| Basic Information | |
|---|---|
| Family ID | F093608 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 42 residues |
| Representative Sequence | VIDPAALQMVLGVLTGWLDRREREAVAYLIEENRLLRRQLG |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 22.33 % |
| % of genes near scaffold ends (potentially truncated) | 61.32 % |
| % of genes from short scaffolds (< 2000 bps) | 83.02 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.962 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (14.151 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.415 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.736 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.62% β-sheet: 0.00% Coil/Unstructured: 46.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF13276 | HTH_21 | 9.43 |
| PF13683 | rve_3 | 3.77 |
| PF00903 | Glyoxalase | 1.89 |
| PF00753 | Lactamase_B | 1.89 |
| PF02687 | FtsX | 1.89 |
| PF01527 | HTH_Tnp_1 | 1.89 |
| PF00160 | Pro_isomerase | 0.94 |
| PF07394 | DUF1501 | 0.94 |
| PF00313 | CSD | 0.94 |
| PF08448 | PAS_4 | 0.94 |
| PF01638 | HxlR | 0.94 |
| PF13560 | HTH_31 | 0.94 |
| PF07676 | PD40 | 0.94 |
| PF12681 | Glyoxalase_2 | 0.94 |
| PF00999 | Na_H_Exchanger | 0.94 |
| PF07638 | Sigma70_ECF | 0.94 |
| PF01548 | DEDD_Tnp_IS110 | 0.94 |
| PF14361 | RsbRD_N | 0.94 |
| PF03051 | Peptidase_C1_2 | 0.94 |
| PF00483 | NTP_transferase | 0.94 |
| PF13442 | Cytochrome_CBB3 | 0.94 |
| PF13453 | zf-TFIIB | 0.94 |
| PF03625 | DUF302 | 0.94 |
| PF00486 | Trans_reg_C | 0.94 |
| PF13432 | TPR_16 | 0.94 |
| PF01168 | Ala_racemase_N | 0.94 |
| PF13489 | Methyltransf_23 | 0.94 |
| PF00108 | Thiolase_N | 0.94 |
| PF00400 | WD40 | 0.94 |
| PF07691 | PA14 | 0.94 |
| PF04820 | Trp_halogenase | 0.94 |
| PF16576 | HlyD_D23 | 0.94 |
| PF12728 | HTH_17 | 0.94 |
| PF13570 | PQQ_3 | 0.94 |
| PF06296 | RelE | 0.94 |
| PF00665 | rve | 0.94 |
| PF02371 | Transposase_20 | 0.94 |
| PF13360 | PQQ_2 | 0.94 |
| PF14559 | TPR_19 | 0.94 |
| PF13333 | rve_2 | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.89 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.94 |
| COG4737 | Uncharacterized conserved protein | Function unknown [S] | 0.94 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.94 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.94 |
| COG3579 | Aminopeptidase C | Amino acid transport and metabolism [E] | 0.94 |
| COG3439 | Uncharacterized conserved protein, DUF302 family | Function unknown [S] | 0.94 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.94 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.94 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.94 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.94 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.94 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.94 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.94 |
| COG0652 | Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family | Posttranslational modification, protein turnover, chaperones [O] | 0.94 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.94 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.96 % |
| Unclassified | root | N/A | 16.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000363|ICChiseqgaiiFebDRAFT_10366703 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300004463|Ga0063356_104904559 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300005093|Ga0062594_100482537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1040 | Open in IMG/M |
| 3300005332|Ga0066388_101973113 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300005338|Ga0068868_100956981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 781 | Open in IMG/M |
| 3300005356|Ga0070674_100114511 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1986 | Open in IMG/M |
| 3300005546|Ga0070696_100536946 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300005549|Ga0070704_101241374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 681 | Open in IMG/M |
| 3300005549|Ga0070704_102060571 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300005713|Ga0066905_100942019 | Not Available | 758 | Open in IMG/M |
| 3300005764|Ga0066903_100441365 | All Organisms → cellular organisms → Bacteria | 2169 | Open in IMG/M |
| 3300005764|Ga0066903_101025520 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1511 | Open in IMG/M |
| 3300005764|Ga0066903_101541498 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300006794|Ga0066658_10640965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300006852|Ga0075433_10018247 | All Organisms → cellular organisms → Bacteria | 5828 | Open in IMG/M |
| 3300006852|Ga0075433_10364401 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1276 | Open in IMG/M |
| 3300006871|Ga0075434_100012997 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7906 | Open in IMG/M |
| 3300006881|Ga0068865_102064843 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300006894|Ga0079215_11244546 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300007076|Ga0075435_100749939 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 849 | Open in IMG/M |
| 3300009012|Ga0066710_100730632 | All Organisms → cellular organisms → Bacteria | 1512 | Open in IMG/M |
| 3300009038|Ga0099829_10587170 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300009100|Ga0075418_10184087 | All Organisms → cellular organisms → Bacteria | 2224 | Open in IMG/M |
| 3300009137|Ga0066709_100024249 | All Organisms → cellular organisms → Bacteria | 6225 | Open in IMG/M |
| 3300009137|Ga0066709_100073788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4025 | Open in IMG/M |
| 3300009143|Ga0099792_11166717 | Not Available | 521 | Open in IMG/M |
| 3300009147|Ga0114129_10017489 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10209 | Open in IMG/M |
| 3300009147|Ga0114129_11323668 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300009156|Ga0111538_10313897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1984 | Open in IMG/M |
| 3300009156|Ga0111538_13156623 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300009162|Ga0075423_10797239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → unclassified Caulobacteraceae → Caulobacteraceae bacterium | 999 | Open in IMG/M |
| 3300009176|Ga0105242_10040274 | All Organisms → cellular organisms → Bacteria | 3765 | Open in IMG/M |
| 3300009176|Ga0105242_11800390 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300009177|Ga0105248_13200773 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300009610|Ga0105340_1184936 | Not Available | 872 | Open in IMG/M |
| 3300010043|Ga0126380_11708047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300010043|Ga0126380_12069150 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300010046|Ga0126384_11449167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 642 | Open in IMG/M |
| 3300010047|Ga0126382_11452877 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300010358|Ga0126370_10216827 | All Organisms → cellular organisms → Bacteria | 1459 | Open in IMG/M |
| 3300010360|Ga0126372_10337855 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
| 3300010362|Ga0126377_10154191 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2161 | Open in IMG/M |
| 3300010362|Ga0126377_10331880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1511 | Open in IMG/M |
| 3300010362|Ga0126377_12286157 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300010366|Ga0126379_13240660 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300011440|Ga0137433_1045937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 1292 | Open in IMG/M |
| 3300012685|Ga0137397_10568882 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300012685|Ga0137397_10783057 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300012918|Ga0137396_10005902 | All Organisms → cellular organisms → Bacteria | 7164 | Open in IMG/M |
| 3300012948|Ga0126375_11484915 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300012948|Ga0126375_12111302 | Not Available | 501 | Open in IMG/M |
| 3300012958|Ga0164299_10735247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300012960|Ga0164301_11352557 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300012971|Ga0126369_12614937 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300012986|Ga0164304_10808939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300012989|Ga0164305_11892569 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300013297|Ga0157378_10658340 | Not Available | 1063 | Open in IMG/M |
| 3300013308|Ga0157375_11906268 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300014326|Ga0157380_10847867 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300015357|Ga0134072_10116179 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300015371|Ga0132258_10748330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2462 | Open in IMG/M |
| 3300015371|Ga0132258_13170062 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300015374|Ga0132255_105152691 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300016371|Ga0182034_11521330 | Not Available | 586 | Open in IMG/M |
| 3300018067|Ga0184611_1252223 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300018073|Ga0184624_10271865 | Not Available | 760 | Open in IMG/M |
| 3300018083|Ga0184628_10009579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4677 | Open in IMG/M |
| 3300018084|Ga0184629_10470702 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300018433|Ga0066667_10428985 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300018433|Ga0066667_10468290 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300018433|Ga0066667_10486642 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300018481|Ga0190271_12664679 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300021339|Ga0193706_1146525 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300021560|Ga0126371_10934026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1011 | Open in IMG/M |
| 3300025906|Ga0207699_11321657 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300025936|Ga0207670_10904469 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 739 | Open in IMG/M |
| 3300026088|Ga0207641_10810889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 926 | Open in IMG/M |
| 3300026310|Ga0209239_1073851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1485 | Open in IMG/M |
| 3300027273|Ga0209886_1050259 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300027821|Ga0209811_10223440 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300027835|Ga0209515_10014347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8207 | Open in IMG/M |
| 3300027846|Ga0209180_10699432 | Not Available | 551 | Open in IMG/M |
| 3300027907|Ga0207428_10557545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 828 | Open in IMG/M |
| 3300028536|Ga0137415_10043537 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4381 | Open in IMG/M |
| 3300028536|Ga0137415_11391232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300030989|Ga0308196_1024801 | Not Available | 724 | Open in IMG/M |
| 3300031226|Ga0307497_10235854 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300031226|Ga0307497_10328360 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300031231|Ga0170824_128477032 | Not Available | 544 | Open in IMG/M |
| 3300031716|Ga0310813_12331102 | Not Available | 507 | Open in IMG/M |
| 3300031720|Ga0307469_10421354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1147 | Open in IMG/M |
| 3300031720|Ga0307469_11390385 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300031740|Ga0307468_102041165 | Not Available | 550 | Open in IMG/M |
| 3300031795|Ga0318557_10058302 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1641 | Open in IMG/M |
| 3300032000|Ga0310903_10834943 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300032059|Ga0318533_10975063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300032180|Ga0307471_100148829 | Not Available | 2247 | Open in IMG/M |
| 3300032180|Ga0307471_102236025 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300032180|Ga0307471_102549962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300032770|Ga0335085_10535688 | Not Available | 1330 | Open in IMG/M |
| 3300033412|Ga0310810_10433160 | All Organisms → cellular organisms → Bacteria | 1341 | Open in IMG/M |
| 3300033433|Ga0326726_11502799 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 656 | Open in IMG/M |
| 3300033475|Ga0310811_10959264 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 14.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.32% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.38% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.60% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.66% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.66% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.77% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.83% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.89% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.94% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.94% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.94% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.94% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.94% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011440 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2 | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300021339 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027273 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027835 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030989 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiFebDRAFT_103667032 | 3300000363 | Soil | VIDPAALQMVLGVLIGWLDRRERDAIAYLIEENQLLRNQELGTKRLRFTDDDR |
| Ga0063356_1049045592 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VVDASAFQFLLMIVTGWLARREREVIAYLIEENRCLRRQLGTRRVRLTDD |
| Ga0062594_1004825372 | 3300005093 | Soil | VIDFAALQMVLGVLTGWLDRREREAIAYLVEENRLLRRQLGGR |
| Ga0066388_1019731132 | 3300005332 | Tropical Forest Soil | LDAAALQWLLLVLTSWLERREREIVAYLVVENRLLRRQLGTRRMRLTDR* |
| Ga0068868_1009569811 | 3300005338 | Miscanthus Rhizosphere | VIDPAALQMVLCVLTGWPERREREAIAYLIEENRLLRRQLGTRRLRLT |
| Ga0070674_1001145114 | 3300005356 | Miscanthus Rhizosphere | VIDPTALRMVLGVLTGWLERREREAIAYLIEENRLLRRELGAGGCA* |
| Ga0070696_1005369461 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VFDAAALQWLLLVLTSWLERREREVVAYLIVENRLLRRQSGRDGYG* |
| Ga0070704_1012413741 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VIDLSALQMLLMVVTGWLDRREREVLAYPIEENRLLRRQVGGRRLHLTDDDRRRLAV |
| Ga0070704_1020605711 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VIDVVVVHMVLGALTGWLERRERQAIAYLIEENRLLRRQLGRRRLRLTD |
| Ga0066905_1009420192 | 3300005713 | Tropical Forest Soil | VIDVSALQLLLTILTGWLKSQEREVIGYLVAENRCLRRQ |
| Ga0066903_1004413652 | 3300005764 | Tropical Forest Soil | VIGPAALQMVLCVLIGYLHRREREAVAHMIEENWLRRRQLGARRLRLNDNAHRHG* |
| Ga0066903_1010255202 | 3300005764 | Tropical Forest Soil | VIDLSALQLLLMVLTDWLERREREAIAYLIEENRVRCV* |
| Ga0066903_1015414982 | 3300005764 | Tropical Forest Soil | VIDVSALQLLLLAVTGWLDRRERDAMAYLIEENRILRRQIGG |
| Ga0066903_1030617271 | 3300005764 | Tropical Forest Soil | VICTPAVIDAPALQLLLAVLTGWLNRQERATIGYLIAENRLLRR |
| Ga0066658_106409651 | 3300006794 | Soil | VIDPAALQMVLGVLTGWLERQEREGIAYLIEENRLLRRQL |
| Ga0075433_100182471 | 3300006852 | Populus Rhizosphere | VIDPAALQIVLAVLTGWLERREREAIAYLIEENRLLRRQLG |
| Ga0075433_103644011 | 3300006852 | Populus Rhizosphere | MFHMLLPGVTGWQDRREREVLAYLMEENRVLRRQVGGRRL |
| Ga0075434_1000129973 | 3300006871 | Populus Rhizosphere | VFDAPALQWLLPVLTRWLERREREAVAYLIVENRLLRRNSGPDGCS* |
| Ga0068865_1020648431 | 3300006881 | Miscanthus Rhizosphere | VIDPAALQMVLCVLNGWLDRREREAVAYLIEENRCLRR* |
| Ga0079215_112445461 | 3300006894 | Agricultural Soil | VIDPAALQMVLGVLTGWLERRERETIAYLSEENRL |
| Ga0075435_1007499391 | 3300007076 | Populus Rhizosphere | VITPAALKMWLLVLTGWLERRERDALAYLIEENRLLRRQLGARR |
| Ga0066710_1007306322 | 3300009012 | Grasslands Soil | MVSMVLTGWLERRERSALAYLIEENRLLRRQLGGRRVR |
| Ga0099829_105871702 | 3300009038 | Vadose Zone Soil | MLPLVIAPAALQMLLLVLTGWLERREQEAIAYLIEENRLLRR |
| Ga0075418_101840872 | 3300009100 | Populus Rhizosphere | VFDAPARQWLLPVLTRWLERREREAVAYLIVENRLLRRNSGPDGCS* |
| Ga0066709_1000242493 | 3300009137 | Grasslands Soil | VIDVSILRLLLLTIVAWLDHREREALAYLIEENRLLRR* |
| Ga0066709_1000737881 | 3300009137 | Grasslands Soil | VIDMSALQMWFAVLIGWLDRQEREALAYLIEENRVL |
| Ga0099792_111667171 | 3300009143 | Vadose Zone Soil | VIDPAALQMVPGVLTGWLARREREAIAYVIEENLLLRRQLGTRR |
| Ga0114129_100174895 | 3300009147 | Populus Rhizosphere | VFDAPARQWLLLVLTRWLERREREAVAYLIVENRLLRRNSGPDGCS* |
| Ga0114129_113236681 | 3300009147 | Populus Rhizosphere | MLRLVIDVTTLQLVLSVLIAWLDCREREAVAYLIEENRLLRR* |
| Ga0111538_103138974 | 3300009156 | Populus Rhizosphere | VIDVSSLQMLLLTVTSWLGHREREVLAYLIEENRI |
| Ga0111538_131566232 | 3300009156 | Populus Rhizosphere | VIDASAFQLLLMVVTGWLARREREVIAYLIEENRCLRRQLGSRRVRLT* |
| Ga0075423_107972391 | 3300009162 | Populus Rhizosphere | KRPLVFDAPARQWLLLVLTRWLERREREAVAYLIVENRLLRRNSGPDGCS* |
| Ga0105242_100402743 | 3300009176 | Miscanthus Rhizosphere | VIDPTALRMVLGVLTGWLERREREAIAYLIEENRLLRRKLGAGGC |
| Ga0105242_118003901 | 3300009176 | Miscanthus Rhizosphere | VINAALQMVLGVLTGWLERREREAIAYLIEENRLLRRELGAGGCA* |
| Ga0105248_132007731 | 3300009177 | Switchgrass Rhizosphere | VIRRVLQMVVSVLTDWLERREWKAIAYVVEENRLLRR* |
| Ga0105340_11849362 | 3300009610 | Soil | MLRLVIDLAALQTMLGVLTGWLGRRERDAVAYLVEENRLMRRELGGCRLRLP |
| Ga0126380_117080472 | 3300010043 | Tropical Forest Soil | VIDLSAVQMLLMVLTGLLDRRDREALRYLIEENRL |
| Ga0126380_120691502 | 3300010043 | Tropical Forest Soil | VIDVSVLQVLLLAVTGWLDRREREVIAYLMEENRLLRRQI |
| Ga0126384_114491672 | 3300010046 | Tropical Forest Soil | MSAVTDVSALQMVLAVLTGWLDRQEREALRYLIEENRVLRRQLG |
| Ga0126382_114528772 | 3300010047 | Tropical Forest Soil | MTRAVIDVSSFRLLLFILTGWLDRRERDALAYLMEENRLLRR |
| Ga0126370_102168272 | 3300010358 | Tropical Forest Soil | VIDPSGLQMVMVVLTGWLDRREREAVAFLIEENRSCGAN* |
| Ga0126372_103378552 | 3300010360 | Tropical Forest Soil | VINVAALQMVLGVLTGWLERAEREAIAYVVEENRLLRR* |
| Ga0126377_101541913 | 3300010362 | Tropical Forest Soil | VIDPSVLRLVLLILTGWLERREREVIAYLVEENRCLRRQLGKPAATPD* |
| Ga0126377_103318801 | 3300010362 | Tropical Forest Soil | KLPLVFDAATLQWLLLVLTSWLEHREREVIAYLVIENRLLRRQLGTP* |
| Ga0126377_122861571 | 3300010362 | Tropical Forest Soil | VFDAAALPWVLLVLTSWLERREREVLAYLIAENRLLRRQLGRNARG* |
| Ga0126379_132406601 | 3300010366 | Tropical Forest Soil | MLHLLLLAVTGWLDRRERAAMAHLIEENHLLRRQI |
| Ga0134121_100411271 | 3300010401 | Terrestrial Soil | VFDAAALQWLFLVLTSWLERRERDTLAYLIAENRLLRGQL |
| Ga0137433_10459371 | 3300011440 | Soil | VFDTVPLHRLLLVLTGWLECRERDAVMYLIAENRLIRRQLGTRRLRLTDADR |
| Ga0137397_105688822 | 3300012685 | Vadose Zone Soil | VIDPAALQMVLGVLTGWLERREREAIAYPIEENRLLRRQLGTRRLRLTD |
| Ga0137397_107830571 | 3300012685 | Vadose Zone Soil | VIDPAALQIVLGVLTGWLERREREAIAYPIEENRLLR |
| Ga0137396_100059022 | 3300012918 | Vadose Zone Soil | VIEALALQLVLAVLTGWLDRREREVLRYLVEENRVLRRQLQGGVWS* |
| Ga0126375_102796051 | 3300012948 | Tropical Forest Soil | VPLVFDAAALQRVLLVLTSWLERREREILAYLIVENR |
| Ga0126375_114849152 | 3300012948 | Tropical Forest Soil | VINIAALQMVLGVLTGWLERREREAIAYLIEENRLLRRQLDGPRL |
| Ga0126375_121113022 | 3300012948 | Tropical Forest Soil | VFDAAALQWLLLVLTSWLERREREVVAYLIVENRLLRRQLGTRRMQLTDAD |
| Ga0164299_107352471 | 3300012958 | Soil | VIDPAALQMVLGVLTGWLDRREREAIALYLLRSPSK |
| Ga0164301_113525572 | 3300012960 | Soil | VIDPAALQMVLCVLTGRLDRREREAVAYLIEENRLLRRQLG |
| Ga0126369_126149371 | 3300012971 | Tropical Forest Soil | VIDLSALRLLLLTITGWLERRQREALAYLVEENDFET |
| Ga0164304_108089392 | 3300012986 | Soil | VIDAAALQMVLSVLIGWLERREREVIAYLIEENRLLRKDSTIG* |
| Ga0164305_118925691 | 3300012989 | Soil | VIDPAALQIVLCVLTGWLVRREREAVAYLIEENRLLRR |
| Ga0157378_106583401 | 3300013297 | Miscanthus Rhizosphere | VFDAAALQWLLLVLTSWLEHREREVIAYLVIENRLLRRQLGTRRIRLMDGDRRRL |
| Ga0157375_119062683 | 3300013308 | Miscanthus Rhizosphere | VIDLSALQLLLMVLTGWLDRREREAIAYLIEENRLPK |
| Ga0157380_108478672 | 3300014326 | Switchgrass Rhizosphere | MVLGVLTGWLDRREREAVASLIEENRLLRRQLGTRRPRGNG |
| Ga0134072_101161793 | 3300015357 | Grasslands Soil | VIDVSVLRLLLLTITGWLDRREREALAYLIEENRLLRNMSVSVA |
| Ga0132258_107483304 | 3300015371 | Arabidopsis Rhizosphere | VINIAALQMVLGVLTGWLERREREAIAYLIEENRF |
| Ga0132258_131700623 | 3300015371 | Arabidopsis Rhizosphere | MIDPAALQMVLMVLTGWLDGRERRALVYLIEENRLPLA* |
| Ga0132255_1051526911 | 3300015374 | Arabidopsis Rhizosphere | VIDLAALQMMLGVLIGWLDRRERDAIAYLIEENRLLRRQLG |
| Ga0182034_115213301 | 3300016371 | Soil | VIDPAALQMVLIMLSGWLENRERHAVAYLIEENRLLR |
| Ga0184611_12522232 | 3300018067 | Groundwater Sediment | VIDPTALRMVLGVLTGWLERREREAIAYLIEENRLLRRELGAGGCA |
| Ga0184624_102718651 | 3300018073 | Groundwater Sediment | MVLMVLTGWIKRRERHAVARLVEENRLLRRQLDRIA |
| Ga0184628_100095796 | 3300018083 | Groundwater Sediment | VIDLAALQMVLGVLTGWLERREREAVAYLIEENRLLRRQLGTRRL |
| Ga0184629_104707022 | 3300018084 | Groundwater Sediment | VIDASALQMVLAVLTGWLDRQERPALAYLMEELRARFGREEH |
| Ga0066667_104289851 | 3300018433 | Grasslands Soil | VPVLRLLLLTVIGWLDHREREALAYLIEENRLLRRQSGGRRLS |
| Ga0066667_104682903 | 3300018433 | Grasslands Soil | VIDVSILRLLLLTIVAWLDHREREALAYLIEENRLLRR |
| Ga0066667_104866421 | 3300018433 | Grasslands Soil | VIDMSALQMWFAVLIGWLDRQEREALAYLIEENRVLRAQLVGDACV |
| Ga0190271_126646791 | 3300018481 | Soil | VIDPATLQMVLGMLTGWLDRREREAIAYLIEENRLLRRQLGTTG |
| Ga0193706_11465251 | 3300021339 | Soil | MVLAVLTGWLDRQERHAVAYLIEEIRVLRRRLGPKR |
| Ga0126371_109340262 | 3300021560 | Tropical Forest Soil | VIDPAALQMVLGMLTGWLERREREAIAYLVEENRLLRRQLGTRRL |
| Ga0207699_113216573 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VIDPAALQIVLTVLTGWLDRREREAVAYLIEENRRVR |
| Ga0207670_109044691 | 3300025936 | Switchgrass Rhizosphere | VIDPAALQMVLGVLTGWLDRREREAVAYLIEENRSL |
| Ga0207641_108108891 | 3300026088 | Switchgrass Rhizosphere | VIDPTALRMVLGVLTGWLERREREAIAYLIEENRLLRRKLGAGGCA |
| Ga0209239_10738512 | 3300026310 | Grasslands Soil | VIDVSILRLLLLTIVAWLDHREREALAYLIEENRLLRRQIG |
| Ga0209886_10502591 | 3300027273 | Groundwater Sand | VIDPAALQMVLGVLTGWLDRREREAVAYLIEENRLLRRQLG |
| Ga0209811_102234402 | 3300027821 | Surface Soil | VIDFVALQMVLGVLTGWLDRREREAVAYLIEENPLLRRQLGERRLRRQH |
| Ga0209515_100143479 | 3300027835 | Groundwater | VIDPAALQMVPGVLTGWLERREREVIAYLIEENRLLRRQLGRPGGCA |
| Ga0209180_106994322 | 3300027846 | Vadose Zone Soil | MLPLVIAPAALQMLLLVLTGWLERREQEAIAYLIEENRL |
| Ga0207428_105575451 | 3300027907 | Populus Rhizosphere | MLLLTVTSWLGHQEREVLAYLIEENRILRRELGGRHLCL |
| Ga0137415_100435374 | 3300028536 | Vadose Zone Soil | VIEALALQLVLAVLTGWLDRREREVLRYLVEENRVLRRQLQGGVWS |
| Ga0137415_113912321 | 3300028536 | Vadose Zone Soil | VIDVAVVQMVLGALTDWLERRERQAIAYLIEENRLLRRHTASVGSAS |
| Ga0308196_10248013 | 3300030989 | Soil | VFDAAALQWLLLVLTSWLERREREVLAYLVVENRLLRRQLGTRR |
| Ga0307497_102358542 | 3300031226 | Soil | MVLCVLTGWLDRREREAVAYLIEENRLLRRQLGTRR |
| Ga0307497_103283601 | 3300031226 | Soil | MVLGVLTGWLDRREREAVAYLIEENRLLRRQLGTGRP |
| Ga0170824_1284770322 | 3300031231 | Forest Soil | VIDPAALRMVLGVLTGWLERRERETIAYLIEENPLSLLKT |
| Ga0310813_123311022 | 3300031716 | Soil | VIDLSALQLLLMVLTGWLERREREVIAYLIEENRLLKR |
| Ga0307469_104213542 | 3300031720 | Hardwood Forest Soil | VINIAVLQMVLGVLTGWLERREREAITYLVEENRLLRR |
| Ga0307469_113903852 | 3300031720 | Hardwood Forest Soil | VINIAALQMVLGVLTGWLERREREAIDYLVEENRLLRRQLGRRRIR |
| Ga0307468_1020411652 | 3300031740 | Hardwood Forest Soil | VFDIAALRVLVLVVTGWLERRERDAIAYLIEENRLVECVN |
| Ga0318557_100583021 | 3300031795 | Soil | MVLGVLTGWLDRREREVVAYLIEENRLLRRQRGTRRL |
| Ga0310903_108349431 | 3300032000 | Soil | VIDLTTLRLVLSVLTGWLDCREREAIGYLIEENRLLRRQLCGRRLR |
| Ga0318533_109750631 | 3300032059 | Soil | VIDASALQMLLAVLTGWLNRRERDVISYLVAENRLLRRQLRPAPAAHG |
| Ga0307471_1001488293 | 3300032180 | Hardwood Forest Soil | MIWLDSVIDPAALQMVLRVLTGWLERLEREAIAYVI |
| Ga0307471_1022360251 | 3300032180 | Hardwood Forest Soil | VIDLSALQMLLLVVTGWLDRREREVLAYLIEENRLLRRQVGG |
| Ga0307471_1025499622 | 3300032180 | Hardwood Forest Soil | VRDARDPVIDPAALQMALGMLTGWLERREREALAYLIEENRLLRRQLGTGGCS |
| Ga0335085_105356882 | 3300032770 | Soil | MVLGVLTGCLGRRERAAIAYLIEENRLLRRQLGTGRLRLTDDDADGWRR |
| Ga0310810_104331603 | 3300033412 | Soil | MIDPAALQMVLMVLTGWLDGRERRALVYLIEENRLPLA |
| Ga0326726_115027991 | 3300033433 | Peat Soil | VIDAAALQMVLFVLTGWLDRREREAVAYLIEENRLLRR |
| Ga0310811_109592642 | 3300033475 | Soil | VIDPAALQMVLMVLTGWLDGRERRALVYLIEENRLPLA |
| ⦗Top⦘ |