| Basic Information | |
|---|---|
| Family ID | F093707 |
| Family Type | Metagenome |
| Number of Sequences | 106 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MKKTLRFVRIEDIRFPILEYKDNKIDAKELVEKLEKLINKYE |
| Number of Associated Samples | 75 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.89 % |
| % of genes near scaffold ends (potentially truncated) | 28.30 % |
| % of genes from short scaffolds (< 2000 bps) | 87.74 % |
| Associated GOLD sequencing projects | 63 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (79.245 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (64.151 % of family members) |
| Environment Ontology (ENVO) | Unclassified (93.396 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (86.792 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 2.38% Coil/Unstructured: 64.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF00118 | Cpn60_TCP1 | 0.94 |
| PF13662 | Toprim_4 | 0.94 |
| PF00268 | Ribonuc_red_sm | 0.94 |
| PF14743 | DNA_ligase_OB_2 | 0.94 |
| PF01068 | DNA_ligase_A_M | 0.94 |
| PF00166 | Cpn10 | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG0208 | Ribonucleotide reductase beta subunit, ferritin-like domain | Nucleotide transport and metabolism [F] | 0.94 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.94 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.94 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.94 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 79.25 % |
| All Organisms | root | All Organisms | 20.75 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001743|JGI24515J20084_1011964 | Not Available | 784 | Open in IMG/M |
| 3300002514|JGI25133J35611_10061290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1220 | Open in IMG/M |
| 3300002514|JGI25133J35611_10115556 | Not Available | 772 | Open in IMG/M |
| 3300005427|Ga0066851_10044439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1529 | Open in IMG/M |
| 3300005605|Ga0066850_10201505 | Not Available | 720 | Open in IMG/M |
| 3300006736|Ga0098033_1042819 | Not Available | 1343 | Open in IMG/M |
| 3300006736|Ga0098033_1234951 | Not Available | 501 | Open in IMG/M |
| 3300006738|Ga0098035_1038654 | Not Available | 1781 | Open in IMG/M |
| 3300006738|Ga0098035_1063723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1324 | Open in IMG/M |
| 3300006738|Ga0098035_1089145 | Not Available | 1083 | Open in IMG/M |
| 3300006738|Ga0098035_1195972 | Not Available | 675 | Open in IMG/M |
| 3300006738|Ga0098035_1203623 | Not Available | 660 | Open in IMG/M |
| 3300006750|Ga0098058_1062697 | Not Available | 1035 | Open in IMG/M |
| 3300006750|Ga0098058_1099676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 786 | Open in IMG/M |
| 3300006751|Ga0098040_1023819 | Not Available | 1984 | Open in IMG/M |
| 3300006751|Ga0098040_1027196 | Not Available | 1837 | Open in IMG/M |
| 3300006751|Ga0098040_1078031 | Not Available | 1009 | Open in IMG/M |
| 3300006752|Ga0098048_1231994 | Not Available | 541 | Open in IMG/M |
| 3300006753|Ga0098039_1197877 | Not Available | 681 | Open in IMG/M |
| 3300006754|Ga0098044_1183954 | Not Available | 827 | Open in IMG/M |
| 3300006768|Ga0098071_101170 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 3400 | Open in IMG/M |
| 3300006789|Ga0098054_1029140 | Not Available | 2165 | Open in IMG/M |
| 3300006789|Ga0098054_1308523 | Not Available | 565 | Open in IMG/M |
| 3300006793|Ga0098055_1049638 | Not Available | 1695 | Open in IMG/M |
| 3300006793|Ga0098055_1264879 | Not Available | 645 | Open in IMG/M |
| 3300006923|Ga0098053_1061276 | Not Available | 770 | Open in IMG/M |
| 3300006923|Ga0098053_1064571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 747 | Open in IMG/M |
| 3300006926|Ga0098057_1155798 | Not Available | 557 | Open in IMG/M |
| 3300006928|Ga0098041_1110354 | Not Available | 888 | Open in IMG/M |
| 3300006929|Ga0098036_1023658 | Not Available | 1941 | Open in IMG/M |
| 3300007513|Ga0105019_1071046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1989 | Open in IMG/M |
| 3300007963|Ga0110931_1163946 | Not Available | 666 | Open in IMG/M |
| 3300008050|Ga0098052_1147239 | Not Available | 934 | Open in IMG/M |
| 3300008050|Ga0098052_1216514 | Not Available | 740 | Open in IMG/M |
| 3300008050|Ga0098052_1231029 | Not Available | 711 | Open in IMG/M |
| 3300008051|Ga0098062_1053393 | Not Available | 579 | Open in IMG/M |
| 3300008220|Ga0114910_1003645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 6542 | Open in IMG/M |
| 3300008952|Ga0115651_1002411 | Not Available | 31068 | Open in IMG/M |
| 3300009129|Ga0118728_1005633 | Not Available | 11259 | Open in IMG/M |
| 3300009414|Ga0114909_1159665 | Not Available | 593 | Open in IMG/M |
| 3300009418|Ga0114908_1083164 | Not Available | 1091 | Open in IMG/M |
| 3300009488|Ga0114925_10635447 | Not Available | 758 | Open in IMG/M |
| 3300009488|Ga0114925_10730998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 708 | Open in IMG/M |
| 3300009528|Ga0114920_10110732 | Not Available | 1763 | Open in IMG/M |
| 3300009602|Ga0114900_1070915 | Not Available | 1011 | Open in IMG/M |
| 3300009603|Ga0114911_1003094 | Not Available | 7314 | Open in IMG/M |
| 3300009605|Ga0114906_1134817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 862 | Open in IMG/M |
| 3300009620|Ga0114912_1147912 | Not Available | 549 | Open in IMG/M |
| 3300010149|Ga0098049_1052772 | Not Available | 1297 | Open in IMG/M |
| 3300010150|Ga0098056_1228674 | Not Available | 618 | Open in IMG/M |
| 3300010153|Ga0098059_1424218 | Not Available | 501 | Open in IMG/M |
| 3300010155|Ga0098047_10120847 | Not Available | 1019 | Open in IMG/M |
| 3300010155|Ga0098047_10364883 | Not Available | 542 | Open in IMG/M |
| 3300010155|Ga0098047_10412749 | Not Available | 505 | Open in IMG/M |
| 3300013098|Ga0164320_10514482 | Not Available | 611 | Open in IMG/M |
| 3300017702|Ga0181374_1056882 | Not Available | 663 | Open in IMG/M |
| 3300017702|Ga0181374_1065100 | Not Available | 614 | Open in IMG/M |
| 3300017704|Ga0181371_1055460 | Not Available | 644 | Open in IMG/M |
| 3300017718|Ga0181375_1028564 | Not Available | 948 | Open in IMG/M |
| 3300017730|Ga0181417_1000591 | Not Available | 11841 | Open in IMG/M |
| 3300017765|Ga0181413_1187462 | Not Available | 619 | Open in IMG/M |
| 3300017772|Ga0181430_1023974 | All Organisms → Viruses → Predicted Viral | 1989 | Open in IMG/M |
| 3300017775|Ga0181432_1141344 | Not Available | 736 | Open in IMG/M |
| 3300017775|Ga0181432_1171999 | Not Available | 672 | Open in IMG/M |
| 3300020399|Ga0211623_10295499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 576 | Open in IMG/M |
| 3300021068|Ga0206684_1043398 | Not Available | 1576 | Open in IMG/M |
| 3300021084|Ga0206678_10044505 | All Organisms → Viruses → Predicted Viral | 2410 | Open in IMG/M |
| 3300021442|Ga0206685_10003871 | Not Available | 4582 | Open in IMG/M |
| 3300021442|Ga0206685_10016516 | Not Available | 2318 | Open in IMG/M |
| 3300021442|Ga0206685_10239600 | Not Available | 613 | Open in IMG/M |
| (restricted) 3300024052|Ga0255050_10001223 | Not Available | 3515 | Open in IMG/M |
| (restricted) 3300024052|Ga0255050_10024661 | Not Available | 1186 | Open in IMG/M |
| (restricted) 3300024057|Ga0255051_10341736 | Not Available | 551 | Open in IMG/M |
| (restricted) 3300024517|Ga0255049_10396378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 637 | Open in IMG/M |
| (restricted) 3300024518|Ga0255048_10388713 | Not Available | 675 | Open in IMG/M |
| 3300025038|Ga0208670_127356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300025066|Ga0208012_1021504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1042 | Open in IMG/M |
| 3300025066|Ga0208012_1036772 | Not Available | 743 | Open in IMG/M |
| 3300025069|Ga0207887_1034795 | Not Available | 813 | Open in IMG/M |
| 3300025096|Ga0208011_1010350 | Not Available | 2611 | Open in IMG/M |
| 3300025096|Ga0208011_1012576 | Not Available | 2305 | Open in IMG/M |
| 3300025096|Ga0208011_1031695 | Not Available | 1294 | Open in IMG/M |
| 3300025108|Ga0208793_1081928 | Not Available | 929 | Open in IMG/M |
| 3300025109|Ga0208553_1087890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 730 | Open in IMG/M |
| 3300025110|Ga0208158_1059450 | Not Available | 931 | Open in IMG/M |
| 3300025112|Ga0209349_1165000 | Not Available | 587 | Open in IMG/M |
| 3300025118|Ga0208790_1147549 | Not Available | 653 | Open in IMG/M |
| 3300025118|Ga0208790_1155662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 629 | Open in IMG/M |
| 3300025122|Ga0209434_1142437 | Not Available | 656 | Open in IMG/M |
| 3300025128|Ga0208919_1037628 | Not Available | 1716 | Open in IMG/M |
| 3300025128|Ga0208919_1192691 | Not Available | 615 | Open in IMG/M |
| 3300025131|Ga0209128_1054043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1452 | Open in IMG/M |
| 3300025131|Ga0209128_1071949 | Not Available | 1186 | Open in IMG/M |
| 3300025131|Ga0209128_1097826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 952 | Open in IMG/M |
| 3300025133|Ga0208299_1087398 | Not Available | 1080 | Open in IMG/M |
| 3300025133|Ga0208299_1202673 | Not Available | 587 | Open in IMG/M |
| 3300025133|Ga0208299_1242878 | Not Available | 511 | Open in IMG/M |
| 3300025141|Ga0209756_1107433 | Not Available | 1191 | Open in IMG/M |
| 3300025301|Ga0208450_1138758 | Not Available | 505 | Open in IMG/M |
| 3300026103|Ga0208451_1030543 | Not Available | 634 | Open in IMG/M |
| 3300026115|Ga0208560_1019514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 626 | Open in IMG/M |
| (restricted) 3300027856|Ga0255054_10123303 | Not Available | 1282 | Open in IMG/M |
| (restricted) 3300027868|Ga0255053_10075716 | Not Available | 1603 | Open in IMG/M |
| 3300031775|Ga0315326_10161911 | Not Available | 1471 | Open in IMG/M |
| 3300032088|Ga0315321_10687958 | Not Available | 595 | Open in IMG/M |
| 3300032360|Ga0315334_10979016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 732 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 64.15% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 7.55% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 7.55% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 6.60% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 4.72% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 2.83% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 2.83% |
| Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 1.89% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.94% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001743 | Marine viral communities from the Pacific Ocean - LP-38 | Environmental | Open in IMG/M |
| 3300002514 | Marine viral communities from the Pacific Ocean - ETNP_6_85 | Environmental | Open in IMG/M |
| 3300005427 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65 | Environmental | Open in IMG/M |
| 3300005605 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV67 | Environmental | Open in IMG/M |
| 3300006736 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006768 | Marine viral communities from Cariaco Basin, Caribbean Sea - 29_WHOI_OMZ | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006923 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG | Environmental | Open in IMG/M |
| 3300006926 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007513 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate b | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008051 | Marine viral communities from Cariaco Basin, Caribbean Sea - 23_WHOI_OMZ | Environmental | Open in IMG/M |
| 3300008220 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 | Environmental | Open in IMG/M |
| 3300008952 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um | Environmental | Open in IMG/M |
| 3300009129 | Combined Assembly of Gp0139513, Gp0139514 | Environmental | Open in IMG/M |
| 3300009414 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 | Environmental | Open in IMG/M |
| 3300009418 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 | Environmental | Open in IMG/M |
| 3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
| 3300009528 | Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaG | Environmental | Open in IMG/M |
| 3300009602 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 | Environmental | Open in IMG/M |
| 3300009603 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300009620 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51 | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300013098 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay11, Core 4567-28, 0-3 cm | Environmental | Open in IMG/M |
| 3300017702 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_10 viral metaG | Environmental | Open in IMG/M |
| 3300017704 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_07 viral metaG | Environmental | Open in IMG/M |
| 3300017718 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_11 viral metaG | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300020399 | Marine microbial communities from Tara Oceans - TARA_B100000470 (ERX555969-ERR598947) | Environmental | Open in IMG/M |
| 3300021068 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 100m 12015 | Environmental | Open in IMG/M |
| 3300021084 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 | Environmental | Open in IMG/M |
| 3300021442 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 | Environmental | Open in IMG/M |
| 3300024052 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_5 | Environmental | Open in IMG/M |
| 3300024057 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_9 | Environmental | Open in IMG/M |
| 3300024517 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3 | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300025038 | Marine viral communities from Cariaco Basin, Caribbean Sea - 24B_WHOI_OMZ_CsCl (SPAdes) | Environmental | Open in IMG/M |
| 3300025066 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025069 | Marine viral communities from the Pacific Ocean - LP-38 (SPAdes) | Environmental | Open in IMG/M |
| 3300025096 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025109 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025112 | Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025122 | Marine viral communities from the Pacific Ocean - ETNP_2_300 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025131 | Marine viral communities from the Pacific Ocean - ETNP_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025301 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 (SPAdes) | Environmental | Open in IMG/M |
| 3300026103 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026115 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3827_250 (SPAdes) | Environmental | Open in IMG/M |
| 3300027856 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_23 | Environmental | Open in IMG/M |
| 3300027868 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_22 | Environmental | Open in IMG/M |
| 3300031775 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315 | Environmental | Open in IMG/M |
| 3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
| 3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24515J20084_10119641 | 3300001743 | Marine | YKFKNRTLRFVKVEDIRFTILEYKDNKIDAKQLVEKLEQLINKYE* |
| JGI25133J35611_100612904 | 3300002514 | Marine | MSYKNTLRFVRIEDIRFPILEYKDNKIDAKELINKLEKLINKYEKNK* |
| JGI25133J35611_101155561 | 3300002514 | Marine | KMSYKNTLRYIRIEEIRFPILEYKDNKIDAKELVEKLEKLINKYE* |
| Ga0066851_100444393 | 3300005427 | Marine | MSYKNTLRYIRIEDIRFPILEYKDNKIDAKQLVEKLEQLINKYE* |
| Ga0066850_102015054 | 3300005605 | Marine | LRYIRIEEIRFPILEYKDNKIDAKQLVEKLEQLINKYE* |
| Ga0098033_10428193 | 3300006736 | Marine | MSYKNTLRYIRIEEIRFPILEYKDNKIDAKELVEKLEQLINKYE* |
| Ga0098033_12349512 | 3300006736 | Marine | MSYKNTLRFVRIEDIRFPILEYKDNKIDAKQLVEKLEKLINKYE* |
| Ga0098035_10386547 | 3300006738 | Marine | MSYKNTLRFVRIEDIRLPILEYKDNKIDAKQLVERLEQLINKYE* |
| Ga0098035_10637233 | 3300006738 | Marine | MKKTLRFVRIEDIRFPILEYKDNKIDAKQLVEKLEQLINKYE* |
| Ga0098035_10891454 | 3300006738 | Marine | MKKTLRFVRIEDIRYPILEYKDNKIDAKQLVEKLEKLINKYE* |
| Ga0098035_11959722 | 3300006738 | Marine | MKKTLRFVRIEDIRFPILEYKEKKIDAKKLVEKLEKLINKYE* |
| Ga0098035_12036232 | 3300006738 | Marine | MSYKNTLRYIRIEEIRFPILEYKDNKIDAKELVEKLEKLINKYE* |
| Ga0098058_10626971 | 3300006750 | Marine | TLRFVRIEDIRFPILEYKDNKIDAKELINKLEKLINKYE* |
| Ga0098058_10996762 | 3300006750 | Marine | MSYKNTLRYIRIEEIRFPILEYKDNKIDATQLVEKLEQLINKYE* |
| Ga0098040_10238198 | 3300006751 | Marine | MSYKNTLRFVRIEDIRFPILEYKDNKINAKQLIEKLEQLINKYE* |
| Ga0098040_10271963 | 3300006751 | Marine | MKKTLRFVRIEDIRLPILEYKDNKIDAKQLVEKLEKLINKYE* |
| Ga0098040_10780313 | 3300006751 | Marine | MSYKNTLRFVRIEDIRYPILEYKDNKIDAKQLVEKLEKLINKYE* |
| Ga0098048_12319943 | 3300006752 | Marine | MSYKNTLRFVRIEDIRFPILEYKDNKIDAKQLVEKLEKLINKY |
| Ga0098039_11978772 | 3300006753 | Marine | MKKTLRFIRIEDIRYPILEYKDNKIDAKELINKLEKLINK* |
| Ga0098044_11839541 | 3300006754 | Marine | MSYKKTLRFVRIEDIRFPILEYKDNKIDAKQLVEKLEQLINKYE* |
| Ga0098071_1011702 | 3300006768 | Marine | MKKTLRFVRIEDIRFPILEYKDNKIDAKELITKLEKLINKYEKNK* |
| Ga0098054_10291405 | 3300006789 | Marine | MKKTLRFVRIEEIRFPILEYKDNKIDAKQLVEKLEQLINKYE* |
| Ga0098054_13085233 | 3300006789 | Marine | MKKTLRFVRVEDIRFPILEYKDNKIDAKQLVEKLEKLINKYE* |
| Ga0098055_10496381 | 3300006793 | Marine | KMSYKNTLRYIRIEEIRFPILEYKDNKIDAKQLVEKLEQLINKYE* |
| Ga0098055_12648793 | 3300006793 | Marine | MKKTLRFVRIEDIRFPILEYKDNKIDAKQLVEKLEKLINKYE* |
| Ga0098053_10612761 | 3300006923 | Marine | IRIEEIRFPILEYKDNKIDATQLVEKLEQLINKYE* |
| Ga0098053_10645713 | 3300006923 | Marine | MSYKNTLRFVRIEDIRFPILEYKDNKIDAKELINKLEKLINKYE* |
| Ga0098057_11557981 | 3300006926 | Marine | KNTLRFVRIEDIRFPILEYKDNKIDAKELVKKLEQLINKYE* |
| Ga0098041_11103543 | 3300006928 | Marine | MVKMKKTLRFVRIEEIRFPILEYKDNKIDAKELVEKLEKLINKYE* |
| Ga0098036_10236586 | 3300006929 | Marine | MKKTLRFVRIEDIRFPILEYKDNKIDAKELINKLEEVINE* |
| Ga0105019_10710461 | 3300007513 | Marine | MKKTLRFVRIEDIRFPILEYKDNKIDAKELVNKLEKLINKDEKNKQTI* |
| Ga0110931_11639463 | 3300007963 | Marine | MSYKNTLRYIRIEEIRYPILEYKDNKIDAKELVEKLEKLINKYE* |
| Ga0098052_11472394 | 3300008050 | Marine | YKNTLRYIRIEEIRFPILEYKDNKIDAKQLVEKLEKLINKYE* |
| Ga0098052_12165144 | 3300008050 | Marine | MSYKNTLRFVRIEDIRYPILEYKDNKIDAKELINKLEKLIN |
| Ga0098052_12310293 | 3300008050 | Marine | MSYKNTLRYIRIEEIRYPILEYKDNKIDAKELINKLEKLINKYE* |
| Ga0098062_10533933 | 3300008051 | Marine | KMKKTLRFVRIEDIRFPILEYKDNKIDAKELINKLEKLINKYE* |
| Ga0114910_100364510 | 3300008220 | Deep Ocean | MNYKKTLRFVRIEDIRFPILEYKDNKIDAKKLVEKLEKLINKYE* |
| Ga0115651_10024113 | 3300008952 | Marine | MKKTLRFVRIEDIRFPILEYKDNKIDAKELVNKLEKLINKYEKNK* |
| Ga0118728_10056338 | 3300009129 | Marine | MKKTLRFVRIEDIRFPILEYKDNKIDAKELINKLEKLINKYEKNK* |
| Ga0114909_11596653 | 3300009414 | Deep Ocean | MKKTLRFVRIEDIRFPILEYKDNKIDAKELINKYE* |
| Ga0114908_10831643 | 3300009418 | Deep Ocean | MKKTLRFVRIEDIRFPILEYKDNKIDAKELINKLEKLINKYE* |
| Ga0114925_106354474 | 3300009488 | Deep Subsurface | MKKTLRFVRIEDIRFPILEYKDNKIDAKELINKLEKLINKQI* |
| Ga0114925_107309982 | 3300009488 | Deep Subsurface | MKKTLRFVRIEDIRFPILEYKDNKIDAKELINKLEQLINKYE* |
| Ga0114920_101107323 | 3300009528 | Deep Subsurface | MIRIEDIRFPILEYKDNKIDAKELINKLEKLINKYE* |
| Ga0114900_10709153 | 3300009602 | Deep Ocean | MKKTLRFVRIEDIRFPILEYKDNKIDAKELINKLEEVIN* |
| Ga0114911_10030942 | 3300009603 | Deep Ocean | MNYKKTLRFVKIEDIRYPILEYKDNKIDAKELINKLEKLINKYE* |
| Ga0114906_11348173 | 3300009605 | Deep Ocean | MKKTLRFVRIEDIKFPILEYKDNKIDAQQLVEKLEQLINKYE* |
| Ga0114912_11479122 | 3300009620 | Deep Ocean | MKKTLRFVRIEDIRFPILEYKDNKIDAKELINKLEVINE* |
| Ga0098049_10527721 | 3300010149 | Marine | MKKTLRFVRIEDIRFPILEYKDNKIDAKELINKLEKLINKYD* |
| Ga0098056_12286743 | 3300010150 | Marine | MKKTLRFVRIEDIRFPILEYKDNKIDAKELVEKLEKLINKYE* |
| Ga0098059_14242181 | 3300010153 | Marine | KMSYKNTLRFVRIEDIRFPILEYKDNKIDAKQLVEKLEKLINKYE* |
| Ga0098047_101208473 | 3300010155 | Marine | MSYKNTLRFVRIEDIRFPILEYKDNKIDAKQLVERLEQLINKYE* |
| Ga0098047_103648833 | 3300010155 | Marine | YKRQTRFVRIEDIRFPILEYKDNKIDAKELVKKLEQLINKYE* |
| Ga0098047_104127493 | 3300010155 | Marine | MKKILRFVRIEDIRFPILEYKDNKIDAKELINKLEKLINKYE* |
| Ga0164320_105144824 | 3300013098 | Marine Sediment | FVKVEDIRFPILEYKDNKIDAKQLVEKLEQLINKYE* |
| Ga0181374_10568824 | 3300017702 | Marine | RFVRIEDIRFPILEYKDNKIDAKELVEKLEKLINKYE |
| Ga0181374_10651001 | 3300017702 | Marine | IMKKTLRFVRMEEIRFHILEYKDNKIDAKQLVEKLEKLINKYE |
| Ga0181371_10554603 | 3300017704 | Marine | MKKTLRFVRIEDIRFPILEYKDNKINAKQLIEKLEQLINKYE |
| Ga0181375_10285645 | 3300017718 | Marine | MSYKNTLRFVRIEDIRFLILEYKDNKIDAKELINKLEEVINE |
| Ga0181417_10005913 | 3300017730 | Seawater | MVKMKKTLRFVRIEEIRFPILEYKDNKIDAKELVEKLEKLINKLNK |
| Ga0181413_11874621 | 3300017765 | Seawater | TLRFVRIEDIRFPILEYKDNKIDAKELVEKLEKLINKLNK |
| Ga0181430_10239743 | 3300017772 | Seawater | MKKTLRFVRIEEIRFPILEYKDNKIDAKELINKLEKLINKYE |
| Ga0181432_11413443 | 3300017775 | Seawater | MIRIEDIRFPILEYKDNKIDAKELINKLEKLINKYEKNK |
| Ga0181432_11719992 | 3300017775 | Seawater | MGYKRQIRFVRIEDIRFPILEYKDNKIEAKELVEKLEKLINND |
| Ga0211623_102954993 | 3300020399 | Marine | MIRIEDIRFLILEYKDNKIDAKELINKLEQLINKYE |
| Ga0206684_10433984 | 3300021068 | Seawater | MKKTLRFVRIEDIRFLILEYKDNKIDAKELINKLEKLINKYE |
| Ga0206678_100445053 | 3300021084 | Seawater | MKKTLRFVRIEDIRFPILEYKDNKIDAKELINKLEKLINKYE |
| Ga0206685_1000387113 | 3300021442 | Seawater | MKKTLRFVRIEDIRLPILEYKDNKIDAKQLVEKLEKLINKYE |
| Ga0206685_100165168 | 3300021442 | Seawater | MIRIEDIRFPILEYKDNKIDAKELINKLEKLINKYE |
| Ga0206685_102396002 | 3300021442 | Seawater | MKKTLRFIRIEDIRFPILEYKDGKINANELVEKLEIIINEIDLTSRYE |
| (restricted) Ga0255050_1000122310 | 3300024052 | Seawater | MKKTLRFVRIEDIRFPILEYKDNKIDAKELVTKLEKLINKYE |
| (restricted) Ga0255050_100246612 | 3300024052 | Seawater | MKKTLRFVRIEDIRFPILEYKDNKIDAKELITKLEKLINKYEKNK |
| (restricted) Ga0255051_103417363 | 3300024057 | Seawater | YTKIMKKTLRFVRIEDIRFPILEYKDNKIDAKELITKLEKLINKYEKNK |
| (restricted) Ga0255049_103963781 | 3300024517 | Seawater | MKKTLRFVRIEDIRFPILEYKDNKIDAKELINKLEQLINKYE |
| (restricted) Ga0255048_103887134 | 3300024518 | Seawater | MIRIEDIRFPILEYKDNKIDAKELINKLEQLINKYE |
| Ga0208670_1273563 | 3300025038 | Marine | MKKTLRFVRIEDIRFPILEYKDNKIDAKELVNKLEKLINKYEKNK |
| Ga0208012_10215045 | 3300025066 | Marine | MSYKNTLRYIRIEEIRFPILEYKDNKIDAKELVEKLEKLINKYE |
| Ga0208012_10367722 | 3300025066 | Marine | MKKTLRFVRIEDIRFPILEYKDNKIDAKQLVEKLEQLINKYE |
| Ga0207887_10347954 | 3300025069 | Marine | RFVKVEDIRFPILEYKDNKIDANKLVEKLEKLINKYE |
| Ga0208011_10103505 | 3300025096 | Marine | MSYKNTLRFVRIEDIRYPILEYKDNKIDAKQLVEKLEKLINKYE |
| Ga0208011_10125765 | 3300025096 | Marine | MSYKNTLRFVRIEDIRFPILEYKDNKINAKQLIEKLEQLINKYE |
| Ga0208011_10316954 | 3300025096 | Marine | MSYKNTLRYIRIEEIRFPILEYKDNKIDAKQLVEKLEQLINKYE |
| Ga0208793_10819284 | 3300025108 | Marine | YKNTLRYIRIEEIRFPILEYKDNKIDAKELVEKLEKLINKYE |
| Ga0208553_10878904 | 3300025109 | Marine | MSYKNTLRFVRIEDIRFPILEYKDNKIDAKQLVEKLEKLIN |
| Ga0208158_10594503 | 3300025110 | Marine | MVKMKKTLRFVRIEEIRFPILEYKDNKIDAKELVEKLEKLINKYE |
| Ga0209349_11650003 | 3300025112 | Marine | MKKILRFVRIEDIRFLILEYKDNKIDAKELVTKLEKLINKYE |
| Ga0208790_11475494 | 3300025118 | Marine | YTKMSYKNTLRFVRIEDIRYPILEYKDNKIDAKQLVEKLEKLINKYE |
| Ga0208790_11556623 | 3300025118 | Marine | MKKTLRFVRIEDIRLPILEYKDNKIDAKQLVEKLEKLINK |
| Ga0209434_11424373 | 3300025122 | Marine | MSYKNTLRFVRIEDIRFPILEYKDNKIDAKQLVEKLEQLINKYE |
| Ga0208919_10376281 | 3300025128 | Marine | MKKTLRFVRIEDIRFPILEYKDNKIDAKELINKLEEVINE |
| Ga0208919_11926913 | 3300025128 | Marine | MKKTLRFVRIEDIRFPILEYKDNKIDAKELINKLEKLINK |
| Ga0209128_10540437 | 3300025131 | Marine | MSYKNTLRYIRIEEIRFPILEYKDNKIDAKQLVEKLEQ |
| Ga0209128_10719493 | 3300025131 | Marine | MSYKNTLRYIRIEEIRFPILEYKDNKIDAKQLVEKLEKLINKYE |
| Ga0209128_10978263 | 3300025131 | Marine | MKKTLRFVRIEEIRFPILEYKDNKIDAKQLVEKLEQLINKYE |
| Ga0208299_10873984 | 3300025133 | Marine | MKKTLRFVRIEDIRFPILEYKDNKIDAKQLVEKLEKLINKYE |
| Ga0208299_12026731 | 3300025133 | Marine | MSYKNTLRFVRIEDIRYPILEYKDNKIDAKQLVEKLEKLINKQI |
| Ga0208299_12428783 | 3300025133 | Marine | MSYKNTLRYIRIEEIRYPILEYKDNKIDAKELVEKLEKLINKYE |
| Ga0209756_11074331 | 3300025141 | Marine | MKKTLRFVRIEDIRFPILEYKDNKIEAKQLVEKLEKLINKYE |
| Ga0208450_11387583 | 3300025301 | Deep Ocean | VKIEDIRYPILEYKDNKIDAKELINKLEKLINKYE |
| Ga0208451_10305433 | 3300026103 | Marine Oceanic | MQKQKKELKMKRTKRFVRIEDIRFPILEYKDGKINAKKLVEKLEKIINELEL |
| Ga0208560_10195141 | 3300026115 | Marine Oceanic | MKKTLRFVRIEDIRFPILEYKDNKIDAKELINKLEKLINKYEKNK |
| (restricted) Ga0255054_101233036 | 3300027856 | Seawater | MKKTLRFVRIEDIRFPILEYKDNKIDAKELVIKLEKLINKYE |
| (restricted) Ga0255053_100757165 | 3300027868 | Seawater | MKKTLRFVRIEDIRFLILEYKDNKIDAKELINKLEQLINKYE |
| Ga0315326_101619111 | 3300031775 | Seawater | MKKTLRFVRIEDIRFPILEYKDNKIDAKELINKLEQL |
| Ga0315321_106879583 | 3300032088 | Seawater | MKKTLRFVRIEDIRFLILEYKDNKIDAKELINKLEEVINE |
| Ga0315334_109790161 | 3300032360 | Seawater | MKKTLRFVRIEDIRLPILEYKDNKIDAKQLVEKLEKLINKY |
| ⦗Top⦘ |