Basic Information | |
---|---|
Family ID | F093589 |
Family Type | Metagenome |
Number of Sequences | 106 |
Average Sequence Length | 47 residues |
Representative Sequence | KLANRVAEEAGAKALVMATAVGAVKGADNYIAAIDYNITTLAKALR |
Number of Associated Samples | 94 |
Number of Associated Scaffolds | 106 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.83 % |
% of genes near scaffold ends (potentially truncated) | 94.34 % |
% of genes from short scaffolds (< 2000 bps) | 92.45 % |
Associated GOLD sequencing projects | 89 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.37 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (100.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (18.868 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.415 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.623 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 59.46% β-sheet: 0.00% Coil/Unstructured: 40.54% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 106 Family Scaffolds |
---|---|---|
PF00950 | ABC-3 | 74.53 |
PF01297 | ZnuA | 15.09 |
PF01769 | MgtE | 1.89 |
PF00072 | Response_reg | 0.94 |
PF02771 | Acyl-CoA_dh_N | 0.94 |
PF13489 | Methyltransf_23 | 0.94 |
PF00977 | His_biosynth | 0.94 |
COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
---|---|---|---|
COG0609 | ABC-type Fe3+-siderophore transport system, permease component | Inorganic ion transport and metabolism [P] | 74.53 |
COG1108 | ABC-type Mn2+/Zn2+ transport system, permease component | Inorganic ion transport and metabolism [P] | 74.53 |
COG4606 | ABC-type enterochelin transport system, permease component | Inorganic ion transport and metabolism [P] | 74.53 |
COG1824 | Permease, similar to cation transporters | Inorganic ion transport and metabolism [P] | 1.89 |
COG2239 | Mg/Co/Ni transporter MgtE (contains CBS domain) | Inorganic ion transport and metabolism [P] | 1.89 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.94 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000953|JGI11615J12901_12940001 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 832 | Open in IMG/M |
3300000955|JGI1027J12803_100553256 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 546 | Open in IMG/M |
3300000955|JGI1027J12803_105972456 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
3300000955|JGI1027J12803_106967764 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_20CM_70_15 | 504 | Open in IMG/M |
3300000955|JGI1027J12803_108772986 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300002558|JGI25385J37094_10144792 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300002561|JGI25384J37096_10117561 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
3300004157|Ga0062590_100378472 | All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → Candidatus Omnitrophus → Candidatus Omnitrophus fodinae | 1148 | Open in IMG/M |
3300005174|Ga0066680_10282865 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
3300005176|Ga0066679_10129973 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1560 | Open in IMG/M |
3300005177|Ga0066690_10141683 | All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → Candidatus Omnitrophus | 1575 | Open in IMG/M |
3300005332|Ga0066388_101926493 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
3300005336|Ga0070680_101486798 | All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → Candidatus Omnitrophus → Candidatus Omnitrophus fodinae | 587 | Open in IMG/M |
3300005367|Ga0070667_102070950 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300005438|Ga0070701_10336767 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
3300005444|Ga0070694_101076143 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300005450|Ga0066682_10153141 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
3300005451|Ga0066681_10064603 | All Organisms → cellular organisms → Bacteria | 2031 | Open in IMG/M |
3300005468|Ga0070707_100385299 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
3300005518|Ga0070699_101126012 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
3300005540|Ga0066697_10731460 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300005546|Ga0070696_100017700 | All Organisms → cellular organisms → Bacteria | 4812 | Open in IMG/M |
3300005546|Ga0070696_101974400 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 506 | Open in IMG/M |
3300005568|Ga0066703_10252437 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
3300005575|Ga0066702_10477742 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 761 | Open in IMG/M |
3300005578|Ga0068854_100820703 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
3300005587|Ga0066654_10856723 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 519 | Open in IMG/M |
3300005713|Ga0066905_100374027 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
3300005713|Ga0066905_100492117 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
3300005713|Ga0066905_100550143 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 969 | Open in IMG/M |
3300005844|Ga0068862_100973078 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 838 | Open in IMG/M |
3300006049|Ga0075417_10227183 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
3300006796|Ga0066665_10802357 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 742 | Open in IMG/M |
3300006806|Ga0079220_10926924 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 680 | Open in IMG/M |
3300006844|Ga0075428_101969223 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 606 | Open in IMG/M |
3300006847|Ga0075431_100067790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3684 | Open in IMG/M |
3300006852|Ga0075433_10165221 | All Organisms → cellular organisms → Bacteria | 1970 | Open in IMG/M |
3300006852|Ga0075433_10997852 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300006871|Ga0075434_100021101 | All Organisms → cellular organisms → Bacteria | 6329 | Open in IMG/M |
3300006876|Ga0079217_11617998 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 518 | Open in IMG/M |
3300006876|Ga0079217_11678322 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 510 | Open in IMG/M |
3300006880|Ga0075429_100950354 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 752 | Open in IMG/M |
3300006880|Ga0075429_101024182 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 722 | Open in IMG/M |
3300006969|Ga0075419_10549666 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
3300007076|Ga0075435_100123538 | All Organisms → cellular organisms → Bacteria | 2162 | Open in IMG/M |
3300009012|Ga0066710_103593732 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 585 | Open in IMG/M |
3300009089|Ga0099828_10060583 | All Organisms → cellular organisms → Bacteria | 3174 | Open in IMG/M |
3300009090|Ga0099827_10254086 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1478 | Open in IMG/M |
3300009094|Ga0111539_12952156 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 550 | Open in IMG/M |
3300009157|Ga0105092_10858408 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 534 | Open in IMG/M |
3300009553|Ga0105249_11047022 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 885 | Open in IMG/M |
3300009810|Ga0105088_1112421 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 513 | Open in IMG/M |
3300009817|Ga0105062_1045336 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 797 | Open in IMG/M |
3300010337|Ga0134062_10535142 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 594 | Open in IMG/M |
3300010397|Ga0134124_10608098 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1072 | Open in IMG/M |
3300011271|Ga0137393_11404313 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 587 | Open in IMG/M |
3300012205|Ga0137362_11474191 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 567 | Open in IMG/M |
3300012208|Ga0137376_10328562 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1327 | Open in IMG/M |
3300012209|Ga0137379_10293592 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1536 | Open in IMG/M |
3300012356|Ga0137371_10864529 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 688 | Open in IMG/M |
3300012930|Ga0137407_10792441 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 895 | Open in IMG/M |
3300012971|Ga0126369_13676517 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 503 | Open in IMG/M |
3300012976|Ga0134076_10415894 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 602 | Open in IMG/M |
3300014267|Ga0075313_1051735 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 964 | Open in IMG/M |
3300014883|Ga0180086_1201323 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 516 | Open in IMG/M |
3300015374|Ga0132255_103435680 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 674 | Open in IMG/M |
3300016445|Ga0182038_11247466 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 663 | Open in IMG/M |
3300018031|Ga0184634_10180591 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 956 | Open in IMG/M |
3300018054|Ga0184621_10197611 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 721 | Open in IMG/M |
3300018422|Ga0190265_12483114 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 617 | Open in IMG/M |
3300018433|Ga0066667_10150234 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1642 | Open in IMG/M |
3300018468|Ga0066662_10157787 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1727 | Open in IMG/M |
3300020221|Ga0194127_10032978 | All Organisms → cellular organisms → Bacteria | 4380 | Open in IMG/M |
3300025899|Ga0207642_10491162 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 750 | Open in IMG/M |
3300025907|Ga0207645_11004710 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 565 | Open in IMG/M |
3300025923|Ga0207681_11774824 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 515 | Open in IMG/M |
3300025930|Ga0207701_10341925 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
3300026324|Ga0209470_1191686 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 873 | Open in IMG/M |
3300026335|Ga0209804_1289936 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 563 | Open in IMG/M |
3300026529|Ga0209806_1051584 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1930 | Open in IMG/M |
3300026529|Ga0209806_1110644 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1144 | Open in IMG/M |
3300026550|Ga0209474_10564113 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 579 | Open in IMG/M |
3300027277|Ga0209846_1070392 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 522 | Open in IMG/M |
3300027444|Ga0207468_1003214 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 824 | Open in IMG/M |
3300027639|Ga0209387_1239409 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 513 | Open in IMG/M |
3300027873|Ga0209814_10355001 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300027909|Ga0209382_11416110 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 697 | Open in IMG/M |
3300027949|Ga0209860_1020079 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
3300028380|Ga0268265_10963244 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 841 | Open in IMG/M |
3300028812|Ga0247825_10931410 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 630 | Open in IMG/M |
3300028814|Ga0307302_10067360 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1683 | Open in IMG/M |
(restricted) 3300031150|Ga0255311_1103858 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 616 | Open in IMG/M |
3300031198|Ga0307500_10060596 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 937 | Open in IMG/M |
3300031564|Ga0318573_10055666 | All Organisms → cellular organisms → Bacteria | 1943 | Open in IMG/M |
3300031640|Ga0318555_10256790 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 944 | Open in IMG/M |
3300031720|Ga0307469_11284887 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 694 | Open in IMG/M |
3300031731|Ga0307405_11984255 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 520 | Open in IMG/M |
3300031740|Ga0307468_100044919 | All Organisms → cellular organisms → Bacteria | 2254 | Open in IMG/M |
3300031740|Ga0307468_100843533 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 787 | Open in IMG/M |
3300031740|Ga0307468_101363653 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 649 | Open in IMG/M |
3300031820|Ga0307473_11165967 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 571 | Open in IMG/M |
3300031892|Ga0310893_10151788 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 901 | Open in IMG/M |
3300031903|Ga0307407_10553994 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 850 | Open in IMG/M |
3300031995|Ga0307409_101518138 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 697 | Open in IMG/M |
3300032163|Ga0315281_11390482 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 692 | Open in IMG/M |
3300033433|Ga0326726_11813788 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 594 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 18.87% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.26% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.55% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.66% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.72% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.72% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.77% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.77% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 3.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.83% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.83% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.89% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.89% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.94% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.94% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.94% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.94% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.94% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.94% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.94% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.94% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.94% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.94% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.94% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.94% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.94% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.94% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.94% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.94% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300014267 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 | Environmental | Open in IMG/M |
3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027277 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027444 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A1w-11 (SPAdes) | Environmental | Open in IMG/M |
3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027949 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI11615J12901_129400011 | 3300000953 | Soil | AKAFVFASSVGAVKGADNYLGAIDYNIRTLAKALQ* |
JGI1027J12803_1005532562 | 3300000955 | Soil | EVGGGAKALVMATAVGAVKGADNYIAAIDYNIKTLVQALK* |
JGI1027J12803_1059724562 | 3300000955 | Soil | AKAFVMATAVGAVKGADNYIAAIDHNITTLAKALQ* |
JGI1027J12803_1069677641 | 3300000955 | Soil | EPWNDLKLAERVAAEVGNGAQALTMATAVGAVKGADNYFAAIDYNITSLAQALK* |
JGI1027J12803_1087729862 | 3300000955 | Soil | EAGAKAFVMATAVGAVKGADNYLAAIDYNVTTLAKALR* |
JGI25385J37094_101447922 | 3300002558 | Grasslands Soil | EEAGAKAYVFASAVGGVKGTDNYIATIEFNVTLLAQALR* |
JGI25384J37096_101175612 | 3300002561 | Grasslands Soil | NDLKLAERVAAEAGAKAFVFASAVGAVKGADNYIAAIEFNVTTLAQALK* |
Ga0062590_1003784721 | 3300004157 | Soil | EPWNDVKLANRVAEEAGAKAYVMATSVGAVKGADNYVAAIDFNINTLAKALR* |
Ga0066680_102828651 | 3300005174 | Soil | AEEAGAKAYVFASAVGGVKGTDNYIATIEFNVTLLAQALR* |
Ga0066679_101299731 | 3300005176 | Soil | AQRVAEEAGAKAYVFASAVGGVKGADNYIATIEFNVTLLAQALK* |
Ga0066690_101416833 | 3300005177 | Soil | LVEPWNDVKLAQRVAQEAGAKALVFASAVGAVKGADNYIAAIDYNIKTLAKALQ* |
Ga0066388_1019264931 | 3300005332 | Tropical Forest Soil | EAVKMILVEPWNDVKLANRVAEEAGAKAFVMATAVGAVKGADNYIAAIDFNIKTLSQALK |
Ga0070680_1014867981 | 3300005336 | Corn Rhizosphere | EPWNDVKLANRVAEEAGARALVMATSVGAVKGADNYIAAIDYNITALAKALR* |
Ga0070667_1020709502 | 3300005367 | Switchgrass Rhizosphere | EPWNDIKLANRLAEEAGAKALVMATAVGAVKGADNYIAAIDYNITTLAKALQQ* |
Ga0070701_103367672 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | EGVKAILVEPWNDVKLANRLAEEAGAKAYVMATAVGAVKGADNYLAAIDFNINTLAKALR |
Ga0070694_1010761432 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VELWNDVKLANRVAEEAGAKALVMATAVGAVKGADNYIAAIDYNITALAKALR* |
Ga0066682_101531413 | 3300005450 | Soil | VEPWNDVKLANRVAEEAGAKAFVMATAVGAVKGADNYIAAIDYNITTLSKALR* |
Ga0066681_100646031 | 3300005451 | Soil | VKMILVEPWNDVKLATRVAEEAGAKAFVMATAVGAVKGADNYIAAIDFNIKTLSEALK* |
Ga0070707_1003852993 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | ILVEPWNDVKLAQRIAEEAGAKAIVFASAVGAVKGADNYIAAIDYNITTLAKALQ* |
Ga0070699_1011260121 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | DFKLAQRIAEEAGAKAYVFASAVGGVKGTDNYIAAIEFNVALLAQALK* |
Ga0066697_107314602 | 3300005540 | Soil | VEPWNDFKLAQRVADEAGAKAIVFATAVGAVKGADNYIAAIDYNVNTLAEALK* |
Ga0070696_10001770010 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | NRVAEEAGAKALVMATAVGAVKGADNYIAAIDYNITALAKALR* |
Ga0070696_1019744002 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VEPWNDVKLANRIAEEAGATAFVMASAVGAVKGADNYIAAIDYNVTTLARALR* |
Ga0066703_102524372 | 3300005568 | Soil | KEERVKMILVEPWNDVKLATRVAEEAGAKAFVMATAVGAVKGADNYIAAIDFNIKTLSEALK* |
Ga0066702_104777422 | 3300005575 | Soil | LVEPWNDVKLATRVGEEAGAKAFVVASAVGAVKGADNYIAAIDYNIKTLAKALQ* |
Ga0068854_1008207031 | 3300005578 | Corn Rhizosphere | GVKAILVEPWNDVKLANRLAEEAGAKAYVMATAVGAVKGADNYLAAIDFNINTLAKALR* |
Ga0066654_108567232 | 3300005587 | Soil | VAEEAGAKAFVMASAVGAVKGADNYIAAIDYNITTLAQALR* |
Ga0066905_1003740273 | 3300005713 | Tropical Forest Soil | LAERVAQEAGARALVIATSVGAVKGTENYIAAIDYNVRSLAEALK* |
Ga0066905_1004921172 | 3300005713 | Tropical Forest Soil | VEPWNDVKLANRVAEEAGAKAFVMATAVGAVKGGDNYIAAIDFNIKTLSQALK* |
Ga0066905_1005501431 | 3300005713 | Tropical Forest Soil | GAKAFVMATAVGAVKGADNYIAAIDFNIKTLSEALK* |
Ga0068862_1009730781 | 3300005844 | Switchgrass Rhizosphere | WNDVKLANRLAEEAGAKAYVMATAVGAVKGADNYLAAIDFNINTLAKALR* |
Ga0075417_102271831 | 3300006049 | Populus Rhizosphere | LIVEPWNDVKLANRVAQEAGAKAVVLASMVGGVKGADSYIGAIDHNVNALVTAMK* |
Ga0066665_108023571 | 3300006796 | Soil | KAFVFASAVGAVKGADNYIAAIEFNVTLLAQALK* |
Ga0079220_109269242 | 3300006806 | Agricultural Soil | AGAKALVMASAVGAVKGADNYLAAIDFNINALVKALQP* |
Ga0075428_1019692231 | 3300006844 | Populus Rhizosphere | DLKLAERVASEVSGGCKALVMANSVGAVKGADNYIAAVDYNVKMLAQVLK* |
Ga0075431_1000677909 | 3300006847 | Populus Rhizosphere | AKAFVVASAVGAVKGADSYIDAIDFNVNTLAKALR* |
Ga0075433_101652214 | 3300006852 | Populus Rhizosphere | EPWNDVKLARRVADEAGAKAIVIASAVGAVKGADNYIAAVDFNVRTLAEALR* |
Ga0075433_109978521 | 3300006852 | Populus Rhizosphere | RVAEEAGARAFVMATAVGAVKGADNYIAAIEFNIKTLSEALK* |
Ga0075434_10002110111 | 3300006871 | Populus Rhizosphere | ILVEPWNDVKLANRVAEEAGARALVMATAVGAVKGADNYIAAIDYNITALAKALR* |
Ga0079217_116179981 | 3300006876 | Agricultural Soil | EEGGAKVVPLASVVGAIKGADTYLAAIDYNVRALVQALR* |
Ga0079217_116783221 | 3300006876 | Agricultural Soil | GDAGAKAIVIAPAVGAVKGTDDYLAAIDYNVTTLARELR* |
Ga0075429_1009503542 | 3300006880 | Populus Rhizosphere | AKAFVVASAVGAVKGADSYIAAIDYTVNTLAQALR* |
Ga0075429_1010241821 | 3300006880 | Populus Rhizosphere | DVKLANRVAEEAGAKAFVVASAVGAVKGADSYIDAIDFNVNTLAKALR* |
Ga0075419_105496662 | 3300006969 | Populus Rhizosphere | LLVEPWNDVKLANRVAEEAGAKAIVVASSVGAVKGADSYFAAIDYNVTTLAKALR* |
Ga0075435_1001235381 | 3300007076 | Populus Rhizosphere | GAKAFVMASAVGAVKGADNYFAAIDYNITTLSNALR* |
Ga0066710_1035937322 | 3300009012 | Grasslands Soil | TAEEAGARALVIASSVGAVKGADNYLAAIDYNVTMLAKALQ |
Ga0099828_100605836 | 3300009089 | Vadose Zone Soil | VAEEAGAKAYVFASAVGGVKGTDNYVATIEFNVTLLAQALK* |
Ga0099827_102540861 | 3300009090 | Vadose Zone Soil | PWNDRKLAGRVADDAGAKAVVLASMVGGVKGADNYIAAIDYNIKTLSEALR* |
Ga0111539_129521562 | 3300009094 | Populus Rhizosphere | ANRVAEEAGAKAYVMASAVGAVKGADNYLAAIDYNVTTLAKALR* |
Ga0105092_108584082 | 3300009157 | Freshwater Sediment | VIVEPWNDQKLAARVAEEAGAKALVLAAGVGSLKGADTYLDAVAYNVNTLAQALR* |
Ga0105249_110470222 | 3300009553 | Switchgrass Rhizosphere | EEAGAKAYVMATAVGAVKGADNYLAAIDFNINTLAKALR* |
Ga0105088_11124212 | 3300009810 | Groundwater Sand | VKLAKRVADEAGARALVMASAVGAVKGADNYIAAIDYNVKTLAEALR* |
Ga0105062_10453361 | 3300009817 | Groundwater Sand | RVAGEAGARAIVMATAVGAVKGADNYIAAVDYNVTALAQALK* |
Ga0134062_105351422 | 3300010337 | Grasslands Soil | DFKLAQRVADEAGAKAIVFATAVGAVKGADNYIAAIDYNVNTLAEALK* |
Ga0134124_106080981 | 3300010397 | Terrestrial Soil | ILVEPWNDVKLAERVAAEVGNGTKALVMATAVGAVKGADNYFAAIDYNITTLAQALK* |
Ga0137393_114043131 | 3300011271 | Vadose Zone Soil | ILVEPWNDVKLAQRIAEEAGAKAIVFASAVGAVKGADNYIAAIDYNIKTLAEALR* |
Ga0137362_114741911 | 3300012205 | Vadose Zone Soil | EPWNDIKLATRVAEEAGAKALVMASAVGAVKGADNYLAAIDYNVTALVNALR* |
Ga0137376_103285621 | 3300012208 | Vadose Zone Soil | EAGAKAYVFASAVGGVKGTDNYIATIEFNVTLLAQALK* |
Ga0137379_102935921 | 3300012209 | Vadose Zone Soil | DVKLATRVAEEAGARAFVMATAVGAVKGADNYIAAIDFNIKTLSEGLK* |
Ga0137371_108645292 | 3300012356 | Vadose Zone Soil | GAKAYVFASAVGGVKGADNYIATIEFNVTLLAQALK* |
Ga0137407_107924411 | 3300012930 | Vadose Zone Soil | ANRVADEAGARAFVVASAVGAVKGADNYIAAIDYNVNTLAQALR* |
Ga0126369_136765171 | 3300012971 | Tropical Forest Soil | AERVAQEAGARAIVFASAVGAVKGADSYIGAIDFNIKTFVDALK* |
Ga0134076_104158941 | 3300012976 | Grasslands Soil | ANRVAEEAGARAFVMATAVGAVKGADNYIAAIDFNIKTLSEALK* |
Ga0075313_10517351 | 3300014267 | Natural And Restored Wetlands | KEQGVKALLVEPWNDVRLANRVAEEAGAKAYVMASAVGAVKGADNYIAAIDYNVTTLSRVLR* |
Ga0180086_12013232 | 3300014883 | Soil | GARALVMASSVGAVKGADNYIAAIDFNVKTLAEALR* |
Ga0132255_1034356801 | 3300015374 | Arabidopsis Rhizosphere | KALVMATAVGAVKGADNYIAAIDYNITTLAKALQ* |
Ga0182038_112474662 | 3300016445 | Soil | GNGAKALVMATAVGAVKGADNYFAAIDYNITTLAQALK |
Ga0184634_101805912 | 3300018031 | Groundwater Sediment | KLATRVAEEAGARALVVASAVGGVKGADNYFAAIDFNVKTLAEALR |
Ga0184621_101976111 | 3300018054 | Groundwater Sediment | EEAGAKAYVMASAVGAVKGADNYIAAIDYNVTTLAKALR |
Ga0190265_124831142 | 3300018422 | Soil | LANRVAEEAGAKAYVVASAVGAVKGADNYIAAIDYNVTTLARALR |
Ga0066667_101502341 | 3300018433 | Grasslands Soil | ATRVAEEAGAKALVMASAVGAVKGADNYLAAIDYNVTALVNALR |
Ga0066662_101577874 | 3300018468 | Grasslands Soil | VILGEPWNDVKLATRVAEEAGAKAFVMATAVGAVKGADNYIAAIDFNIKTLSEALK |
Ga0194127_100329785 | 3300020221 | Freshwater Lake | VKVVLVEPWNDQKLAARVAEEAGGRAVVVASAVGAVKGADNYLAAIDHNVRTLAEALR |
Ga0207642_104911622 | 3300025899 | Miscanthus Rhizosphere | NDIKLANRLAEEAGAKALVMATAVGAVKGADNYIAAIDYNITALAKALR |
Ga0207645_110047101 | 3300025907 | Miscanthus Rhizosphere | EAGARALVMATSVGAVKGADNYIAAIDYNITALAMALR |
Ga0207681_117748242 | 3300025923 | Switchgrass Rhizosphere | KLANRVAEEAGAKALVMATAVGAVKGADNYIAAIDYNITTLAKALR |
Ga0207701_103419252 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | VANRVAEEAGARALVMATSVGAVKGADNYIAAIDYNITALAKALR |
Ga0209470_11916861 | 3300026324 | Soil | AGAKAYVFASAVGGVKGADNYIATIEFNVTLLAQALK |
Ga0209804_12899361 | 3300026335 | Soil | NDFKLAQRVADEAGAKALVFATAVGAVKGADNYIAAIDYNVNTLAQVLK |
Ga0209806_10515845 | 3300026529 | Soil | VKAILVEPWNDIKLATRVAEEAGAKALVMASAVGAVKGADNYLAAIDYNVTALVNALR |
Ga0209806_11106441 | 3300026529 | Soil | DVKLATRVAEEAGAKAFVMATAVGAVKGADNYIAAIDFNIKTLSEALK |
Ga0209474_105641132 | 3300026550 | Soil | NRVAEEAGAKAFVMASAVGAVKGADNYIAAIDYNITTLAQALR |
Ga0209846_10703922 | 3300027277 | Groundwater Sand | LATRVAEDAGARALVMASSVGAVKGADNYIAAIDYNVKTLAEALR |
Ga0207468_10032142 | 3300027444 | Soil | NDVKLANRLAEEAGAKAYVMATAVGAVKGADNYLAAIDFNINTLAKALR |
Ga0209387_12394091 | 3300027639 | Agricultural Soil | AQEAGARSYVMAVSVGAVKGADTYFSAIDYNIRTLAEALR |
Ga0209814_103550011 | 3300027873 | Populus Rhizosphere | LIVEPWNDVKLANRVAQEAGAKAVVLASMVGGVKGADSYIGAIDHNVNALVTAMK |
Ga0209382_114161101 | 3300027909 | Populus Rhizosphere | LVEPWNDVRLANRVAEEAGAKAYVMASAVGAVKGADNYIAAIDYNVTTLARALRQ |
Ga0209860_10200793 | 3300027949 | Groundwater Sand | PWNDQKLAQRVAGEAGARAIVMATAVGAVKGADNYIAAVDYNVTALAQALK |
Ga0268265_109632442 | 3300028380 | Switchgrass Rhizosphere | PWNDVKLANRLAEEAGAKAYVMATAVGAVKGADNYLAAIDFNINTLAKALR |
Ga0247825_109314102 | 3300028812 | Soil | LGHVLVEPWNDVKLANRVAEEAGAKAFVVASSVGAVKGADNYIAAIDYNVRMLAKVLQ |
Ga0307302_100673604 | 3300028814 | Soil | NRVAEEAGAKAYVMASAVGAVKGADNYIAAIDYNVTTLARALR |
(restricted) Ga0255311_11038581 | 3300031150 | Sandy Soil | ILVEPWNDVKLANRVAQEAGAKAIVFASAVGAVKGADNYIAAIDFNVKTLAEALR |
Ga0307500_100605961 | 3300031198 | Soil | GAKALVMATAVGAVKGADNYIAAIDYNITALAQALR |
Ga0318573_100556664 | 3300031564 | Soil | VKLAERVAGEVGNGAKALVMATAVGAVKGADNYFAAIDYNITTLAQALK |
Ga0318555_102567901 | 3300031640 | Soil | GEVGNGAKALVMATAVGAVKGADNYFAAIDYNITTLAQALK |
Ga0307469_112848871 | 3300031720 | Hardwood Forest Soil | ILVEPWNDLKLAERVAAEVGNGAQALTMATAVGAVKGADNYFAAIDYNITSLAQALK |
Ga0307405_119842552 | 3300031731 | Rhizosphere | KLATRVAEEAGGKALVIASSVGAVKGADDYIATIDYNVKALAAALR |
Ga0307468_1000449191 | 3300031740 | Hardwood Forest Soil | NRIAEEAGAKAFVMATAVGAVKGADNYVAAIDYNITTLVKALR |
Ga0307468_1008435332 | 3300031740 | Hardwood Forest Soil | GAKAIVLASAVGAVKGADNYVAAIDYNIRMLFEALR |
Ga0307468_1013636531 | 3300031740 | Hardwood Forest Soil | PWNDIKLANRLAEEAGAKALVMATAVGAVKGADNYIAAIDYNITTLAKALQ |
Ga0307473_111659671 | 3300031820 | Hardwood Forest Soil | EKVKMILVEPWNDVKLANRVAEEAGAKAFVMATAVGAVKGADNYIAAIDFNIKTLSEGLR |
Ga0310893_101517882 | 3300031892 | Soil | GVKAILVEPWNDVKLANRLAEEAGAKAYVMATAVGAVKGADNYLAAIDFNINTLAKALR |
Ga0307407_105539942 | 3300031903 | Rhizosphere | AARVAEEAGAKALVIASSVGAVKGADDYISTVAYNVKMLAEALR |
Ga0307409_1015181382 | 3300031995 | Rhizosphere | EEAGAKALVIASSVGAVKGADDYISTVAYNVKMLAEALR |
Ga0315281_113904822 | 3300032163 | Sediment | AEEAGAKAYVMATSVGAVKGADNYFAAIDYNVKTLAEALK |
Ga0326726_118137881 | 3300033433 | Peat Soil | EAGARAFVMATAVGAVKGADNYIAAIDFNITTLAKVLQ |
⦗Top⦘ |