| Basic Information | |
|---|---|
| Family ID | F093688 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MAITYTWTIPTLERHTADGGVYIAHWRCTGVDDDGNSASSY |
| Number of Associated Samples | 78 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.17 % |
| % of genes from short scaffolds (< 2000 bps) | 83.02 % |
| Associated GOLD sequencing projects | 63 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (25.472 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (43.396 % of family members) |
| Environment Ontology (ENVO) | Unclassified (70.755 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (88.679 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 39.13% Coil/Unstructured: 60.87% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF13884 | Peptidase_S74 | 40.57 |
| PF13392 | HNH_3 | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.53 % |
| Unclassified | root | N/A | 25.47 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000116|DelMOSpr2010_c10122477 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 936 | Open in IMG/M |
| 3300001460|JGI24003J15210_10086803 | Not Available | 930 | Open in IMG/M |
| 3300006027|Ga0075462_10269841 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| 3300006752|Ga0098048_1223326 | All Organisms → Viruses | 553 | Open in IMG/M |
| 3300006802|Ga0070749_10376208 | Not Available | 786 | Open in IMG/M |
| 3300006803|Ga0075467_10484195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium SB2 | 637 | Open in IMG/M |
| 3300006810|Ga0070754_10091091 | All Organisms → Viruses | 1520 | Open in IMG/M |
| 3300006810|Ga0070754_10110188 | All Organisms → Viruses | 1351 | Open in IMG/M |
| 3300006869|Ga0075477_10255052 | Not Available | 705 | Open in IMG/M |
| 3300006874|Ga0075475_10014981 | All Organisms → Viruses → Predicted Viral | 3864 | Open in IMG/M |
| 3300006874|Ga0075475_10108417 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1248 | Open in IMG/M |
| 3300006916|Ga0070750_10096804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 1371 | Open in IMG/M |
| 3300006921|Ga0098060_1125166 | Not Available | 720 | Open in IMG/M |
| 3300006924|Ga0098051_1005612 | All Organisms → Viruses → Predicted Viral | 4056 | Open in IMG/M |
| 3300006924|Ga0098051_1040198 | All Organisms → Viruses → Predicted Viral | 1309 | Open in IMG/M |
| 3300006925|Ga0098050_1001149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9207 | Open in IMG/M |
| 3300007234|Ga0075460_10250285 | All Organisms → Viruses | 591 | Open in IMG/M |
| 3300007276|Ga0070747_1032440 | All Organisms → cellular organisms → Bacteria | 2066 | Open in IMG/M |
| 3300007346|Ga0070753_1053377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 1656 | Open in IMG/M |
| 3300007346|Ga0070753_1099224 | All Organisms → Viruses → Predicted Viral | 1139 | Open in IMG/M |
| 3300007346|Ga0070753_1219933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 697 | Open in IMG/M |
| 3300007539|Ga0099849_1188278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 781 | Open in IMG/M |
| 3300007540|Ga0099847_1198835 | Not Available | 585 | Open in IMG/M |
| 3300007640|Ga0070751_1133623 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium | 1003 | Open in IMG/M |
| 3300007640|Ga0070751_1170510 | All Organisms → Viruses | 860 | Open in IMG/M |
| 3300008012|Ga0075480_10053616 | All Organisms → Viruses → Predicted Viral | 2358 | Open in IMG/M |
| 3300008012|Ga0075480_10106847 | Not Available | 1562 | Open in IMG/M |
| 3300008012|Ga0075480_10124791 | All Organisms → Viruses | 1421 | Open in IMG/M |
| 3300009001|Ga0102963_1197787 | Not Available | 802 | Open in IMG/M |
| 3300009172|Ga0114995_10223963 | All Organisms → Viruses → Predicted Viral | 1041 | Open in IMG/M |
| 3300009445|Ga0115553_1320401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 596 | Open in IMG/M |
| 3300009529|Ga0114919_10396993 | All Organisms → Viruses | 959 | Open in IMG/M |
| 3300010149|Ga0098049_1096555 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 926 | Open in IMG/M |
| 3300010150|Ga0098056_1214436 | Not Available | 641 | Open in IMG/M |
| 3300010392|Ga0118731_110668219 | All Organisms → Viruses | 592 | Open in IMG/M |
| 3300013010|Ga0129327_10317219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium SB2 | 810 | Open in IMG/M |
| 3300016776|Ga0182046_1598645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-7 | 638 | Open in IMG/M |
| 3300017697|Ga0180120_10294345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 651 | Open in IMG/M |
| 3300017697|Ga0180120_10374623 | Not Available | 561 | Open in IMG/M |
| 3300017719|Ga0181390_1052742 | All Organisms → Viruses → Predicted Viral | 1188 | Open in IMG/M |
| 3300017719|Ga0181390_1074600 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 947 | Open in IMG/M |
| 3300017719|Ga0181390_1084065 | Not Available | 874 | Open in IMG/M |
| 3300017726|Ga0181381_1058310 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 839 | Open in IMG/M |
| 3300017751|Ga0187219_1038283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1640 | Open in IMG/M |
| 3300017751|Ga0187219_1090537 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 942 | Open in IMG/M |
| 3300018413|Ga0181560_10066660 | All Organisms → Viruses → Predicted Viral | 2052 | Open in IMG/M |
| 3300018413|Ga0181560_10497254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
| 3300018415|Ga0181559_10381919 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 775 | Open in IMG/M |
| 3300018416|Ga0181553_10072937 | All Organisms → Viruses → Predicted Viral | 2190 | Open in IMG/M |
| 3300018416|Ga0181553_10214444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1106 | Open in IMG/M |
| 3300018417|Ga0181558_10116527 | All Organisms → Viruses | 1635 | Open in IMG/M |
| 3300018417|Ga0181558_10289212 | Not Available | 899 | Open in IMG/M |
| 3300018420|Ga0181563_10301877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 936 | Open in IMG/M |
| 3300019459|Ga0181562_10252656 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 896 | Open in IMG/M |
| 3300019750|Ga0194000_1012009 | All Organisms → Viruses → Predicted Viral | 1021 | Open in IMG/M |
| 3300020176|Ga0181556_1126722 | All Organisms → Viruses → Predicted Viral | 1096 | Open in IMG/M |
| 3300021373|Ga0213865_10202911 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 979 | Open in IMG/M |
| 3300021958|Ga0222718_10315724 | Not Available | 806 | Open in IMG/M |
| 3300021960|Ga0222715_10030725 | Not Available | 3873 | Open in IMG/M |
| 3300021960|Ga0222715_10092609 | Not Available | 1968 | Open in IMG/M |
| 3300021962|Ga0222713_10714671 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 570 | Open in IMG/M |
| 3300021964|Ga0222719_10597844 | Not Available | 643 | Open in IMG/M |
| 3300022072|Ga0196889_1021620 | All Organisms → Viruses → Predicted Viral | 1337 | Open in IMG/M |
| 3300022072|Ga0196889_1059349 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 731 | Open in IMG/M |
| 3300022072|Ga0196889_1063115 | Not Available | 705 | Open in IMG/M |
| 3300022164|Ga0212022_1053210 | All Organisms → Viruses | 626 | Open in IMG/M |
| 3300022183|Ga0196891_1095674 | Not Available | 523 | Open in IMG/M |
| 3300022187|Ga0196899_1059783 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1219 | Open in IMG/M |
| 3300022187|Ga0196899_1085144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 960 | Open in IMG/M |
| 3300022201|Ga0224503_10275094 | Not Available | 556 | Open in IMG/M |
| 3300022218|Ga0224502_10106202 | Not Available | 1066 | Open in IMG/M |
| 3300022922|Ga0255779_1090347 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1675 | Open in IMG/M |
| 3300022925|Ga0255773_10036403 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3103 | Open in IMG/M |
| 3300022925|Ga0255773_10037336 | All Organisms → Viruses → Predicted Viral | 3053 | Open in IMG/M |
| 3300022925|Ga0255773_10147357 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1145 | Open in IMG/M |
| 3300022925|Ga0255773_10208695 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 874 | Open in IMG/M |
| (restricted) 3300023109|Ga0233432_10029729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6 | 3761 | Open in IMG/M |
| (restricted) 3300023109|Ga0233432_10282804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
| 3300025071|Ga0207896_1018435 | Not Available | 1219 | Open in IMG/M |
| 3300025085|Ga0208792_1011015 | All Organisms → Viruses → Predicted Viral | 2048 | Open in IMG/M |
| 3300025108|Ga0208793_1140584 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 645 | Open in IMG/M |
| 3300025120|Ga0209535_1121914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 884 | Open in IMG/M |
| 3300025508|Ga0208148_1082101 | Not Available | 725 | Open in IMG/M |
| 3300025610|Ga0208149_1107292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
| 3300025645|Ga0208643_1059194 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1148 | Open in IMG/M |
| 3300025653|Ga0208428_1042192 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium | 1413 | Open in IMG/M |
| 3300025653|Ga0208428_1150413 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 624 | Open in IMG/M |
| 3300025671|Ga0208898_1046210 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1621 | Open in IMG/M |
| 3300025671|Ga0208898_1049534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 1536 | Open in IMG/M |
| 3300025674|Ga0208162_1092084 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 917 | Open in IMG/M |
| 3300025751|Ga0208150_1120992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 844 | Open in IMG/M |
| 3300025751|Ga0208150_1240905 | Not Available | 548 | Open in IMG/M |
| 3300025803|Ga0208425_1068419 | Not Available | 861 | Open in IMG/M |
| 3300025806|Ga0208545_1021266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Zobellviridae → Cobavirinae → Veravirus → Roseobacter phage CRP-5 | 2197 | Open in IMG/M |
| 3300025840|Ga0208917_1079851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1231 | Open in IMG/M |
| 3300027753|Ga0208305_10120602 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 973 | Open in IMG/M |
| 3300031579|Ga0308134_1122135 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-7 | 598 | Open in IMG/M |
| 3300032277|Ga0316202_10073247 | All Organisms → Viruses → Predicted Viral | 1590 | Open in IMG/M |
| 3300033742|Ga0314858_024854 | All Organisms → Viruses → Predicted Viral | 1346 | Open in IMG/M |
| 3300034374|Ga0348335_028416 | All Organisms → Viruses → Predicted Viral | 2511 | Open in IMG/M |
| 3300034374|Ga0348335_052886 | All Organisms → Viruses → Predicted Viral | 1551 | Open in IMG/M |
| 3300034375|Ga0348336_059288 | All Organisms → Viruses → Predicted Viral | 1510 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 43.40% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 15.09% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 15.09% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 5.66% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.72% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.83% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.89% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.89% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.94% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.94% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.94% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.94% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.94% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.94% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.94% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.94% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.94% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009445 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 | Environmental | Open in IMG/M |
| 3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300016776 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011505AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300018413 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018415 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019750 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States - FLT_6-7_MG | Environmental | Open in IMG/M |
| 3300020176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022201 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022218 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13 | Environmental | Open in IMG/M |
| 3300022922 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG | Environmental | Open in IMG/M |
| 3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027753 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes) | Environmental | Open in IMG/M |
| 3300031579 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_101224771 | 3300000116 | Marine | MAVTYTWTIPTLEHEIADGGVYIAHWRCTGVDDDG |
| JGI24003J15210_100868031 | 3300001460 | Marine | MAITYTWTITNLSYEVSDGGVYFADWVCTGVDDDGNTASKANSCHLI |
| Ga0075462_102698412 | 3300006027 | Aqueous | MVTYTWTIPTLERHTSDGGVYIAHWRCTGVDDDGNSASSY |
| Ga0098048_12233261 | 3300006752 | Marine | MAITYTWTIPTLEHEIADGGVYVAHWRCTGVDEDGNSASSYGTCGLTYDASAADF |
| Ga0098055_11347711 | 3300006793 | Marine | MAVTYTWTIPTVERNLADGGVTIAHWRCSAVDGDYS |
| Ga0070749_103762083 | 3300006802 | Aqueous | MAIEYTWSIPTTEYSKEDGGIFCIHWRCTGVDDDGNSASSYGTC |
| Ga0075467_104841951 | 3300006803 | Aqueous | MAVTYTWTIPTLEHEIADGGVYIAHWRCTGQDDDGN |
| Ga0070754_100910911 | 3300006810 | Aqueous | MAITYTWTIPTLEHEIADGGVYIAHWRCSGVDDDGNS |
| Ga0070754_101101883 | 3300006810 | Aqueous | MITYTWTIPALERHTSDGGVYIAHWRCTGVDDDGNS |
| Ga0075477_102550523 | 3300006869 | Aqueous | MITYTWTIPTLERHTSDGGVYIAHWRCTGVDDDGNSASSYG |
| Ga0075475_100149811 | 3300006874 | Aqueous | MAIEYTWSIPTTEYSKEDGGIFCIHWRCTGVDDDGNSASSYGTCGLTYDASA |
| Ga0075475_101084171 | 3300006874 | Aqueous | MITYTWTIPTLERHTSDGGVYIAHWRCTGVDDDGNSASSY |
| Ga0070750_100968043 | 3300006916 | Aqueous | MAVVYTWTIPTLEHKTADGGVYIAHWRCTGVDDDGNSA |
| Ga0098060_11251663 | 3300006921 | Marine | MVTYTWSIPTVERNLADGGVTVAHWRCTGVEGDNSASSYGTAGFTPD |
| Ga0098051_10056126 | 3300006924 | Marine | MAITYTWTIPTLEHEIADGGVYIAHWRCTGVDEDGNSAS |
| Ga0098051_10401981 | 3300006924 | Marine | MAVTYTWSIPTLEHKTADGGVYIAHWRCTGVDDDGNSASSY |
| Ga0098050_10011499 | 3300006925 | Marine | MITYTWTIPTLERHTSDGGVYIAHWRCTGVDDDGNS |
| Ga0075460_102502851 | 3300007234 | Aqueous | MAITYTWTIPTLERHTSDGGVYIAHWRCSGVDEDGNSASSY |
| Ga0070747_10324401 | 3300007276 | Aqueous | MAITYTWTIPTTERTLADGGVTVAHWRCSAVDGDYSA |
| Ga0070753_10533771 | 3300007346 | Aqueous | MAIEYTWSIPTTEYSKEDGGIFCIHWRCTGVDDDGNSASSYGTCGLTYDAS |
| Ga0070753_10992243 | 3300007346 | Aqueous | MITYTWTIPALERHTSDGGVYIAHWRCTGVDDDGNSASS |
| Ga0070753_12199332 | 3300007346 | Aqueous | MAIAYTWTIPTLERHTSDGGVYIAHWRCTGVDEDGNTASSYG |
| Ga0099849_11882783 | 3300007539 | Aqueous | MIEYTWTIPTLERHTSDGGVYIAHWRCTGVDDDGNSA |
| Ga0099847_11988351 | 3300007540 | Aqueous | MAITYSWTIPTLERHTADGGVYIAHWRCTGVDDDGNSASSYG |
| Ga0070751_11336233 | 3300007640 | Aqueous | MAVTYTWTIPTLEHEIADGGVYIAHWRCSGVDDDG |
| Ga0070751_11705103 | 3300007640 | Aqueous | MAITYTWTIPTLEHEIADGGVYIAHWRCTGVDEDG |
| Ga0075480_100536161 | 3300008012 | Aqueous | MAVTYDWTIPTLERHTSDGGVYIAHWRCTGVDDDGNSASSY |
| Ga0075480_101068471 | 3300008012 | Aqueous | MAITYTWSIPTLERHTADGGVYIAHWRCTGVDDDGNTA |
| Ga0075480_101247913 | 3300008012 | Aqueous | MAITYTWTIPTLEHEIADGGVYIAHWRCTGVDDDGNSA |
| Ga0102963_11977873 | 3300009001 | Pond Water | MVTYTWSIPTTERTLADGGVTVAHWRCTGVEGDNSASSYGTAGFTPDASADG |
| Ga0114995_102239633 | 3300009172 | Marine | MAVVYNWTIPTLEHEIADGGVYVAHWRCSGVDGEY |
| Ga0115553_13204012 | 3300009445 | Pelagic Marine | MAITYTWTIPTLEHEIADGGVYIAHWRCTGVDDDGNTASSY |
| Ga0114919_103969931 | 3300009529 | Deep Subsurface | MAITYTWTIPTLERHTSDGGVYIAHWRCTGVDDDGNSASSYG |
| Ga0098049_10965552 | 3300010149 | Marine | MAITYTWTIPTLEHEIADGGVYIAHWRCTGQDDDGNTASS |
| Ga0098056_12144361 | 3300010150 | Marine | MAITYTWTIPTLEHEIADGGVYIAHWRCTGQDDDGNTASSYGTCS |
| Ga0118731_1106682192 | 3300010392 | Marine | MAITYTWTIPTLEHKTADGGVYVAHWRCVGQDDDGNTASSYGTCG |
| Ga0129327_103172191 | 3300013010 | Freshwater To Marine Saline Gradient | MAITYTWTIPNLEHELADGGVYIAHWRCTGQDDDGN |
| Ga0182046_15986452 | 3300016776 | Salt Marsh | MAITYTWTIPTLERHTSDGGVYIAHWRCTGVDDDGNSAS |
| Ga0180120_102943452 | 3300017697 | Freshwater To Marine Saline Gradient | MAITYTWTIPTLERHTSDGGVYIAHWRCQGVDDDGNSASSYG |
| Ga0180120_103746233 | 3300017697 | Freshwater To Marine Saline Gradient | MAITYTWTIPTLERHTSDGGVYIAHWRCTGVDDDGNSASS |
| Ga0181390_10527421 | 3300017719 | Seawater | MAITYTWTIPTLEHEIADGGVYIAHWRCTGQDEDGNTASS |
| Ga0181390_10746001 | 3300017719 | Seawater | MAITYTWTIPTLEHEIADGGVYTAHWRCTGVDDDGNTASSYG |
| Ga0181390_10840653 | 3300017719 | Seawater | MAVTYTWSIPTTERTLADGGVTVAHWRCTGVDDDGNTASSYGTCGLTYDASAYDFT |
| Ga0181381_10583101 | 3300017726 | Seawater | MAITYTWTIPTLERNTSDGGVYIAHWRCTGQDDDGNTAS |
| Ga0187219_10382833 | 3300017751 | Seawater | MAVTYTWSIPTTERTLADGGVTVAHWRCTGVDDDGNTASAYGTCGLTYDAS |
| Ga0187219_10905371 | 3300017751 | Seawater | MAITYTWTIPTLEHEIADGGVYTAHWRCTGVDDDGNTASS |
| Ga0181560_100666603 | 3300018413 | Salt Marsh | MAITYTWTIPTLERHTADGGVYIAHWRCTGVDDDGNSASSYG |
| Ga0181560_104972541 | 3300018413 | Salt Marsh | MVTYTWSIPTLERHTSDGGVYIAHWRCTGVDDDGNSA |
| Ga0181559_103819191 | 3300018415 | Salt Marsh | MVTYTWTIPTLERHTSDGGVYIAHWRCTGVDDDGN |
| Ga0181553_100729371 | 3300018416 | Salt Marsh | MAITYTWSIPTVERNLADGGVTIAHWRCTGVEGDNSASS |
| Ga0181553_102144442 | 3300018416 | Salt Marsh | MAITYTWTIPTLERHTSDGGVYIAHWRCTGVDDDGNSA |
| Ga0181558_101165271 | 3300018417 | Salt Marsh | MAITYSWTIPTLERHTSDGGVYIAHWRCTGVDDDGNS |
| Ga0181558_102892122 | 3300018417 | Salt Marsh | MAITYTWTIPTLERHTADGGVYIAHWRCTGVDDDGNSASSY |
| Ga0181563_103018771 | 3300018420 | Salt Marsh | MAVTYTWTIPTLERHTSDGGVYIAHWRCTGVDDDGN |
| Ga0181562_102526562 | 3300019459 | Salt Marsh | MAITYTWTIPTLERHTADGGVYIAHWRCTGVDDDGN |
| Ga0194000_10120093 | 3300019750 | Sediment | MAIEYTWSIPTTEYSKEDGGIFCIHWRCTGVDDDGNTASSYGTCGLTYDAS |
| Ga0181556_11267223 | 3300020176 | Salt Marsh | MAVTYTWTIPTLERHTADGGVYIAHWRCTGVDDDGNSAS |
| Ga0213865_102029112 | 3300021373 | Seawater | MAITYTWTIPTLEHEIADGGVYIAHWRCTGVDDDGNSAS |
| Ga0222718_103157243 | 3300021958 | Estuarine Water | MAITYTWTIPTLERHTADGGVYIAHWRCTGVDDDGNSA |
| Ga0222715_100307254 | 3300021960 | Estuarine Water | MAITYTWSIPTLEHEIADGGVYVAHWRCTGQDDDGNTASSYGTCGLTYDASA |
| Ga0222715_100926092 | 3300021960 | Estuarine Water | MVTYTWTIPTLEHEIADGGVYIAHWRCTGQDDDGNSASAYGTC |
| Ga0222713_107146711 | 3300021962 | Estuarine Water | MAITYTWTIPTLEHEIADGGVYIAHWRCTGVDEDGNSSSSYG |
| Ga0222719_105978441 | 3300021964 | Estuarine Water | MAVTYTWTVPTTERTLADGGVTVAHWRCTGVEGDNSASS |
| Ga0196889_10216203 | 3300022072 | Aqueous | MAITYTWTIPTLEHEIADGGVYIAHWRCTGQDDDGNTASSYG |
| Ga0196889_10593491 | 3300022072 | Aqueous | MAITYTWTIPTLEHEIADGGVYIAHWRCSGVDDDGNSASAYGT |
| Ga0196889_10631151 | 3300022072 | Aqueous | MAVTYTWTIPTLERHTSDGGVYIAHWRCTGVDDDGNSASSY |
| Ga0212022_10532102 | 3300022164 | Aqueous | MAITYTWTIPTLERHTADGGVYIAHWRCTGVDEDNNSAS |
| Ga0196887_10782461 | 3300022178 | Aqueous | MAVAYTWSIPTVERNLADGGVTIAHWRCSAVDGDY |
| Ga0196891_10956741 | 3300022183 | Aqueous | MAITYTWTIPTLERHTSDGGVYIAHWRCSGVDEDGNSAS |
| Ga0196899_10597831 | 3300022187 | Aqueous | MAIAYTWTIPTLERHTSDGGVYIAHWRCTGVDDDGNTASSYG |
| Ga0196899_10851441 | 3300022187 | Aqueous | MAITYTWTIPTLEHEIADGGVYIAHWRCTGVDDDGNSASSYG |
| Ga0224503_102750942 | 3300022201 | Sediment | MAVTYTWTIPTLEHEIADGGVYIAHWRCSGVDDDGNTA |
| Ga0224502_101062021 | 3300022218 | Sediment | MAITYTWTIPTLEHEIADGGVYIAHWRCTGVDDDGNTASAYGTCG |
| Ga0255779_10903473 | 3300022922 | Salt Marsh | MVTYTWTIPTLERHTSDGGVYIAHWRCTGVDDDGNTA |
| Ga0255773_100364034 | 3300022925 | Salt Marsh | MVTYTWTIPTLERHTSDGGVYIAHWRCTGVDDDGNS |
| Ga0255773_100373361 | 3300022925 | Salt Marsh | MAITYTWTIPTLERHTSDGGVYIAHWRCTGVDDDGN |
| Ga0255773_101473573 | 3300022925 | Salt Marsh | MVTYTWSIPTLERHTSDGGVYIAHWRCTGVDDDGNSASS |
| Ga0255773_102086951 | 3300022925 | Salt Marsh | MAITYTWTIPTLERHTSDGGVYIAHWRCTGVDDDGNTASA |
| (restricted) Ga0233432_100297294 | 3300023109 | Seawater | MAITYTWTIPTLEHEISDGGVYIAHWRCTGVDDDGNTASA |
| (restricted) Ga0233432_102828041 | 3300023109 | Seawater | MVTYTWTIPTLEHEIADGGVYIAHWRCTGVDDDGNTASAYGTCGL |
| Ga0207896_10184351 | 3300025071 | Marine | MAITYTWTITNLSHEVSDGGVYFADWVCTGVDDDGNTASKAN |
| Ga0208791_10352761 | 3300025083 | Marine | MAVVNTWTIPTVERNLADGGVTIAHWRCSAVDGDY |
| Ga0208792_10110151 | 3300025085 | Marine | MAITYTWTIPTLEHEIADGGVYVAHWRCTGVDDDG |
| Ga0208793_11405841 | 3300025108 | Marine | MAITYTWTIPTLEHEIADGGVYIAHWRCTGQDDDGNTASSYGTCSL |
| Ga0209535_11219141 | 3300025120 | Marine | MAITYTWTITNLSHEVSDGGVYFADWVCTGVDDDG |
| Ga0208148_10821011 | 3300025508 | Aqueous | MAITYTWTIPTLEHEIADGGVYIAHWRCTGQDDDGNTASSYGT |
| Ga0208149_11072922 | 3300025610 | Aqueous | MVTYTWTIPTLERHTSDGGVYIAHWRCTGVDDDGNSASS |
| Ga0208643_10591941 | 3300025645 | Aqueous | MAITYTWTIPTLEHEIADGGVYIAHWRCSGVDDDGNSASAY |
| Ga0208428_10421923 | 3300025653 | Aqueous | MAVTYTWTIPTVERNLADGGVTVCHWRCTGVDDDGNSASSYGTCGLTYDAS |
| Ga0208428_11504131 | 3300025653 | Aqueous | MAVTYTWTIPTLERHTSDGGVYIAHWRCSGVDEDGNTASSYGT |
| Ga0208898_10462101 | 3300025671 | Aqueous | MAIIYTWTIPTLERHTADGGVYIAHWRCTGVDDDGNSASS |
| Ga0208898_10495341 | 3300025671 | Aqueous | MAIEYTWSIPTTEYSKEDGGIFCIHWRCTGVDDDGNSAS |
| Ga0208162_10920841 | 3300025674 | Aqueous | MAITYTWTIPTLERHTSDGGVYIAHWRCTGVDDDGNS |
| Ga0208162_11805881 | 3300025674 | Aqueous | MAVTYTWTIPTVERNLADGGVTVAHWRCKGVEGDN |
| Ga0208150_11209922 | 3300025751 | Aqueous | MAVTYTWTIPTLERHTSDGGVYIAHWRCTGVDDDG |
| Ga0208150_12409052 | 3300025751 | Aqueous | MAIEYTWSIPTTEYSKEDGGIFCIHWRCTGVDDDGNSASSYGTCGLTYD |
| Ga0208425_10684192 | 3300025803 | Aqueous | MAITYTWTIPTLERHTSDGGVYIAHWRCTGVDDDGNTASSY |
| Ga0208545_10212661 | 3300025806 | Aqueous | MAITYTWTIPTLEHEIADGGVYIAHWRCSGVDDDGNSASA |
| Ga0208917_10798511 | 3300025840 | Aqueous | MAVTYTWTIPTLERHTSDGGVYIAHWRCTGVDDDGNTA |
| Ga0208305_101206022 | 3300027753 | Estuarine | MAVTYTWTIPTLEHEIADGGVYVAHWRCTGVDEDGNSASSYGTCGLTYDASAA |
| Ga0308134_11221352 | 3300031579 | Marine | MAITYTWTIPTLEHKIADGGVYVAHWRCNGVDADGNSASSYGTCGLTYDASSA |
| Ga0316202_100732472 | 3300032277 | Microbial Mat | MVTYTWTIPTLERHTSDGGVYIAHWRCTGVDDDGNTAS |
| Ga0314858_024854_1224_1346 | 3300033742 | Sea-Ice Brine | MAITYAWTIPTLEHEIADGGVYVAHWRCNGVDGESPSSPSS |
| Ga0348335_028416_2407_2511 | 3300034374 | Aqueous | MAVTYTWTIPTVERNLADGGVTIAHWRCSAVDGDY |
| Ga0348335_052886_1409_1549 | 3300034374 | Aqueous | MAIEYTWSIPTTEYSKEDGGIFCIHWRCTGVDDDGNSASSYGTCGLT |
| Ga0348336_059288_3_134 | 3300034375 | Aqueous | MAITYTWTIPTLEHEIADGGVYIAHWRCTGQDDDGNTASSYGTC |
| ⦗Top⦘ |