIIEYPAAITDILMADIKVSNVKNIVIFI |
| Ga0181568_106073672 | 3300018428 | Salt Marsh | ANKVAKPIIEYPAAITDILMADIKVSNVKNIVIFI |
| Ga0181562_104903792 | 3300019459 | Salt Marsh | ASPTIEYPAAITEIEIADRNVNNVKNILLIIFSNFA |
| Ga0211647_100621324 | 3300020377 | Marine | IGTKAPANNVAKPIIEYPAAITDILMADIKVSNVKNIVIFI |
| Ga0211647_100933271 | 3300020377 | Marine | GTAAPANKVASPSIEYPAAIKDIAIADINVNNVKNIVLFISLNF |
| Ga0211582_100157971 | 3300020386 | Marine | IAIIGTAAPANKVASPSIEYPAAIKDIAIADINVNNVKNIVLFISLNF |
| Ga0211659_102067571 | 3300020404 | Marine | TTAPANNVASPTIEYPAAITEIEIADRNVNNVKNILLIIFSNFA |
| Ga0211523_102666531 | 3300020414 | Marine | PIAMIGTTAPANNVASPTIEYPAAITEIEIADRNVNSVKNIN |
| Ga0211473_105604231 | 3300020451 | Marine | MMGTTAPANNVASPTIEYPAAITEIEIADRKVNSVKNIVIFI |
| Ga0211547_102351581 | 3300020474 | Marine | AMMGTTAPANNVASPTIEYPAAITDIEMADRNVNNVKNILLIVFSNFA |
| Ga0213867_10552531 | 3300021335 | Seawater | NNVARPMIEYPAAITDIDMADKNVSIVKNIILCYTLF |
| Ga0213862_101522202 | 3300021347 | Seawater | PANNVASPTMEYPAAITDILIADKNVSNVKNIVIFI |
| Ga0222718_100514401 | 3300021958 | Estuarine Water | EPIAIIGITAPANNVARPMIEYPAAITDIDMADKNVNIVKNILLFIIVITN |
| Ga0222718_100807951 | 3300021958 | Estuarine Water | PIAIIGTAAPANSVARPIIEYPAAIIDMLIADKNVSNVRNIKLYSAL |
| Ga0222716_104378671 | 3300021959 | Estuarine Water | TAPANNVARPMIEYPAAITDIVMADKNVKIVKNIIVF |
| Ga0222715_100582241 | 3300021960 | Estuarine Water | AIIGITAPANNVARPMIEYPAAIIDILMADKNVKTVKNIESLFTYTRFLFFL |
| Ga0222715_102950431 | 3300021960 | Estuarine Water | NVARPMIEYPAAITDILIADRNVSIVKNINLFYTLF |
| Ga0222714_102458081 | 3300021961 | Estuarine Water | IGTTAPANSVASPMIEYPAAIIDILIADKNVNSVRNIILFYTLF |
| Ga0222713_105021751 | 3300021962 | Estuarine Water | APANSVASPMIEYPAAIIDILIADRKVNSVRNIVLLFIK |
| Ga0222719_105132352 | 3300021964 | Estuarine Water | TAPANKVARPMIEYPAAITDIDMADRNVSIVKNIIIFYNLF |
| Ga0212030_10481811 | 3300022053 | Aqueous | NVARPMIEYPAAIIDIDMADRNVSIVKNIILYYTRF |
| Ga0196907_1045611 | 3300022149 | Aqueous | GITAPANNVARPMIEYPAAIIDIDMADRNVSIVKNIILYYTRF |
| Ga0255761_102254523 | 3300023170 | Salt Marsh | IAIIGITAPANNVARPMIEYPAAITDIDMADRNVSIVKNIILCYTLF |
| Ga0255766_102068131 | 3300023172 | Salt Marsh | IAIIGTTAPANSVASPMIEYPAAIIDILIADKNVNSVRNIVLFI |
| Ga0255766_103416691 | 3300023172 | Salt Marsh | GTVAPAKIAAKPIIEYPAAITDMLIADKKVIKVKNIKLFMVYF |
| Ga0222661_10426102 | 3300023229 | Saline Water | IGTTAPANSVARPMIEYPAAITDIDMADKNVNNVRNINYILF |
| Ga0208666_11576922 | 3300025102 | Marine | IGTTAPANNVASPTMEYPAAITDIDMADRNVNIVKNIIDSLF |
| Ga0209645_10554761 | 3300025151 | Marine | EPMAMMGTTAPANNVASPTIEYPAAITEIEIADRNVNSVKNIN |
| Ga0208428_11021161 | 3300025653 | Aqueous | VARPMIEYPAAITDIDMADRNVSIVKNIILCYTLF |
| Ga0209137_10918471 | 3300025767 | Marine | ANSVARPMIEYPAAITDIEMADRNVSIVKNIIVCYTLF |
| Ga0209362_11132303 | 3300025770 | Marine | PANNVASPMIEYPAAITDIDMADKKVNIVKNINYILF |
| Ga0208785_10935211 | 3300025815 | Aqueous | GITAPANNVARPMIEYPAAITDILIADRNVSIVKNIIVCYTLF |
| Ga0208917_10084219 | 3300025840 | Aqueous | GITAPANNVARPMIEYPAAIIDIDMADRNVSIVKNIV |
| Ga0209709_103695572 | 3300027779 | Marine | GITAPANNVASPMIEYPAAITDIDMADKNVSIVKNMS |
| Ga0209711_103939131 | 3300027788 | Marine | GITAPANNVARPMIEYPAAITDIDMADKKVNIVKNIVIFS |
| Ga0183757_10068141 | 3300029787 | Marine | GIKAPANNVAKPIIEYPAAITDMLMADIKVSNVKNIVIFI |
| Ga0183757_10587221 | 3300029787 | Marine | AEPIAMMGTTAPANNVASPTMEYPAAITDILIADKNVSNVKNIVIFI |
| Ga0307986_100276661 | 3300031659 | Marine | TAPANNVARPMIEYPAAITEILIADRKVNIVRNIVIFS |
| Ga0310344_107799811 | 3300032006 | Seawater | SNADPIAIIGTAAPANNVASPSIEYPAAIKDIAIADMKVNIVKNI |
| Ga0315315_105082591 | 3300032073 | Seawater | TTAPANNVASPTMEYPAAIIDIDMADKNVNIVKNIIDSLF |
| Ga0316201_110617622 | 3300032136 | Worm Burrow | IGITAPANNVARPMIEYPAAIIDIDMADRNVSIVKNIILYYTLL |
| ⦗Top⦘ |