| Basic Information | |
|---|---|
| Family ID | F093683 |
| Family Type | Metagenome |
| Number of Sequences | 106 |
| Average Sequence Length | 54 residues |
| Representative Sequence | MSDEKRIRELSDRRARPRGGRREDDSQKPWYMRRRLWLAAASMVFVGWKRVRRIV |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 66.35 % |
| % of genes near scaffold ends (potentially truncated) | 20.75 % |
| % of genes from short scaffolds (< 2000 bps) | 73.58 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.566 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (11.321 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.472 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (62.264 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.17% β-sheet: 0.00% Coil/Unstructured: 57.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF03109 | ABC1 | 22.64 |
| PF00072 | Response_reg | 17.92 |
| PF12705 | PDDEXK_1 | 16.04 |
| PF13361 | UvrD_C | 10.38 |
| PF12838 | Fer4_7 | 3.77 |
| PF06727 | DUF1207 | 0.94 |
| PF13534 | Fer4_17 | 0.94 |
| PF04389 | Peptidase_M28 | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG0661 | Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family | Signal transduction mechanisms [T] | 22.64 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.57 % |
| Unclassified | root | N/A | 9.43 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886012|MBSR1b_contig_1110838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 1019 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101508527 | All Organisms → cellular organisms → Bacteria | 2549 | Open in IMG/M |
| 3300000571|JGI1358J11329_10107468 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300004114|Ga0062593_100417214 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300005178|Ga0066688_10046191 | All Organisms → cellular organisms → Bacteria | 2499 | Open in IMG/M |
| 3300005289|Ga0065704_10077360 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 4752 | Open in IMG/M |
| 3300005338|Ga0068868_100377363 | All Organisms → cellular organisms → Bacteria | 1219 | Open in IMG/M |
| 3300005340|Ga0070689_100126773 | All Organisms → cellular organisms → Bacteria | 2043 | Open in IMG/M |
| 3300005340|Ga0070689_100968273 | Not Available | 755 | Open in IMG/M |
| 3300005345|Ga0070692_10146750 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1340 | Open in IMG/M |
| 3300005364|Ga0070673_100319090 | All Organisms → cellular organisms → Bacteria | 1372 | Open in IMG/M |
| 3300005436|Ga0070713_100069024 | All Organisms → cellular organisms → Bacteria | 2979 | Open in IMG/M |
| 3300005440|Ga0070705_100108464 | All Organisms → cellular organisms → Bacteria | 1768 | Open in IMG/M |
| 3300005440|Ga0070705_100345434 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300005441|Ga0070700_100346221 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300005441|Ga0070700_100855727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
| 3300005445|Ga0070708_101868729 | Not Available | 557 | Open in IMG/M |
| 3300005535|Ga0070684_100012298 | All Organisms → cellular organisms → Bacteria | 6854 | Open in IMG/M |
| 3300005540|Ga0066697_10519938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
| 3300005545|Ga0070695_100277963 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
| 3300005559|Ga0066700_10480652 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300005564|Ga0070664_101744153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300005719|Ga0068861_101246736 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300005764|Ga0066903_108454098 | Not Available | 525 | Open in IMG/M |
| 3300005840|Ga0068870_10708460 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300005841|Ga0068863_100226956 | All Organisms → cellular organisms → Bacteria | 1800 | Open in IMG/M |
| 3300005876|Ga0075300_1067139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300005937|Ga0081455_10136576 | All Organisms → cellular organisms → Bacteria | 1910 | Open in IMG/M |
| 3300006046|Ga0066652_101388775 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 658 | Open in IMG/M |
| 3300006049|Ga0075417_10111502 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300006755|Ga0079222_10078955 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1651 | Open in IMG/M |
| 3300006844|Ga0075428_101105254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 837 | Open in IMG/M |
| 3300006852|Ga0075433_10042679 | All Organisms → cellular organisms → Bacteria | 3936 | Open in IMG/M |
| 3300006854|Ga0075425_100219390 | Not Available | 2187 | Open in IMG/M |
| 3300006871|Ga0075434_100000556 | All Organisms → cellular organisms → Bacteria | 28600 | Open in IMG/M |
| 3300006871|Ga0075434_100088391 | All Organisms → cellular organisms → Bacteria | 3099 | Open in IMG/M |
| 3300006914|Ga0075436_101245830 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300007004|Ga0079218_11667775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
| 3300007255|Ga0099791_10218512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 900 | Open in IMG/M |
| 3300009012|Ga0066710_101538641 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300009090|Ga0099827_10238749 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
| 3300009148|Ga0105243_10513794 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300009148|Ga0105243_11231376 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300009156|Ga0111538_10913288 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300009162|Ga0075423_12170347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300009176|Ga0105242_11372769 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300010038|Ga0126315_10782368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300010045|Ga0126311_10981934 | Not Available | 690 | Open in IMG/M |
| 3300010047|Ga0126382_12430921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300010373|Ga0134128_10683841 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300010398|Ga0126383_10588678 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
| 3300010400|Ga0134122_12108142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300010401|Ga0134121_10529553 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300010403|Ga0134123_10357183 | All Organisms → cellular organisms → Bacteria | 1322 | Open in IMG/M |
| 3300012198|Ga0137364_11116551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300012200|Ga0137382_10435977 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 926 | Open in IMG/M |
| 3300012203|Ga0137399_10154245 | All Organisms → cellular organisms → Bacteria | 1837 | Open in IMG/M |
| 3300012212|Ga0150985_108137730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300012469|Ga0150984_100373493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300013105|Ga0157369_12677931 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300013296|Ga0157374_10909365 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300014969|Ga0157376_11686742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300015371|Ga0132258_10331667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3755 | Open in IMG/M |
| 3300015371|Ga0132258_10903343 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2230 | Open in IMG/M |
| 3300015371|Ga0132258_11306391 | All Organisms → cellular organisms → Bacteria | 1833 | Open in IMG/M |
| 3300015371|Ga0132258_11528868 | All Organisms → cellular organisms → Bacteria | 1685 | Open in IMG/M |
| 3300015372|Ga0132256_100532113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1287 | Open in IMG/M |
| 3300015372|Ga0132256_103381891 | Not Available | 536 | Open in IMG/M |
| 3300015373|Ga0132257_100276398 | All Organisms → cellular organisms → Bacteria | 2012 | Open in IMG/M |
| 3300015374|Ga0132255_104237241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300018083|Ga0184628_10027461 | All Organisms → cellular organisms → Bacteria | 2831 | Open in IMG/M |
| 3300025908|Ga0207643_10370286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 902 | Open in IMG/M |
| 3300025910|Ga0207684_10795712 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300025917|Ga0207660_11329230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300025922|Ga0207646_10239199 | All Organisms → cellular organisms → Bacteria | 1640 | Open in IMG/M |
| 3300025928|Ga0207700_10005091 | All Organisms → cellular organisms → Bacteria | 7814 | Open in IMG/M |
| 3300025934|Ga0207686_10464930 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300025935|Ga0207709_10481514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 965 | Open in IMG/M |
| 3300025938|Ga0207704_10025313 | All Organisms → cellular organisms → Bacteria | 3236 | Open in IMG/M |
| 3300025945|Ga0207679_11911213 | Not Available | 541 | Open in IMG/M |
| 3300026075|Ga0207708_10030138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 4114 | Open in IMG/M |
| 3300026089|Ga0207648_10148226 | All Organisms → cellular organisms → Bacteria | 2070 | Open in IMG/M |
| 3300026121|Ga0207683_10254690 | All Organisms → cellular organisms → Bacteria | 1602 | Open in IMG/M |
| 3300026285|Ga0209438_1001823 | All Organisms → cellular organisms → Bacteria | 7077 | Open in IMG/M |
| 3300026315|Ga0209686_1020631 | All Organisms → cellular organisms → Bacteria | 2622 | Open in IMG/M |
| 3300026320|Ga0209131_1389919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300026325|Ga0209152_10063831 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
| 3300027835|Ga0209515_10020829 | All Organisms → cellular organisms → Bacteria | 6235 | Open in IMG/M |
| 3300027903|Ga0209488_11185514 | Not Available | 515 | Open in IMG/M |
| 3300027907|Ga0207428_11280095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300028536|Ga0137415_10102134 | All Organisms → cellular organisms → Bacteria | 2720 | Open in IMG/M |
| 3300031562|Ga0310886_10398021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 811 | Open in IMG/M |
| 3300031720|Ga0307469_10557164 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300031740|Ga0307468_100019732 | All Organisms → cellular organisms → Bacteria | 2940 | Open in IMG/M |
| 3300031740|Ga0307468_100020224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2917 | Open in IMG/M |
| 3300031740|Ga0307468_100214198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1317 | Open in IMG/M |
| 3300031740|Ga0307468_101137850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 698 | Open in IMG/M |
| 3300031740|Ga0307468_101142003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300031740|Ga0307468_102426690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300031938|Ga0308175_102656143 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300032003|Ga0310897_10014857 | All Organisms → cellular organisms → Bacteria | 2393 | Open in IMG/M |
| 3300032075|Ga0310890_10509918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 916 | Open in IMG/M |
| 3300032180|Ga0307471_100134199 | All Organisms → cellular organisms → Bacteria | 2341 | Open in IMG/M |
| 3300032180|Ga0307471_101204710 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 921 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.32% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.43% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 8.49% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.60% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 5.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.72% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.83% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 1.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.89% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.89% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.89% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.89% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.94% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.94% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000571 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005876 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300027835 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MBSR1b_0361.00004230 | 2162886012 | Miscanthus Rhizosphere | MDDEKRVRTFSDRRARPRGGRRDGDSAKPWYRRHAWWLAAVSMMFVNWKRIRRLV |
| INPhiseqgaiiFebDRAFT_1015085271 | 3300000364 | Soil | MGDDKRIKVFPDRRARPRGGRRGSDSQRPWYLRNGVLLAAASMIFVGWKRVR |
| JGI1358J11329_101074683 | 3300000571 | Groundwater | MGDDKRIKELEDRRAGRRGGRRESDSPKPWYMRRRLWLAAASIVFVGWKRVRRIV* |
| Ga0062593_1004172143 | 3300004114 | Soil | MSAEQRVNGSDRRANPRGGRREHDSPKPWYVRRRWWLAAVSLMFVGWKRVRRLV* |
| Ga0066688_100461913 | 3300005178 | Soil | MGDDKHIRAVSDRRARPRGGRRDGDSQKPWYQRHALWLAAASMVFVGWKRVRRIV* |
| Ga0065704_100773601 | 3300005289 | Switchgrass Rhizosphere | MSAEQRVNGTDRRANPRGGRREDDSAKPWYVRRRWWLAAVALVFVGWK |
| Ga0068868_1003773631 | 3300005338 | Miscanthus Rhizosphere | MSAEQRVNGLERRANPRGGRREHDSGKPWYVRRRWWLAAASLVFVGWKRVRRLV* |
| Ga0070689_1001267733 | 3300005340 | Switchgrass Rhizosphere | MSAEQRVNGLERRANPRGGRREHDSGKPWYVRRRWWLAAASLVFLGWKRVRRLV* |
| Ga0070689_1009682732 | 3300005340 | Switchgrass Rhizosphere | MSAEQRVNGLDRRAKPRGGRREDDSQKPWYVRRRWWLAAASLVFVGWKRVRRLV* |
| Ga0070692_101467503 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEKRIRELSDRRARPRGGRREDDSQKPWYMRRRLWLAAASMVFVGWKRVRRIV* |
| Ga0070673_1003190903 | 3300005364 | Switchgrass Rhizosphere | MNAEKRDNGFDRRANPRGGRREHDSAKPWYLRRRWWLAAASLMFVGWKRVRRIV* |
| Ga0070713_1000690243 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MVDDKRIVEQIDRRARPRGGRRGSDQQRPWYLRRRIWLAAASIVFVGWKRVRRIV* |
| Ga0070705_1001084641 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDDKRIKEFSDRRARPRGGRRENDSSKPWYMRRRLWLAAASMLFVGWKRVRRIV* |
| Ga0070705_1003454342 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGDKRIKEFTDRRAHPRGGRRENDSSKPWYMRRRLWLAAVSLFFVGWKRVRRMV* |
| Ga0070700_1003462213 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDEKRIRELSDRRARPRGGRREDDSQKPWYMRRRIWLAAASMVFVGWKRVRRIV* |
| Ga0070700_1008557272 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAEQRVNGLDRRANARGGRREHDSQKPWYVRRRWWLAAASLVFVGWKRVRRLV* |
| Ga0070708_1018687291 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDEKRIRELSDRRARPRGGRREDDSQKPWYMRRRLWLAAASMVFVGWKRVRRIV* |
| Ga0070684_1000122983 | 3300005535 | Corn Rhizosphere | MDDEKRVRTFSDRRAHPRGGRRDGDSTKPWYQRHAWWLAAASMMFVNWKRIRRLV* |
| Ga0066697_105199382 | 3300005540 | Soil | MSDDDKRMRELEDRRARPRGGRRENDSRKPWYVRRRLWLAAASMMFVGWKRVRRIV* |
| Ga0070695_1002779632 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGDKRIKEFTDRRAHPRGGRRENDSSKPWYMRRRLWLAAASMLFVGWKRVRRIV* |
| Ga0066698_107804542 | 3300005558 | Soil | MSDERRDTEHSDRRARSRGGRRPYDQKKPWYMRRRLWLATASLVFVGW |
| Ga0066700_104806522 | 3300005559 | Soil | MSDDKRIREWSDRRARPRGGRREHDAPKPWYMRRRLWLAAASMVFVGW |
| Ga0070664_1017441533 | 3300005564 | Corn Rhizosphere | MSDDKRVRDFSDRRARPRGGRRGHDGRKPWYRRHAMWLAAVSMAFMGWKRVRRLV* |
| Ga0068861_1012467362 | 3300005719 | Switchgrass Rhizosphere | MSAEQRVNGLDRRSNPRSGRREYDSPKPWYVRRRWWLAAASLMFVGWKRVRRLV* |
| Ga0066903_1084540982 | 3300005764 | Tropical Forest Soil | MTGEKRVVEPADRRARPRGGRRDSDLPKPWYMRRRLWLAAASMVFVGWKRVRRIV* |
| Ga0068870_107084601 | 3300005840 | Miscanthus Rhizosphere | MDDEKRVRTFSDRRAHPRGGRRDGDSTKPWYQRHAWWLAAASMMFVNWKRIRRL |
| Ga0068863_1002269561 | 3300005841 | Switchgrass Rhizosphere | PRRAFGGKCGGKLALMSAEQRVNGLDRRANARGGRREHDSQKPWYVRRRWWLAAASLVFVGWKRVRRLV* |
| Ga0075300_10671392 | 3300005876 | Rice Paddy Soil | MGDDKRVREFSDRRAHPRGGRRENDSQKPWYMRRRLWLAAASMFFVGWKRVRRIV* |
| Ga0081455_101365764 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MNAELRVNGTDRRANSRGGRREYDSPKPWYVRRRWWLAAISLVFVGWKRVRRLV* |
| Ga0066652_1013887752 | 3300006046 | Soil | MGDDDKRARELADRRARPRGGRRDNDSPKPWYVRRRLWLAAASMMFVGWKRVRRIV* |
| Ga0075417_101115023 | 3300006049 | Populus Rhizosphere | MSGDKRIKEFSDRRANPRGGRRENDSSKPWYMRRRLWLAAASMLFVGWKRIRRIV* |
| Ga0079222_100789552 | 3300006755 | Agricultural Soil | MDDEKRVRTFSDRRARPRGGRRDGDSAKPWYRRHAWWLAAVSMMFVNWKRIRRLV* |
| Ga0075428_1011052542 | 3300006844 | Populus Rhizosphere | MSAEQRVNGSDRRANPRGGRREDDSPKPWYVRRRWWLAAASLVFVGWKRVRRLV* |
| Ga0075433_100426793 | 3300006852 | Populus Rhizosphere | MSDDKRIKEFSDRRARPRGGRRENDSSKPWYMRRRLWLAAASMLFVGWKRIRRIV* |
| Ga0075425_1002193901 | 3300006854 | Populus Rhizosphere | MSGDKRIKEFSDRRANPRGGRRENDSSKPWYMRRRLWLAAASLFFVGWKRVRRM |
| Ga0075434_1000005567 | 3300006871 | Populus Rhizosphere | MSDDKRIKVFPDRRARPRGGRRGSDSRKPWYLRNGVWLAAVSMIFVGWKRVRRLV* |
| Ga0075434_1000883914 | 3300006871 | Populus Rhizosphere | MSGDKRIKEFSDRRANPRGGRRENDSSKPWYMRRRLWLAAASLFFVGWKRVRRMV* |
| Ga0075436_1012458301 | 3300006914 | Populus Rhizosphere | GFMDDEKRVRTFSDRRARPRGGRRDGDSAKPWYRRHAWWLAAVSMMFVNWKRIRRLV* |
| Ga0079218_116677753 | 3300007004 | Agricultural Soil | MADDPRRNGQSDRRAHARGGRRATDGAKPWYVRRRWWLAAASLAFVSWRRVRRKVFTS* |
| Ga0099791_102185122 | 3300007255 | Vadose Zone Soil | MSDEKRIRELSDRRARPRGGRRDNDSQKPWYMRRRLWLAAASMFFVGWKRVRRIV* |
| Ga0066710_1015386412 | 3300009012 | Grasslands Soil | MSDDKRIKESSDRRARPRGGRREHDAPKPWYMRRRLWLAAASMVFVGWKRVRRMV |
| Ga0099827_102387493 | 3300009090 | Vadose Zone Soil | MGDDMRIRELEDRRARRRGGRRENDSPKPWYMRRRLWLAAASLMFVGWKRVRRIV* |
| Ga0105243_105137942 | 3300009148 | Miscanthus Rhizosphere | MSDDKRIREFSDRRARPRGGRRENDSQKPWYMRRRLWLAAVSMFFVGWKRVRRIV* |
| Ga0105243_112313762 | 3300009148 | Miscanthus Rhizosphere | MTAEQRVNGLDRRSNPRSGRREYDSPKPWYVRRRWWLAAVSLMFVGWKRVRRLV* |
| Ga0111538_109132882 | 3300009156 | Populus Rhizosphere | MSAEQRVNGLDRRSNPRSGRREYDSPKPWYVRRRWWLAAVSLMFVGWKRVRRLV* |
| Ga0075423_121703472 | 3300009162 | Populus Rhizosphere | MSGVMSAEHRVNGPDRRAIPRGGRREHDSPKPWYVRRRWWLAAASLVFVGWKRVRRLV* |
| Ga0105242_113727691 | 3300009176 | Miscanthus Rhizosphere | SDDKRIREFSDRRARPRGGRRENDSQKPWYMRRRLWLAAVSMFFVGWKRVRRIV* |
| Ga0126315_107823682 | 3300010038 | Serpentine Soil | MSDDKRVRELPDRRARKRGGRRDSDMPRPWYMRRPVWLAAASMIFVGWKRVRRIV* |
| Ga0126311_109819342 | 3300010045 | Serpentine Soil | MSDDKRRELSDRRARKRGGRRDSDMPRPWYLKRPVWLAAASMLFVGWKRVRRIV* |
| Ga0126382_124309211 | 3300010047 | Tropical Forest Soil | MSAEQRVNGSDRRANPRGGRREHDSPKPWYVRRRWWLAAASLFFVGWKRIRRLV* |
| Ga0134128_106838412 | 3300010373 | Terrestrial Soil | MSAEQRVNGLERRANPRGGRREYDSPKPWYVRRRWWLAAASLIFVGWKRVRRLV* |
| Ga0126383_105886782 | 3300010398 | Tropical Forest Soil | MTDEKRVVEQADRRARPRGGRRDSDLPKPWYMRRRLWLAAASMVFVGWKRVRRIV* |
| Ga0134122_121081421 | 3300010400 | Terrestrial Soil | MSDEKRIRELSDRRARPRGGRREDDSQKPWYMRRRLWLAAASMIFVGWKRVRRIV* |
| Ga0134121_105295531 | 3300010401 | Terrestrial Soil | RKLADRRARRRGGRREDDSPRPWYMRRRLWLAAASMMFVGWKRVRRIV* |
| Ga0134123_103571831 | 3300010403 | Terrestrial Soil | MSEKRIRELSDRRARPRGGRRGDDSQKPWYMRRRIWLAAASMVF |
| Ga0137364_111165512 | 3300012198 | Vadose Zone Soil | MSDDDKRMRTNSDRRARPRGGRRDGDSPKPWYMRRRIWLAAASMVFVGWKRVRRIV* |
| Ga0137382_104359772 | 3300012200 | Vadose Zone Soil | MDDDDKRARELADRRARPRGGRRDNDSPKPWYVRRRLWLAAASMMFVGWKRVRRIV* |
| Ga0137399_101542452 | 3300012203 | Vadose Zone Soil | MSDDKRIRELSDRRARPRGGRRDNDSPKPWYMRRRLWLAAASMFFVGWKRVRRIV* |
| Ga0150985_1081377302 | 3300012212 | Avena Fatua Rhizosphere | MSDDKRTEAFSDRRARPRGGRRGNDSPKPWYTKHGFWLTAASVIFVGWKRVRRFV* |
| Ga0150984_1003734932 | 3300012469 | Avena Fatua Rhizosphere | DKRTEAFSDRRARPRGGRRGNDSPKPWYTKHGFWLTAASVIFVGWKRVRRFV* |
| Ga0157369_126779312 | 3300013105 | Corn Rhizosphere | MAEDNREQIDRRARRRGGRRDSDQPKPWYMRRRLWLAAASMVFVGWKRVRRIV* |
| Ga0157374_109093651 | 3300013296 | Miscanthus Rhizosphere | MSAEQRVNGLDRRANARGGRREHDSQKPWYVRRRWWLAAASLVFVGWK |
| Ga0157376_116867423 | 3300014969 | Miscanthus Rhizosphere | KCGGKLALMSAEQRVNGLDRRANARGGRREHDSQKPWYVRRRWWLAAASLVFVGWKRVRRLV* |
| Ga0132258_103316671 | 3300015371 | Arabidopsis Rhizosphere | EKRIREFSDRRARPRGGRREDDSQKPWYMRRRLWLAAASMVFVGWKRVRRIV* |
| Ga0132258_109033431 | 3300015371 | Arabidopsis Rhizosphere | MSEKRIREFSDRRARPRGGRREDDSQKPWYMRRRLWLAAASMVFVGWKR |
| Ga0132258_113063912 | 3300015371 | Arabidopsis Rhizosphere | MSAEQRVNGLDRRANSRGGRREHDSGKPWYVRRRWWLAAASLVFLGWKRVRRLV* |
| Ga0132258_115288681 | 3300015371 | Arabidopsis Rhizosphere | MSDDKRIKEFPDRRARPRGGRRGSDSGKPWYLRNGLWLAAASMMFV |
| Ga0132256_1005321133 | 3300015372 | Arabidopsis Rhizosphere | MSAEQRGNGLDRRAKPRGGRREDDSQKPWYVRRRWWLAAASLVFVGWKRVRRLV* |
| Ga0132256_1033818911 | 3300015372 | Arabidopsis Rhizosphere | MSEKRIREFSDRRARPRGGRRENDSQRPWYMRRRLWLAAASMFFVGWKR |
| Ga0132257_1002763983 | 3300015373 | Arabidopsis Rhizosphere | MSAEQRVNGLDRRANSRGGRREHDSGKPWYVRRRWWLAAASLVFVGWKRVRRLV* |
| Ga0132255_1042372411 | 3300015374 | Arabidopsis Rhizosphere | MSEKRIREFSDRRARPRGGRREDDSQKPWYMRRRLWLAAASMVFVGWKRVRRIV* |
| Ga0184628_100274612 | 3300018083 | Groundwater Sediment | MSDDDKRVKELDDRRARPRGGRRENDSRRPWYMRRRLWLAAASMMFVGWKRVRRIV |
| Ga0207643_103702862 | 3300025908 | Miscanthus Rhizosphere | MSAEQRVNGSDRRANPRGGRREHDSPKPWYVRRRWWLAAVSLMFVGWKRVRRLV |
| Ga0207684_107957121 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MGDDIRIRELEDRRARRRGGRREYDSPKPWYMRRRLWLAAASIVFVGWKRVRRIV |
| Ga0207660_113292303 | 3300025917 | Corn Rhizosphere | ARLMSDDKRIREFSDRRARPRGGRRENDSQKPWYMRRRLWLAAVSMFFVGWKRVRRIV |
| Ga0207646_102391991 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGDKRIKEFTDRRAHPRGGRRENDSSKPWYMRRRLWLAAASMLFVGWKRVRRIV |
| Ga0207700_100050913 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MVDDKRIVEQIDRRARPRGGRRGSDQQRPWYLRRRIWLAAASIVFVGWKRVRRIV |
| Ga0207686_104649303 | 3300025934 | Miscanthus Rhizosphere | SDDKRIREFSDRRARPRGGRRENDSQKPWYMRRRLWLAAVSMFFVGWKRVRRIV |
| Ga0207709_104815142 | 3300025935 | Miscanthus Rhizosphere | MSDDKRIREFSDRRARPRGGRRENDSQKPWYMRRRLWLAAVSMFFVGWKRVRRIV |
| Ga0207704_100253135 | 3300025938 | Miscanthus Rhizosphere | MSAEQRVNGLERRANPRGGRREHDSGKPWYVRRRWWLAAASLVFLGWKRVRRLV |
| Ga0207679_119112132 | 3300025945 | Corn Rhizosphere | MSAEQRVNGLDRRAKPRGGRREDDSQKPWYVRRRWWLAAASLVFVGWKRVRRLV |
| Ga0207708_100301386 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDEKRIRELSDRRARPRGGRREDDSQKPWYMRRRIWLAAASMVFVGWKRVRRIV |
| Ga0207648_101482262 | 3300026089 | Miscanthus Rhizosphere | MSDEKRIRELSDRRARPRGGRREDDSQKPWYMRRRLWLAAASMVFVGWKRVRRIV |
| Ga0207683_102546902 | 3300026121 | Miscanthus Rhizosphere | MSAEQRVNGLERRANPRGGRREHDSGKPWYVRRRWWLAAASLVFVGWKRVRRLV |
| Ga0207683_106216243 | 3300026121 | Miscanthus Rhizosphere | MEQERRNSTQNDRRAISRSGRRDGDQKKPWYMRRRLWLAAAS |
| Ga0209438_10018234 | 3300026285 | Grasslands Soil | MSDEKRIREFSDRRARPRGGRRDNDSQKPWYMRRRLWLAAASMFFVGWKRVRRIV |
| Ga0209686_10206313 | 3300026315 | Soil | MGDDKHIRAVPDRRARPRGGRRDGDSQKPWYQRHALWLAAASMVFVGWKRVRRIV |
| Ga0209131_13899192 | 3300026320 | Grasslands Soil | MSDEKRIRELSDRRARPRGGRRDNDSQKPWYMRRRLWLAAASMFFVGWKRVRRIV |
| Ga0209152_100638313 | 3300026325 | Soil | MGDDKHIRAVSDRRARPRGGRRDGDSQKPWYQRHALWLAAASMVFVGWKRVRRIV |
| Ga0209515_100208294 | 3300027835 | Groundwater | MGDDKRIKELEDRRAGRRGGRRESDSPKPWYMRRRLWLAAASIVFVGWKRVRRIV |
| Ga0209488_111855142 | 3300027903 | Vadose Zone Soil | MSGDKRVIDHADRRARPRGGRRDSDQQRPWYMRRRLWLAAASMVFVGWKRVRKIV |
| Ga0207428_112800952 | 3300027907 | Populus Rhizosphere | MSDDKRIKEFSDRRARPRGGRRENDSSKPWYMRRRLWLAAASMLFVGWKRVRRIV |
| Ga0137415_101021342 | 3300028536 | Vadose Zone Soil | MSDDKRIRELSDRRARPRGGRRDNDSPKPWYMRRRLWLAAASMFFVGWKRVRRIV |
| Ga0310886_103980212 | 3300031562 | Soil | MSAEQRVNGLDRRANARGGRREHDSQKPWYVRRRWWLAAASLVFVGWKRVRRLV |
| Ga0307469_105571643 | 3300031720 | Hardwood Forest Soil | MGDEKRIRELSDRRARPRGGRREDDSQKPWYMRRRLWLAAASLFFVGWKRVRRIV |
| Ga0307468_1000197323 | 3300031740 | Hardwood Forest Soil | MSDDKRIREFSDRRARPRGGRRENDSQKPWYMRRRLWLAAASLFFVGWKRVRRLV |
| Ga0307468_1000202243 | 3300031740 | Hardwood Forest Soil | MSDDKRIREFSDRRAHPRGGRRENDSQKPWYKRRRLWLAAASMLFVGWKRVRRLV |
| Ga0307468_1002141981 | 3300031740 | Hardwood Forest Soil | MSDEKRIRELSDRRARPRGGRREDDSQKPWYMRRRLWLAAASMIFVGWKRVR |
| Ga0307468_1011378503 | 3300031740 | Hardwood Forest Soil | MSDDKRIKAFSDRRARPRGGRREDDSQKPWYMRRRLWLAAASMIFVGWKRVRRIV |
| Ga0307468_1011420032 | 3300031740 | Hardwood Forest Soil | MSEKRIRELSDRRARPRGGRREDDSQKPWYMRRRLWLAAASMVFVGWKRVRRIV |
| Ga0307468_1024266902 | 3300031740 | Hardwood Forest Soil | MGDQKRANDAIDRRARPRGGRRDSDAQRPWYMRRRLWLAAASVIFVGWKRVRRIV |
| Ga0308175_1026561431 | 3300031938 | Soil | MSDDKRVRDFSDRRARPRGGRRGHDGQKPWYRRHAMWLAAVSMAFMGWKRVRRL |
| Ga0310897_100148571 | 3300032003 | Soil | SAEERSNGSDRRANPRGGRREYDAAKPWYVRRRWWLAAASLVFVGWKRVRRVV |
| Ga0310890_105099182 | 3300032075 | Soil | MSAEQRVNGLDRRANARGGRREHDSQKPWYVRRRWWLAAASLVFVGWKRVRRVV |
| Ga0307471_1001341993 | 3300032180 | Hardwood Forest Soil | MSDDKRIKEFSDRRARPRGGRRENDSSKPWYMRRRLWLAAVSMLFVGWKRVRRIV |
| Ga0307471_1012047102 | 3300032180 | Hardwood Forest Soil | MSDDKRIREFSDRRARPRGGRRDNDSQKPWYMRRRLWLAAASLVFVGWKRVRRLV |
| ⦗Top⦘ |