| Basic Information | |
|---|---|
| Family ID | F093561 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 44 residues |
| Representative Sequence | VTIILCPAKNGAPVAYIGSGDPGTKVIFADGRELDFKDRTAP |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.94 % |
| % of genes near scaffold ends (potentially truncated) | 97.17 % |
| % of genes from short scaffolds (< 2000 bps) | 94.34 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.113 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (13.207 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.698 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.170 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 22.86% Coil/Unstructured: 77.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF00486 | Trans_reg_C | 12.26 |
| PF04248 | NTP_transf_9 | 4.72 |
| PF01738 | DLH | 3.77 |
| PF07586 | HXXSHH | 0.94 |
| PF02653 | BPD_transp_2 | 0.94 |
| PF03928 | HbpS-like | 0.94 |
| PF07690 | MFS_1 | 0.94 |
| PF03972 | MmgE_PrpD | 0.94 |
| PF11848 | DUF3368 | 0.94 |
| PF12681 | Glyoxalase_2 | 0.94 |
| PF04909 | Amidohydro_2 | 0.94 |
| PF05496 | RuvB_N | 0.94 |
| PF03544 | TonB_C | 0.94 |
| PF00041 | fn3 | 0.94 |
| PF15919 | HicB_lk_antitox | 0.94 |
| PF07626 | PSD3 | 0.94 |
| PF00583 | Acetyltransf_1 | 0.94 |
| PF00708 | Acylphosphatase | 0.94 |
| PF01177 | Asp_Glu_race | 0.94 |
| PF02627 | CMD | 0.94 |
| PF00756 | Esterase | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG2343 | Uncharacterized conserved protein, DUF427 family | Function unknown [S] | 4.72 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.94 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.94 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.94 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.94 |
| COG2255 | Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvB | Replication, recombination and repair [L] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.11 % |
| Unclassified | root | N/A | 1.89 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004463|Ga0063356_105230243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300005180|Ga0066685_10712312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300005330|Ga0070690_100641656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 810 | Open in IMG/M |
| 3300005337|Ga0070682_100421970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1014 | Open in IMG/M |
| 3300005365|Ga0070688_100876476 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 707 | Open in IMG/M |
| 3300005438|Ga0070701_10810813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → Bdellovibrionaceae → Bdellovibrio → unclassified Bdellovibrio → Bdellovibrio sp. qaytius | 639 | Open in IMG/M |
| 3300005535|Ga0070684_100015391 | All Organisms → cellular organisms → Bacteria | 6230 | Open in IMG/M |
| 3300005554|Ga0066661_10870543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300005558|Ga0066698_10288861 | Not Available | 1135 | Open in IMG/M |
| 3300005569|Ga0066705_10049414 | All Organisms → cellular organisms → Bacteria | 2357 | Open in IMG/M |
| 3300005616|Ga0068852_101914216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300005834|Ga0068851_10433405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300005836|Ga0074470_10458461 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300005841|Ga0068863_100088592 | All Organisms → cellular organisms → Bacteria | 2933 | Open in IMG/M |
| 3300005844|Ga0068862_101398380 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300006032|Ga0066696_10874970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300006162|Ga0075030_100075306 | All Organisms → cellular organisms → Bacteria | 2776 | Open in IMG/M |
| 3300006797|Ga0066659_10784721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 786 | Open in IMG/M |
| 3300006800|Ga0066660_10717433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 819 | Open in IMG/M |
| 3300006845|Ga0075421_100154858 | All Organisms → cellular organisms → Bacteria | 2862 | Open in IMG/M |
| 3300006846|Ga0075430_100196840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1674 | Open in IMG/M |
| 3300006852|Ga0075433_10276017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1490 | Open in IMG/M |
| 3300006853|Ga0075420_100451073 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1111 | Open in IMG/M |
| 3300006854|Ga0075425_100398445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1586 | Open in IMG/M |
| 3300009012|Ga0066710_100938680 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber | 1333 | Open in IMG/M |
| 3300009148|Ga0105243_12457247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300009553|Ga0105249_12144662 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300009792|Ga0126374_11454794 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300010047|Ga0126382_10732120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 834 | Open in IMG/M |
| 3300010107|Ga0127494_1130274 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
| 3300010114|Ga0127460_1037980 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300010124|Ga0127498_1076201 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300010304|Ga0134088_10015135 | All Organisms → cellular organisms → Bacteria | 3347 | Open in IMG/M |
| 3300010326|Ga0134065_10218299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300010335|Ga0134063_10227780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 882 | Open in IMG/M |
| 3300010358|Ga0126370_11624745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300010360|Ga0126372_12647083 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300010362|Ga0126377_13024697 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300010362|Ga0126377_13150633 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300010366|Ga0126379_13851226 | Not Available | 503 | Open in IMG/M |
| 3300010376|Ga0126381_101665000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 922 | Open in IMG/M |
| 3300010376|Ga0126381_102665865 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300010398|Ga0126383_10467639 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1313 | Open in IMG/M |
| 3300010398|Ga0126383_11793193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300010399|Ga0134127_11307769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
| 3300010905|Ga0138112_1045620 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
| 3300011080|Ga0138568_1133470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300011087|Ga0138570_1155266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 886 | Open in IMG/M |
| 3300011119|Ga0105246_10752008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 860 | Open in IMG/M |
| 3300012205|Ga0137362_10747198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 839 | Open in IMG/M |
| 3300012357|Ga0137384_10459901 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300012383|Ga0134033_1150905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300012401|Ga0134055_1117820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 860 | Open in IMG/M |
| 3300012469|Ga0150984_111636892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300012892|Ga0157294_10072637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 831 | Open in IMG/M |
| 3300012917|Ga0137395_10931294 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300012960|Ga0164301_11577898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300012971|Ga0126369_10596558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1174 | Open in IMG/M |
| 3300013100|Ga0157373_10321603 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1100 | Open in IMG/M |
| 3300013308|Ga0157375_11264315 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
| 3300013308|Ga0157375_12678576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300014499|Ga0182012_10225228 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1300 | Open in IMG/M |
| 3300014969|Ga0157376_11183280 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 792 | Open in IMG/M |
| 3300015373|Ga0132257_102923050 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300015374|Ga0132255_105406414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300016357|Ga0182032_11636971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300016387|Ga0182040_11810119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300018431|Ga0066655_10374986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
| 3300020000|Ga0193692_1031076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1247 | Open in IMG/M |
| 3300021432|Ga0210384_10170227 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1957 | Open in IMG/M |
| 3300021432|Ga0210384_10225857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1685 | Open in IMG/M |
| 3300021475|Ga0210392_11308216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300021560|Ga0126371_11983473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300021560|Ga0126371_13680451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300021861|Ga0213853_11068104 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300025898|Ga0207692_10774401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300025906|Ga0207699_10165892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1474 | Open in IMG/M |
| 3300025927|Ga0207687_11941792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300025933|Ga0207706_11187320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300025939|Ga0207665_11202043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300025944|Ga0207661_10218558 | All Organisms → cellular organisms → Bacteria | 1683 | Open in IMG/M |
| 3300025944|Ga0207661_11361928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300026023|Ga0207677_11555924 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 611 | Open in IMG/M |
| 3300026075|Ga0207708_11384620 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 617 | Open in IMG/M |
| 3300026116|Ga0207674_10875329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 866 | Open in IMG/M |
| 3300026121|Ga0207683_10753153 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300026307|Ga0209469_1083284 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 947 | Open in IMG/M |
| 3300026309|Ga0209055_1264649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300026550|Ga0209474_10450910 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300027905|Ga0209415_10928846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300027911|Ga0209698_10510251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 930 | Open in IMG/M |
| 3300027911|Ga0209698_10532220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 908 | Open in IMG/M |
| 3300031708|Ga0310686_118007735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300031712|Ga0265342_10694148 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300031753|Ga0307477_10372206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 981 | Open in IMG/M |
| 3300031879|Ga0306919_10513614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 924 | Open in IMG/M |
| 3300031947|Ga0310909_11011222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300031962|Ga0307479_12102593 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300032001|Ga0306922_10513203 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1277 | Open in IMG/M |
| 3300032039|Ga0318559_10460067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300032783|Ga0335079_11694944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300033004|Ga0335084_11812864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300033158|Ga0335077_11602867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300033289|Ga0310914_10215982 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1716 | Open in IMG/M |
| 3300033433|Ga0326726_11772484 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300034662|Ga0314783_170442 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.43% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 8.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.66% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.72% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.77% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.77% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.83% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.83% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.83% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.89% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.89% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.94% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.94% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.94% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.94% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.94% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.94% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.94% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010107 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010114 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010124 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010905 | Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011080 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011087 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 55 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012383 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012401 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300020000 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1 | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034662 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0063356_1052302432 | 3300004463 | Arabidopsis Thaliana Rhizosphere | CPAKNGEPVAYIGTGDPGTKVIFADGRELDFKDRTVPTP* |
| Ga0066685_107123123 | 3300005180 | Soil | RSVKPGDEVTIILCPAKNGEPVAYIGSGDPGTKIIFSDGRELDFKDRTAQ* |
| Ga0070690_1006416562 | 3300005330 | Switchgrass Rhizosphere | IMCPAKNGAPVAYMGSGDPGTKVIFADGHELDFTDKTGR* |
| Ga0070682_1004219701 | 3300005337 | Corn Rhizosphere | GDQITIILCPAKNGQPVAYAGSGGPGTKVIFADGRELDFTDKTVDKAVDTAK* |
| Ga0070688_1008764761 | 3300005365 | Switchgrass Rhizosphere | EVSIILCPAKNGAPVAYIGTGDPGTKVIFADGRELDFSEKTAK* |
| Ga0070701_108108132 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | RSVKPGDEVTIILCSAKNGAPVAYIGSGDPGTKVIFSNGKELDFQDRTTK* |
| Ga0070684_1000153917 | 3300005535 | Corn Rhizosphere | ALKAGDQITIILCPAKNGQPVAYAGSGDPGTKVIFADGRELDFTDKTIDKTVDKTIDNAK |
| Ga0066661_108705432 | 3300005554 | Soil | IKPGDEVTIILCPAKNGEPVAYIGSGDPGTKIIFSDGRELDFKDRTAP* |
| Ga0066698_102888612 | 3300005558 | Soil | VTIILCPAKNGAPVAYIGSGDPGTKVIFADGRELDFKDRTAP* |
| Ga0066705_100494144 | 3300005569 | Soil | AKNGAPVAYIGSGDPGTKVIFADGRELDFKEKTAP* |
| Ga0068852_1019142162 | 3300005616 | Corn Rhizosphere | LKAGDKITIIMCPAKNGQPVAYAGSGDPGTKVIFADGHELDFTDKTAK* |
| Ga0068851_104334051 | 3300005834 | Corn Rhizosphere | PVAYAGSGDPGTKVIFADGRELDFTDKTVDKTAP* |
| Ga0074470_104584611 | 3300005836 | Sediment (Intertidal) | ITVILCPAKNGAPVAYIGSGDPGTKVIFADGRELDFTDKTTQ* |
| Ga0068863_1000885924 | 3300005841 | Switchgrass Rhizosphere | EVTIIMCPAKNGAPVAYAGSGDPGTKVIFSNGKELDFQDKTGK* |
| Ga0068862_1013983802 | 3300005844 | Switchgrass Rhizosphere | QITIILCPAKNGQPVAYAGSGDPGTKVIFADGRELDFTDKTVDKAIDNAK* |
| Ga0066696_108749701 | 3300006032 | Soil | RSLKPGDEVTIILCPAKNGAPVAYIGSGDPGTKVIFADGRELDFKEKTAP* |
| Ga0075030_1000753061 | 3300006162 | Watersheds | IMCPAKNGQPVAYAGSGDPGTKVIFDDGRELDFVDKTR* |
| Ga0066659_107847211 | 3300006797 | Soil | PAKNGEPIAYIGSGDPGTKVIFSDGRELDFKDRTAP* |
| Ga0066660_107174331 | 3300006800 | Soil | GDEVTIILCPAKNGAPVAYIGSGDPGTKVIFFDGRELDFKDKTAQ* |
| Ga0075421_1001548581 | 3300006845 | Populus Rhizosphere | CPAKNGAPVAYIGSGDPGTKIIFSDGRELDFKDRTAQ* |
| Ga0075430_1001968403 | 3300006846 | Populus Rhizosphere | TIILCPAKNGAPVAYIGSGDPGTKVIFPDGRELDFKDKTAQ* |
| Ga0075433_102760173 | 3300006852 | Populus Rhizosphere | SLKAGDEVTIILCPAKNGAPVAYIGSGDPGTKVIFSDGRELDFKDRTAQ* |
| Ga0075420_1004510733 | 3300006853 | Populus Rhizosphere | AGDEVTIILCPAKNGAPVAYIGSGDPGTKVIFSDGRELDFKDRTAQ* |
| Ga0075425_1003984453 | 3300006854 | Populus Rhizosphere | GDEVTIILCPAKNGAPVAYIGSGDPGTKVIFSDGRELDFKDRTAQ* |
| Ga0066710_1009386801 | 3300009012 | Grasslands Soil | SLKAGDEVTIILCPARNGEPVAYIGSRDPGTKVIFSDGRELDFKDRTTPAP |
| Ga0105243_124572471 | 3300009148 | Miscanthus Rhizosphere | VTIIMCPAKNGAPVAYAGSGDPGTKVIFSNGKELDFQDKTGK* |
| Ga0105249_121446621 | 3300009553 | Switchgrass Rhizosphere | ILCPAKNGSPVAYMGSGDPGTKVIFADGHELDFTDKAAQ* |
| Ga0126374_114547941 | 3300009792 | Tropical Forest Soil | TRHSLKAGDEITIILCPAKNGQPVAYAGSGDPGTKVIFSDGRELDFTDKTLP* |
| Ga0126382_107321201 | 3300010047 | Tropical Forest Soil | RSIKAGDEVTIILCPAKNGAPVAYIGSGDPGTKVIFADGRELDFKDKTAPAQ* |
| Ga0127494_11302741 | 3300010107 | Grasslands Soil | PAKNGAPVAYIGSGDPGTKVILADGRELDFKEKTAP* |
| Ga0127460_10379802 | 3300010114 | Grasslands Soil | GDEVTIILCPAKNGAPVAYIGSGDPGTKVIFADGRELDFKEKTAP* |
| Ga0127498_10762011 | 3300010124 | Grasslands Soil | PGDEVTIILCPAKNGAPVAYIGSGDPGTKVIFADGRELDFKEKTAP* |
| Ga0134088_100151355 | 3300010304 | Grasslands Soil | IIVCPAKNGAPVAYIGSGDPGTKVIFADGRELDFKEKTAP* |
| Ga0134065_102182991 | 3300010326 | Grasslands Soil | EVTIILCPAKNGAPVAYIGSGDPGTKVIFADGRELDFKEKTAP* |
| Ga0134063_102277801 | 3300010335 | Grasslands Soil | KNGAPVAYIGSGDPGTKVIFADGRELDFKEKTAP* |
| Ga0126370_116247451 | 3300010358 | Tropical Forest Soil | PGDEVTIILCPAKNNAPVAYIGSGDPGTKVIFADGHELDFKDKTGAAQ* |
| Ga0126372_126470832 | 3300010360 | Tropical Forest Soil | RRSLKAGDEVTVILCPAKNGAPVAYIGSGDPGTKVIFADGRELDFKDRTAQ* |
| Ga0126377_130246971 | 3300010362 | Tropical Forest Soil | ARNGAPIAYIGSGDPGTKIIFSNGKELDFKDRTATAQ* |
| Ga0126377_131506331 | 3300010362 | Tropical Forest Soil | KNGAPVAYIGSGDPGTKVIFADGRELDFKDRTAQ* |
| Ga0126379_138512262 | 3300010366 | Tropical Forest Soil | IILCPAKNGAPVAYIGSGDPGTKVIFSDGRELDFKDRTAQ* |
| Ga0126381_1016650002 | 3300010376 | Tropical Forest Soil | LCPAKNGQPVAYIGSGDPGTKVIFKDGRELDFVDKTVP* |
| Ga0126381_1026658652 | 3300010376 | Tropical Forest Soil | KAGDEITIILCPAKNGQPVAYAGSGDPGTKVIFSDGRELDFTDKTLP* |
| Ga0126383_104676391 | 3300010398 | Tropical Forest Soil | EVTIILCPAKNGQPVAYIGSGDPGTKVIFADGRELDFTDKTVEKTTP* |
| Ga0126383_117931932 | 3300010398 | Tropical Forest Soil | CPAKNGAPVAYIGSGDPGTKVIFADGRELDFKEKAAAQ* |
| Ga0134127_113077692 | 3300010399 | Terrestrial Soil | IILCPAKNGQPVAYAGSGDPGTKVIFADGRELDFIDKTLESAK* |
| Ga0138112_10456201 | 3300010905 | Grasslands Soil | ILCPAKNGAPVAYIGSGDPGTKVIFADGRELDFKEKTAP* |
| Ga0138568_11334702 | 3300011080 | Peatlands Soil | ILCPAKNGQPVAYAGSGDPGTKVIFADGRELLFADKTAGP* |
| Ga0138570_11552661 | 3300011087 | Peatlands Soil | AKNGQPVAYAGSGDPGTKVIFADGRELLFADKTAGP* |
| Ga0105246_107520081 | 3300011119 | Miscanthus Rhizosphere | AKNGQPVAYAGSGDPGTKVIFADGRELDFTDKTVDKTTDNAK* |
| Ga0137362_107471982 | 3300012205 | Vadose Zone Soil | KNGEPIAYIGSGDPGTKVIFSDGRELDFKDRTAP* |
| Ga0137384_104599011 | 3300012357 | Vadose Zone Soil | RSVKPGDEVTIILCPAKNGEPVAYIGSGDPGTKVIFSDGRELDFKDRTAQ* |
| Ga0134033_11509052 | 3300012383 | Grasslands Soil | LCPAKNGAPVAYIGSGDPGTKVIFADGRELDFKEKTAP* |
| Ga0134055_11178201 | 3300012401 | Grasslands Soil | TIIVCPAKNGAPVAYIGSGDPGTKVIFADGRELDFKEKTAP* |
| Ga0150984_1116368921 | 3300012469 | Avena Fatua Rhizosphere | NSEPVAYIGSGDPGTKVIFKDGRELDFKDKSTAP* |
| Ga0157294_100726371 | 3300012892 | Soil | PAKNGAPVAYMGSGDPGTKVIFADGKELDFTDKTLR* |
| Ga0137395_109312941 | 3300012917 | Vadose Zone Soil | IKAGDEVTIILCPAKNGQPVAYAGSGDPGTKVIFANGRELDFTDKTLP* |
| Ga0164301_115778981 | 3300012960 | Soil | PVAYAGSGDPGTKVIFADGREMDFTDKTIDKTLDKTIDNAK* |
| Ga0126369_105965582 | 3300012971 | Tropical Forest Soil | RSLKAGDEVTIILCPAKNGQPVAYIGSGDPGTKVIFADGRELNFTDKTAEKTNP* |
| Ga0157373_103216031 | 3300013100 | Corn Rhizosphere | IILCPAKNGQPVAYAGSGDPGTKVIFADGRELDFTAKTVDKTAP* |
| Ga0157375_112643151 | 3300013308 | Miscanthus Rhizosphere | IILCPAKNGQPVAYAGSGDPGTKVIFADGRELDFTDKTIDKTVDKTIDNAK* |
| Ga0157375_126785761 | 3300013308 | Miscanthus Rhizosphere | RSIKYGDQLTVILCPAKNGAPVAYMGSGDPGTKVIFADGKELDFTDKTLR* |
| Ga0182012_102252281 | 3300014499 | Bog | LKAGDRITIIVCPAKNGQPVAYAGSGDPGTKVVFADGQELDFTDKTK* |
| Ga0157376_111832802 | 3300014969 | Miscanthus Rhizosphere | GDEVSIILCPAKNGAPVAYIGTGDPGTKVIFADGRELDFAEKTAK* |
| Ga0132257_1029230502 | 3300015373 | Arabidopsis Rhizosphere | RSVKPGDEVTVILCPAKNGAPIAYIGSGDPGTKIIFSTGRELDFKDRTAPAQ* |
| Ga0132255_1054064141 | 3300015374 | Arabidopsis Rhizosphere | VKPGDEVTVILCPAKNGAPIAYIGSGDPGTKIIFSTGRELDFKDRTAPAQ* |
| Ga0182032_116369711 | 3300016357 | Soil | VTIILCPAKNGEPVAYIGSGDPGTKIIFPDGRELDFKDKTTAP |
| Ga0182040_118101191 | 3300016387 | Soil | QVTIILCPAKNGEPVAYIGSGDPGTKVVFSDGRELDFKDKTAPAP |
| Ga0066655_103749861 | 3300018431 | Grasslands Soil | KPGDEVTIILCPAKNGAPVAYIGSGDPGTKVIFADGRELDFKEKTAP |
| Ga0193692_10310764 | 3300020000 | Soil | SRSIKPGDEITIIMCPAKNGAPVAYAGSGDAGTKVIFSNGKELDFQDKTVH |
| Ga0210384_101702271 | 3300021432 | Soil | PAKNGQPVAYMGSGDPGTKVIFADGRELDFADKTLP |
| Ga0210384_102258574 | 3300021432 | Soil | DQVTIILCPAKNGQPVAYAGSGDPGTKVIFADGRELDFTDKTVDKTAP |
| Ga0210392_113082162 | 3300021475 | Soil | IIVCPAKNGQPVAYAGSGDPGTKVIFADGRELDFVDKTAR |
| Ga0126371_119834731 | 3300021560 | Tropical Forest Soil | HSLKAGDEVTIILCPAKNGQPVAYIGSGDPGTKVIFKDGLELAFVDKTVP |
| Ga0126371_136804512 | 3300021560 | Tropical Forest Soil | AKNGQPVAYIGSGDPGTKVIFADGRELNFTDKTVEKTTP |
| Ga0213853_110681041 | 3300021861 | Watersheds | VILCPAKNGEPVAYIGSGDPGTKVIFADGRVLEFVDKTAPGK |
| Ga0207692_107744012 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | SLKAGDEITIILCPAKNGQPVAYAGSGDPGTKVIFADGREMDFVDKTVDKTAP |
| Ga0207699_101658923 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | EVTIILCPAKNGQPVAYAGSGDPGTKVIFADGRELDFTDKTVDKTAP |
| Ga0207687_119417922 | 3300025927 | Miscanthus Rhizosphere | IILCPAKNGQPVAYAGSGDPGTKVIFADGRELDFTDKTVDKTLDTAK |
| Ga0207706_111873202 | 3300025933 | Corn Rhizosphere | SLKAGDEVTIILCPAKNGEPVAYIGTGDPGTKVIFADGRELDFKDRTVPTP |
| Ga0207665_112020432 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VGDEVTIILCPAKNGQPVAYIGSGDPGTKVIFADGRELDFTDKTVDKTAP |
| Ga0207661_102185581 | 3300025944 | Corn Rhizosphere | GDQITIILCPAKNGQPVAYAGSGDPGTKVIFADGRELDFTDKTIDKTVDKTIDNAK |
| Ga0207661_113619282 | 3300025944 | Corn Rhizosphere | QPVAYAGSGDPGTKVIFADGRELDFTDKTVDKTAP |
| Ga0207677_115559241 | 3300026023 | Miscanthus Rhizosphere | LCPAKNGAPVAYIGTGDPGTKVIFADGRELDFAEKTAK |
| Ga0207708_113846201 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | WTRRSFKAGDEVSIILCPAKNGAPVAYIGTGDPGTKVIFADGRELDFAEKTAK |
| Ga0207674_108753292 | 3300026116 | Corn Rhizosphere | VKPGDEVTIILCPAKNGAPVAYIGSGDPGTKVIFSNGKELDFQDRTTK |
| Ga0207683_107531532 | 3300026121 | Miscanthus Rhizosphere | KAGDEVSIILCPAKNGAPVAYIGTGDPGTKVIFADGRELDFSEKTAK |
| Ga0209469_10832842 | 3300026307 | Soil | GDEVTIILCPAKNGAPVAYIGSGDPGTKVIFADGRELDFKEKTAP |
| Ga0209055_12646491 | 3300026309 | Soil | DGLRRSIKPGDEVTIILCPARNGEPVAYIGSGDPGTKIIFSDGRELDFKDRTAP |
| Ga0209474_104509101 | 3300026550 | Soil | RRSLKPGDEVTIILCPAKNGAPVAYIGSGDPGTKVVFADGRELDFKEK |
| Ga0209415_109288462 | 3300027905 | Peatlands Soil | LCPAKNGQPVAYIGSGDPGTKVVFADGRVLDFVDKTVDKTVDKTVP |
| Ga0209698_105102512 | 3300027911 | Watersheds | IIMCPAKNGQPVAYAGSGDPGTKVIFDDGRELDFVDKTR |
| Ga0209698_105322202 | 3300027911 | Watersheds | PAKNGQPVAYAGSGDPGAKVIFADGRELDFVDKTVDKGADKTLP |
| Ga0310686_1180077351 | 3300031708 | Soil | KAGDQITIIVCPAKNGQPVAYAGSGDPGTKVIFADGHELDFTDKTAK |
| Ga0265342_106941482 | 3300031712 | Rhizosphere | DQVTIILCPAKNGQPVAYAGSGDPGTKVIFADGHELDFLDKTVDKSAP |
| Ga0307477_103722062 | 3300031753 | Hardwood Forest Soil | TRRSLKAGDQVTIILCPARNGQPVAYAGSGDPGTKVIFADGRELDFVDKTAP |
| Ga0306919_105136141 | 3300031879 | Soil | CPAKNGQPVAYAGSGDPGTKVIFSDGRELDFTDKTLP |
| Ga0310909_110112221 | 3300031947 | Soil | IILCPAKNGQPVAYAGSGDPGTKVIFSDGRELDFTDKTLP |
| Ga0307479_121025932 | 3300031962 | Hardwood Forest Soil | PAKNGQPVAYIGSGDPGTKVIFADGRELNFTDKTVEKTTP |
| Ga0306922_105132031 | 3300032001 | Soil | TIILCPAKNGQPVAYIGSGDPGTKVIFADGRELNFTDKTVEKTTP |
| Ga0318559_104600671 | 3300032039 | Soil | NGQPVAYIGAGDPGTKVIFADGRELNFTDKTVEKTTP |
| Ga0335079_116949441 | 3300032783 | Soil | PAKNGQPVAYAGSGDPGTKVIFADGHELDFTDKTVEKTTP |
| Ga0335084_118128641 | 3300033004 | Soil | IKPGDEVTIILCPAKNNAPVAYIGSGDPGTKVIFADGHELDFKDKTAATP |
| Ga0335077_116028671 | 3300033158 | Soil | IILCPAKNGQPVAYIGSGDPGTKVIFADGRELNFVDKTVDKTVP |
| Ga0310914_102159821 | 3300033289 | Soil | KAGDEITIILCPAKNGQPVAYAGSGDPGTKVIFSDGRELDFTDKTLP |
| Ga0326726_117724842 | 3300033433 | Peat Soil | KNGQPVAYAGSGDPGTKVIFADGRDLDFVDKTIDKAAP |
| Ga0314783_170442_7_153 | 3300034662 | Soil | VKPGDEVTVILCPAKNGAPVAYIGSGDPGTKVIFSNGKELDFQDRTTK |
| ⦗Top⦘ |