Metagenome / Metatranscriptome Family F093552

Basic Information
Family ID	F093552
Family Type	Metagenome / Metatranscriptome
Number of Sequences	106
Average Sequence Length	40 residues
Representative Sequence	YELAFIWGVGPRVEEPGINLIRSFAYSGPLEDLRLKRP
Number of Associated Samples	88
Number of Associated Scaffolds	106

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	3.77 %
% of genes near scaffold ends (potentially truncated)	91.51 %
% of genes from short scaffolds (< 2000 bps)	90.57 %
Associated GOLD sequencing projects	88
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.15

Most Common Taxonomy
Group	Bacteria (93.396 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (16.981 % of family members)
Environment Ontology (ENVO)	Unclassified (26.415 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (36.792 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 106 Family Scaffolds
PF05157	T2SSE_N	8.49
PF05643	DUF799	7.55
PF00496	SBP_bac_5	4.72
PF02615	Ldh_2	4.72
PF12697	Abhydrolase_6	3.77
PF05378	Hydant_A_N	2.83
PF09948	DUF2182	2.83
PF13671	AAA_33	1.89
PF04909	Amidohydro_2	1.89
PF02604	PhdYeFM_antitox	1.89
PF00005	ABC_tran	0.94
PF05685	Uma2	0.94
PF01850	PIN	0.94
PF00528	BPD_transp_1	0.94
PF03092	BT1	0.94
PF00296	Bac_luciferase	0.94
PF13229	Beta_helix	0.94
PF08352	oligo_HPY	0.94
PF01553	Acyltransferase	0.94
PF00866	Ring_hydroxyl_B	0.94
PF03972	MmgE_PrpD	0.94
PF12838	Fer4_7	0.94
PF01425	Amidase	0.94
PF00589	Phage_integrase	0.94
PF08450	SGL	0.94
PF14559	TPR_19	0.94
PF13565	HTH_32	0.94
PF13620	CarboxypepD_reg	0.94
PF03534	SpvB	0.94
PF01402	RHH_1	0.94
PF09084	NMT1	0.94
PF13646	HEAT_2	0.94
PF00571	CBS	0.94
PF14257	DUF4349	0.94
PF13432	TPR_16	0.94
PF01555	N6_N4_Mtase	0.94
PF00501	AMP-binding	0.94

COG ID	Name	Functional Category	% Frequency in 106 Family Scaffolds
COG4380	Uncharacterized conserved protein, DUF799 domain	Function unknown [S]	7.55
COG0145	N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunit	Amino acid transport and metabolism [E]	5.66
COG2055	Malate/lactate/ureidoglycolate dehydrogenase, LDH2 family	Energy production and conversion [C]	4.72
COG4118	Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor	Defense mechanisms [V]	1.89
COG2161	Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family	Defense mechanisms [V]	1.89
COG5517	3-phenylpropionate/cinnamic acid dioxygenase, small subunit	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.94
COG4636	Endonuclease, Uma2 family (restriction endonuclease fold)	General function prediction only [R]	0.94
COG4521	ABC-type taurine transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.94
COG3391	DNA-binding beta-propeller fold protein YncE	General function prediction only [R]	0.94
COG3386	Sugar lactone lactonase YvrE	Carbohydrate transport and metabolism [G]	0.94
COG2189	Adenine specific DNA methylase Mod	Replication, recombination and repair [L]	0.94
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	0.94
COG2079	2-methylcitrate dehydratase PrpD	Carbohydrate transport and metabolism [G]	0.94
COG1041	tRNA G10 N-methylase Trm11	Translation, ribosomal structure and biogenesis [J]	0.94
COG0863	DNA modification methylase	Replication, recombination and repair [L]	0.94
COG0715	ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.94
COG0154	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase	Translation, ribosomal structure and biogenesis [J]	0.94

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	93.40 %
Unclassified	root	N/A	5.66 %
Polyangium	genus	Polyangium	0.94 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	93.40 %
Unclassified	root	N/A	5.66 %
Polyangium aurulentum	species	Polyangium → Polyangium aurulentum	0.94 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	93.40 %
Unclassified	root	N/A	5.66 %
Polyangium aurulentum	species	Polyangium → Polyangium aurulentum	0.94 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	34.91 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	14.15 %
Unclassified	root	N/A	5.66 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	2.83 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.94 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.94 %
Polyangium aurulentum	species	Polyangium → Polyangium aurulentum	0.94 %

Name	Rank	Taxonomy	Distribution
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	14.15 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	14.15 %
Unclassified	root	N/A	5.66 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	3.77 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	2.83 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1.89 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.94 %
Candidatus Omnitrophica	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica	0.94 %
Polyangium aurulentum	species	Polyangium → Polyangium aurulentum	0.94 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	14.15 %
Unclassified	root	N/A	5.66 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	3.77 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.83 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1.89 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1.89 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.94 %
unclassified Candidatus Omnitrophica	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → unclassified Candidatus Omnitrophica	0.94 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.94 %
Polyangium aurulentum	species	Polyangium → Polyangium aurulentum	0.94 %

Name	Rank	Taxonomy	Distribution
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	9.43 %
Unclassified	root	N/A	5.66 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.83 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	1.89 %
unclassified Rhodospirillales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales	1.89 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1.89 %
Omnitrophica WOR_2 bacterium GWF2_63_9	species	All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → unclassified Candidatus Omnitrophica → Omnitrophica WOR_2 bacterium GWF2_63_9	0.94 %
Desulfovibrionales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales	0.94 %
Phyllobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae	0.94 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.94 %
Polyangium aurulentum	species	Polyangium → Polyangium aurulentum	0.94 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	9.43 %
Unclassified	root	N/A	5.66 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.83 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.89 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1.89 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	0.94 %
Desulfonatronaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfonatronaceae	0.94 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.94 %
Omnitrophica WOR_2 bacterium GWF2_63_9	species	All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → unclassified Candidatus Omnitrophica → Omnitrophica WOR_2 bacterium GWF2_63_9	0.94 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.94 %
Polyangium aurulentum	species	Polyangium → Polyangium aurulentum	0.94 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	9.43 %
Unclassified	root	N/A	5.66 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.83 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.89 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1.89 %
unclassified Mesorhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium	0.94 %
Desulfonatronum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfonatronaceae → Desulfonatronum	0.94 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	0.94 %
Omnitrophica WOR_2 bacterium GWF2_63_9	species	All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → unclassified Candidatus Omnitrophica → Omnitrophica WOR_2 bacterium GWF2_63_9	0.94 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.94 %
Polyangium aurulentum	species	Polyangium → Polyangium aurulentum	0.94 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	9.43 %
Unclassified	root	N/A	5.66 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.83 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.89 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1.89 %
Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1	0.94 %
Desulfonatronum lacustre	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfonatronaceae → Desulfonatronum → Desulfonatronum lacustre	0.94 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	0.94 %
Omnitrophica WOR_2 bacterium GWF2_63_9	species	All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → unclassified Candidatus Omnitrophica → Omnitrophica WOR_2 bacterium GWF2_63_9	0.94 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.94 %
Polyangium aurulentum	species	Polyangium → Polyangium aurulentum	0.94 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000364\|INPhiseqgaiiFebDRAFT_100769682	All Organisms → cellular organisms → Bacteria	1001	Open in IMG/M
3300000891\|JGI10214J12806_11507570	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	581	Open in IMG/M
3300000956\|JGI10216J12902_118146145	All Organisms → cellular organisms → Bacteria	509	Open in IMG/M
3300002911\|JGI25390J43892_10061174	All Organisms → cellular organisms → Bacteria	878	Open in IMG/M
3300004643\|Ga0062591_102707423	All Organisms → cellular organisms → Bacteria	524	Open in IMG/M
3300005172\|Ga0066683_10029027	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	3171	Open in IMG/M
3300005330\|Ga0070690_100291159	All Organisms → cellular organisms → Bacteria	1168	Open in IMG/M
3300005353\|Ga0070669_100143663	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1842	Open in IMG/M
3300005445\|Ga0070708_101780019	All Organisms → cellular organisms → Bacteria → Proteobacteria	572	Open in IMG/M
3300005536\|Ga0070697_101395380	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	625	Open in IMG/M
3300005552\|Ga0066701_10607634	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	665	Open in IMG/M
3300005553\|Ga0066695_10873392	All Organisms → cellular organisms → Bacteria → Proteobacteria	515	Open in IMG/M
3300005559\|Ga0066700_11088503	All Organisms → cellular organisms → Bacteria	523	Open in IMG/M
3300005568\|Ga0066703_10170795	All Organisms → cellular organisms → Bacteria → Proteobacteria	1312	Open in IMG/M
3300005617\|Ga0068859_100886943	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	977	Open in IMG/M
3300005617\|Ga0068859_100931639	All Organisms → cellular organisms → Bacteria	953	Open in IMG/M
3300005713\|Ga0066905_101243872	All Organisms → cellular organisms → Bacteria → Proteobacteria	667	Open in IMG/M
3300006797\|Ga0066659_11901206	All Organisms → cellular organisms → Bacteria	505	Open in IMG/M
3300006845\|Ga0075421_100851876	All Organisms → cellular organisms → Bacteria → Proteobacteria	1044	Open in IMG/M
3300006853\|Ga0075420_100255220	All Organisms → cellular organisms → Bacteria → Proteobacteria	1524	Open in IMG/M
3300006871\|Ga0075434_100069103	All Organisms → cellular organisms → Bacteria	3521	Open in IMG/M
3300006904\|Ga0075424_100888167	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	951	Open in IMG/M
3300006914\|Ga0075436_101273290	All Organisms → cellular organisms → Bacteria	556	Open in IMG/M
3300006969\|Ga0075419_10492262	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	851	Open in IMG/M
3300009089\|Ga0099828_10433552	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1185	Open in IMG/M
3300009089\|Ga0099828_10497334	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfonatronaceae → Desulfonatronum → Desulfonatronum lacustre	1099	Open in IMG/M
3300009100\|Ga0075418_11276136	All Organisms → cellular organisms → Bacteria → Proteobacteria	796	Open in IMG/M
3300009100\|Ga0075418_12275578	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	591	Open in IMG/M
3300009100\|Ga0075418_12993025	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	515	Open in IMG/M
3300009147\|Ga0114129_12394534	All Organisms → cellular organisms → Bacteria	632	Open in IMG/M
3300009147\|Ga0114129_13210228	All Organisms → cellular organisms → Bacteria	531	Open in IMG/M
3300009157\|Ga0105092_10238294	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1021	Open in IMG/M
3300009795\|Ga0105059_1062804	Not Available	519	Open in IMG/M
3300009813\|Ga0105057_1100691	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	534	Open in IMG/M
3300010046\|Ga0126384_11660623	All Organisms → cellular organisms → Bacteria	603	Open in IMG/M
3300010046\|Ga0126384_11982623	All Organisms → cellular organisms → Bacteria → Proteobacteria	556	Open in IMG/M
3300010047\|Ga0126382_10351699	All Organisms → cellular organisms → Bacteria	1129	Open in IMG/M
3300010304\|Ga0134088_10026188	All Organisms → cellular organisms → Bacteria	2611	Open in IMG/M
3300010336\|Ga0134071_10156320	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1111	Open in IMG/M
3300010337\|Ga0134062_10519976	All Organisms → cellular organisms → Bacteria	601	Open in IMG/M
3300010337\|Ga0134062_10692609	All Organisms → cellular organisms → Bacteria	534	Open in IMG/M
3300010358\|Ga0126370_11707440	All Organisms → cellular organisms → Bacteria → Proteobacteria	606	Open in IMG/M
3300010362\|Ga0126377_13590683	All Organisms → cellular organisms → Bacteria	502	Open in IMG/M
3300010366\|Ga0126379_12379803	All Organisms → cellular organisms → Bacteria	629	Open in IMG/M
3300010366\|Ga0126379_13254861	All Organisms → cellular organisms → Bacteria	544	Open in IMG/M
3300010391\|Ga0136847_11042702	All Organisms → cellular organisms → Bacteria → Proteobacteria	1000	Open in IMG/M
3300012180\|Ga0153974_1174136	All Organisms → cellular organisms → Bacteria	513	Open in IMG/M
3300012189\|Ga0137388_10741972	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	911	Open in IMG/M
3300012203\|Ga0137399_11649403	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	529	Open in IMG/M
3300012205\|Ga0137362_10374282	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1234	Open in IMG/M
3300012209\|Ga0137379_10442275	All Organisms → cellular organisms → Bacteria	1209	Open in IMG/M
3300012211\|Ga0137377_11515366	All Organisms → cellular organisms → Bacteria	596	Open in IMG/M
3300012350\|Ga0137372_10415573	Not Available	1016	Open in IMG/M
3300012351\|Ga0137386_10887790	All Organisms → cellular organisms → Bacteria	639	Open in IMG/M
3300012355\|Ga0137369_10327333	All Organisms → cellular organisms → Bacteria → Proteobacteria	1127	Open in IMG/M
3300012361\|Ga0137360_10596563	All Organisms → cellular organisms → Bacteria	945	Open in IMG/M
3300012362\|Ga0137361_11754687	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	539	Open in IMG/M
3300012486\|Ga0157331_1039268	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	505	Open in IMG/M
3300012918\|Ga0137396_11044346	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	588	Open in IMG/M
3300012918\|Ga0137396_11235774	All Organisms → cellular organisms → Bacteria	524	Open in IMG/M
3300012930\|Ga0137407_10146949	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2079	Open in IMG/M
3300012930\|Ga0137407_12005060	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	552	Open in IMG/M
3300012944\|Ga0137410_10041464	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3251	Open in IMG/M
3300012971\|Ga0126369_11810874	All Organisms → cellular organisms → Bacteria	699	Open in IMG/M
3300012971\|Ga0126369_13404310	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1	521	Open in IMG/M
3300012976\|Ga0134076_10222863	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	797	Open in IMG/M
3300014154\|Ga0134075_10157833	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	970	Open in IMG/M
3300014154\|Ga0134075_10466194	All Organisms → cellular organisms → Bacteria	563	Open in IMG/M
3300014881\|Ga0180094_1079677	Not Available	734	Open in IMG/M
3300017654\|Ga0134069_1332923	All Organisms → cellular organisms → Bacteria	544	Open in IMG/M
3300018053\|Ga0184626_10079241	All Organisms → cellular organisms → Bacteria	1387	Open in IMG/M
3300018078\|Ga0184612_10259595	All Organisms → cellular organisms → Bacteria	896	Open in IMG/M
3300018079\|Ga0184627_10040292	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2391	Open in IMG/M
3300018079\|Ga0184627_10274230	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	886	Open in IMG/M
3300018422\|Ga0190265_10072917	All Organisms → cellular organisms → Bacteria → Proteobacteria	3108	Open in IMG/M
3300018431\|Ga0066655_10082191	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1758	Open in IMG/M
3300018431\|Ga0066655_10486710	All Organisms → cellular organisms → Bacteria	816	Open in IMG/M
3300020063\|Ga0180118_1162294	Not Available	513	Open in IMG/M
3300021081\|Ga0210379_10327366	All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → unclassified Candidatus Omnitrophica → Omnitrophica WOR_2 bacterium GWF2_63_9	672	Open in IMG/M
3300021090\|Ga0210377_10795040	All Organisms → cellular organisms → Bacteria	511	Open in IMG/M
3300025173\|Ga0209824_10148731	Not Available	844	Open in IMG/M
3300025922\|Ga0207646_10282767	All Organisms → cellular organisms → Bacteria	1499	Open in IMG/M
3300026075\|Ga0207708_10247091	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1437	Open in IMG/M
3300026285\|Ga0209438_1136608	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	654	Open in IMG/M
3300026301\|Ga0209238_1111855	All Organisms → cellular organisms → Bacteria	912	Open in IMG/M
3300026324\|Ga0209470_1027271	All Organisms → cellular organisms → Bacteria → Proteobacteria	2980	Open in IMG/M
3300026326\|Ga0209801_1032855	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2445	Open in IMG/M
3300026530\|Ga0209807_1116474	All Organisms → cellular organisms → Bacteria	1110	Open in IMG/M
3300026540\|Ga0209376_1366052	Not Available	542	Open in IMG/M
3300027903\|Ga0209488_10867428	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	635	Open in IMG/M
3300027957\|Ga0209857_1083848	All Organisms → cellular organisms → Bacteria	537	Open in IMG/M
3300031720\|Ga0307469_10398982	All Organisms → cellular organisms → Bacteria	1173	Open in IMG/M
3300031720\|Ga0307469_10401798	Polyangium → Polyangium aurulentum	1170	Open in IMG/M
3300031720\|Ga0307469_11841305	All Organisms → cellular organisms → Bacteria → Proteobacteria	585	Open in IMG/M
3300031720\|Ga0307469_11848061	All Organisms → cellular organisms → Bacteria	584	Open in IMG/M
3300031768\|Ga0318509_10095569	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1596	Open in IMG/M
3300031820\|Ga0307473_10117691	All Organisms → cellular organisms → Bacteria → Proteobacteria	1451	Open in IMG/M
3300031859\|Ga0318527_10158320	All Organisms → cellular organisms → Bacteria	952	Open in IMG/M
3300031949\|Ga0214473_11461548	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	692	Open in IMG/M
3300032001\|Ga0306922_11538391	All Organisms → cellular organisms → Bacteria	664	Open in IMG/M
3300032005\|Ga0307411_10703915	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	880	Open in IMG/M
3300032075\|Ga0310890_10039482	All Organisms → cellular organisms → Bacteria	2619	Open in IMG/M
3300032180\|Ga0307471_100834547	All Organisms → cellular organisms → Bacteria → Proteobacteria	1089	Open in IMG/M
3300032180\|Ga0307471_101498260	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	833	Open in IMG/M
3300032205\|Ga0307472_100612448	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	963	Open in IMG/M
3300034668\|Ga0314793_021782	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales	1010	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	84.91%
Host-Associated	Host-Associated	15.09%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	74.53%
Plants	Host-Associated → Plants	14.15%
Aquatic	Environmental → Aquatic	10.38%
Fungi	Host-Associated → Fungi	0.94%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	74.53%
Rhizosphere	Host-Associated → Plants → Rhizosphere	12.26%
Freshwater	Environmental → Aquatic → Freshwater	5.66%
Sediment	Environmental → Aquatic → Sediment	4.72%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.89%
Mycelium	Host-Associated → Fungi → Mycelium	0.94%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	66.04%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	11.32%
Loam	Environmental → Terrestrial → Soil → Loam	5.66%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	4.72%
Sediment	Environmental → Aquatic → Freshwater → Sediment	3.77%
Sand	Environmental → Terrestrial → Soil → Sand	2.83%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.89%
Lake	Environmental → Aquatic → Freshwater → Lake	0.94%
Drinking Water	Environmental → Aquatic → Freshwater → Drinking Water	0.94%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.94%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified	0.94%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	34.91%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	16.98%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	11.32%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	10.38%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	4.72%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.72%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	3.77%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	2.83%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.89%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.89%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.94%
Unchlorinated	Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated	0.94%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.94%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	0.94%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.94%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.94%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified	0.94%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	16.98%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	12.26%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	10.38%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	8.49%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	7.55%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	7.55%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	4.72%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	3.77%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.77%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	2.83%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	2.83%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.89%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.94%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment	0.94%
Wastewater	Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater	0.94%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.94%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.94%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.94%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	0.94%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.94%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.94%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.94%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.94%
Attine Ant Fungus Gardens	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens	0.94%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000891	Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300002911	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm	Environmental	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300005172	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132	Environmental	Open in IMG/M
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Host-Associated	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental	Open in IMG/M
3300005553	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144	Environmental	Open in IMG/M
3300005559	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149	Environmental	Open in IMG/M
3300005568	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152	Environmental	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006853	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009157	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015	Environmental	Open in IMG/M
3300009795	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50	Environmental	Open in IMG/M
3300009813	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010304	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015	Environmental	Open in IMG/M
3300010336	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015	Environmental	Open in IMG/M
3300010337	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010391	Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406	Environmental	Open in IMG/M
3300012180	Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaG	Host-Associated	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012350	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG	Environmental	Open in IMG/M
3300012351	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG	Environmental	Open in IMG/M
3300012355	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG	Environmental	Open in IMG/M
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012486	Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.120510	Environmental	Open in IMG/M
3300012918	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012976	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG	Environmental	Open in IMG/M
3300014154	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015	Environmental	Open in IMG/M
3300014881	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1Da	Environmental	Open in IMG/M
3300017654	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG	Environmental	Open in IMG/M
3300018053	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1	Environmental	Open in IMG/M
3300018078	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex	Environmental	Open in IMG/M
3300018079	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1	Environmental	Open in IMG/M
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental	Open in IMG/M
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental	Open in IMG/M
3300020063	Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo	Environmental	Open in IMG/M
3300021090	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo	Environmental	Open in IMG/M
3300025173	Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water (SPAdes)	Environmental	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300026285	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)	Environmental	Open in IMG/M
3300026301	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026324	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)	Environmental	Open in IMG/M
3300026326	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)	Environmental	Open in IMG/M
3300026530	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)	Environmental	Open in IMG/M
3300026540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)	Environmental	Open in IMG/M
3300027903	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)	Environmental	Open in IMG/M
3300027957	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes)	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031768	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22	Environmental	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300031859	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25	Environmental	Open in IMG/M
3300031949	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197	Environmental	Open in IMG/M
3300032001	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)	Environmental	Open in IMG/M
3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Host-Associated	Open in IMG/M
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300034668	Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.15
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.15
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F093552

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
INPhiseqgaiiFebDRAFT_1007696821	3300000364	Soil	LAFIWGVGPTVEEPGINLIRSFAYSAPLEDLKLKKP*
JGI10214J12806_115075702	3300000891	Soil	IYELAFIWGVGPRVEEPGINLIRSFAYSGPLEDLKLKRP*
JGI10216J12902_1181461451	3300000956	Soil	YELAFIWGVGPRLEEPGINLIRSFAYSAPLEDLRLKRP*
JGI25390J43892_100611742	3300002911	Grasslands Soil	RPSSTRVTHIPIYELAFIWGVGPRVEEPGINQIRSFSYSGPLEDLRVKRP*
Ga0062591_1027074232	3300004643	Soil	PLYELAFIWGVGPTVEEPGINLVRSFAYSAPLEDIKLKKP*
Ga0066683_100290276	3300005172	Soil	VTHIPIYELAFIWGVGPRVEEPGINQIRSFSYSGPLEDLRVKRP*
Ga0070690_1002911593	3300005330	Switchgrass Rhizosphere	THIPIYELAFIWGVGPRLEEPGINLIRSFAYSAPLEDLRLKRP*
Ga0070669_1001436631	3300005353	Switchgrass Rhizosphere	YVPIYELAFIWGVGPTVEEPGINLIRSFAYSAPLEDLKLKKP*
Ga0070708_1017800192	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	IPIYELAFIWGVSPRVEEPGVNLIRSFAYSGPLEDLRVKK*
Ga0070697_1013953801	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	RVTHIPIYELAFIWGVHPRVEEPGVNLIRSFAYSGPVEDVRLKRQ*
Ga0066701_106076341	3300005552	Soil	LAFIWGVGPRVEEPGVNLIKSFAYSAPLEDLRLKRP*
Ga0066695_108733921	3300005553	Soil	YELAFIWGVGPRVEESGAWLIPGYAYSAPAEDLKLKK*
Ga0066700_110885031	3300005559	Soil	FIWGVGPRVEEPGINLIRGFAYSAPLEDVKLKRP*
Ga0066703_101707951	3300005568	Soil	HIPIYELAFIWGVGPRVEEPGINQIRSFSYSGPLEDLRVKRP*
Ga0068859_1008869431	3300005617	Switchgrass Rhizosphere	FTWGIGPRLEEPGISLIRGYAYSAPYEDLKLKKP*
Ga0068859_1009316392	3300005617	Switchgrass Rhizosphere	AFIWGVGPRLEEPGINLIRSFAYSAPLEDLRLKRP*
Ga0066905_1012438722	3300005713	Tropical Forest Soil	LAFIWGVGPRVEEPGINLVRSFAYSAPLEDVKLKRP*
Ga0066659_119012061	3300006797	Soil	AFIWGVNPRVEEPGINLIRSYSYSAPYEDLKLKRP*
Ga0075421_1008518762	3300006845	Populus Rhizosphere	FIWGVGPRVEESGANLIPGFAYSAPFEDLKLKKP*
Ga0075420_1002552203	3300006853	Populus Rhizosphere	HIPIYELAFIWGVGPTVEEPGINLIRSFAYSGPLEDLKLKRP*
Ga0075434_1000691034	3300006871	Populus Rhizosphere	VPIYELAFIWGVGPSVAEPGINLIRSFAYSGPLEDVRLKGR*
Ga0075424_1008881671	3300006904	Populus Rhizosphere	YELAFIWGVGPRVEEPGINLIRSFAYSGPLEDLRLKRP*
Ga0075436_1012732902	3300006914	Populus Rhizosphere	AFTWGIGPRLEEPGISLIKGYAYSAPYEDMKLKRP*
Ga0075419_104922622	3300006969	Populus Rhizosphere	PIYELAFIWGVGPSVDEPGINLIRSFAYSGPLEDVRLKRR*
Ga0099828_104335522	3300009089	Vadose Zone Soil	LHDRMIQIPIYELAFIWGVSPRVDEPGINLIRSFAYSGPLEDVKIKRP*
Ga0099828_104973341	3300009089	Vadose Zone Soil	FIWGVGPRVEEPGVNLIKSFAYSAPLEDLRLKRP*
Ga0075418_112761362	3300009100	Populus Rhizosphere	YDRVTHIPIYELAFIWGVGPTVEEPGINLIRSFAYSGPLEDLKLKRP*
Ga0075418_122755782	3300009100	Populus Rhizosphere	AFTWGIGPRLEEPGISLIRGYAYSAPYEDLRLKKP*
Ga0075418_129930252	3300009100	Populus Rhizosphere	LYDRVMYVPIYELAFIWGVGPTVDEPGINLIRSFAYSGPLEDVKLKKP*
Ga0114129_123945342	3300009147	Populus Rhizosphere	VTHIPIYELGLIWGVGPRVEEPGINLVRSFAYSAPLEDVKLNRP*
Ga0114129_132102282	3300009147	Populus Rhizosphere	VIQIPIYELAFIWGVGPRVEEPGISLIRSFASSGPLEDVRIKRP*
Ga0105092_102382943	3300009157	Freshwater Sediment	IYELAFIWGVGPRLEEPGINLIRSFAYSGPLEDLRLKRP*
Ga0105059_10628042	3300009795	Groundwater Sand	YDRMTHIPIYELAFIWSVGPRVQEPGINLVRSFAYSAPLEDVRLKRP*
Ga0105057_11006911	3300009813	Groundwater Sand	ELGFIWGVGPRVEDPGVNLIRAFAYSGPLEDVKLKRP*
Ga0126384_116606231	3300010046	Tropical Forest Soil	FIWGVGPRAEEPGVNLIRSFAYSGPLEDLRLKRP*
Ga0126384_119826232	3300010046	Tropical Forest Soil	VTHIPIYELAFIWGVGPRAEEPGINLIRSFAYSGPLEDLRIKK*
Ga0126382_103516991	3300010047	Tropical Forest Soil	LYELAFIWGVSPRVEEPGINLIRSFAYSAPLEEVRFKRP*
Ga0134088_100261883	3300010304	Grasslands Soil	FTWGIGPRLEEPGISLIRGYAYSAPYEDLKLKRP*
Ga0134071_101563201	3300010336	Grasslands Soil	SAFLWAIGPRVEEPGLSLIPSHAYSAPYEDVKLKRP*
Ga0134062_105199761	3300010337	Grasslands Soil	LAFIWGVGPRVEEPGINLIRSFAYSGPLEDVKVKRP*
Ga0134062_106926091	3300010337	Grasslands Soil	VTHIPIYELAFIWGVGPRVEEPGINQLRSFSYSGPLEDLRVKRP*
Ga0126370_117074402	3300010358	Tropical Forest Soil	IYELAFIWGVGPRVEEPGINLIRSFAYSGPLEDLRIKK*
Ga0126377_135906832	3300010362	Tropical Forest Soil	FTWGVSPRVEEPGINLIRSYAYSAPYEDLRLKHP*
Ga0126379_123798032	3300010366	Tropical Forest Soil	FIWGVSPRVEEPGINLIRSYAYSAPYEDLRLKRP*
Ga0126379_132548612	3300010366	Tropical Forest Soil	IQIPIYELAFIWGVSPRVEEPGINLIRSFAYSGPLEDVRIKRP*
Ga0136847_110427022	3300010391	Freshwater Sediment	AFIWGVGPRVEEAGAGLIPGFAYSAPFEDLKVRK*
Ga0153974_11741361	3300012180	Attine Ant Fungus Gardens	LAFIWGVSPRVEEPGINLIRSHAYSAPYEDLRLKRP*
Ga0137388_107419723	3300012189	Vadose Zone Soil	LAFIWGVGPRVEEPGVNLIRSFAYSGPLEDVKLKQP*
Ga0137399_116494032	3300012203	Vadose Zone Soil	LAFTWGIGPRLEEPGISLIRGYAYSAPYEDLKLKKP*
Ga0137362_103742821	3300012205	Vadose Zone Soil	MIQIPIYELAFIWGVSPRVEEPGINLIRSFAYSGPLEDVKIKRP*
Ga0137379_104422754	3300012209	Vadose Zone Soil	YELAFIWGVGPRVEEPGINLIRSFAYSGPLEDVRVKRP*
Ga0137377_115153661	3300012211	Vadose Zone Soil	DHPPRGVTHIPIYELAFIWGVGPRVEEPGINQIRSFSYSGPLEDLRVKRP*
Ga0137372_104155731	3300012350	Vadose Zone Soil	ELAFIWGVGPRVEEPGVNLIRSFAYSGPLEDVKLKRP*
Ga0137386_108877902	3300012351	Vadose Zone Soil	LAFIWGVSPRVEEPGINLIRSYAYSAPYEDLRLKRP*
Ga0137369_103273332	3300012355	Vadose Zone Soil	VTHIPIYELAFIWGVGPTVDESGINLIRSFAYSGPLEDLRLKRP*
Ga0137360_105965631	3300012361	Vadose Zone Soil	IYDLAFIWGVGPRVEEPGINLVRSFAYSAPLEDVKLKRP*
Ga0137361_117546872	3300012362	Vadose Zone Soil	LHDRMIQIPIYELAFIWGVNPRVEEPGINLIRSFAYSGPLEDVKIKRP*
Ga0157331_10392682	3300012486	Soil	MHVPIYELAFTWGIGPRVEEPGINIIKGFAYSGPLEDLKLKKQ*
Ga0137396_110443462	3300012918	Vadose Zone Soil	LAFIWGVGPRVEEPGINLIRSYAYSAPLEDLRLKRP*
Ga0137396_112357742	3300012918	Vadose Zone Soil	YELAFIWGVGPSVDEPGVNLIRSYAYSAPLEDLRLKRP*
Ga0137407_101469493	3300012930	Vadose Zone Soil	IPIYELAFIWGVGPTVDEPGVNLIRSFAYSGPLEDVRLKRP*
Ga0137407_120050602	3300012930	Vadose Zone Soil	AFIWGVGPRVQEPCAGLIAGFPYSAPLEDVTLKK*
Ga0137410_100414644	3300012944	Vadose Zone Soil	RVTHVPIYELAFIWGVGPTVEEPGINLIRSFAYSGPLEELRLKRR*
Ga0126369_118108741	3300012971	Tropical Forest Soil	HDRMIQIPIYELAFIWGVSPRVEEPGINLIRSFAYSGPLEDVKIKRP*
Ga0126369_134043103	3300012971	Tropical Forest Soil	YELAFIWGVSPRVEEPGINLIRSYSYSAPYEDLRLKRP*
Ga0134076_102228632	3300012976	Grasslands Soil	THIPIYELAFIWGVGPRVEEPGINLNRSFAYSGPLEDVRVKRP*
Ga0134075_101578331	3300014154	Grasslands Soil	LAFTWGIGPRLEEPGISLIRGYAYSAPYEDLKLKRP*
Ga0134075_104661941	3300014154	Grasslands Soil	GVTHIPIYELAFIWGVGPRVEEPGINQIRSFSYSGPLEDLRVKRP*
Ga0180094_10796771	3300014881	Soil	MTIWGVGPRVEESGANLIPGFAYSAPFEDLQLRK*
Ga0134069_13329231	3300017654	Grasslands Soil	IYELAFIWGVGPTVAEPGINLIRSFAYSGPLEDVRLKGR
Ga0184626_100792413	3300018053	Groundwater Sediment	YDRVTHIPIYELAFIWGVGPTVDEPGVNLIRSFAYSGPLEDLRLKRP
Ga0184612_102595951	3300018078	Groundwater Sediment	HIPIYELAFIWGVGPTVDEPGVNLIRSFAYSGPLEDLRLKRP
Ga0184627_100402925	3300018079	Groundwater Sediment	VTQIPIYELAFIWGVGSRVEEPGVNLVRSFAYSAPLEDLRLKRP
Ga0184627_102742302	3300018079	Groundwater Sediment	LAFIWGVGPRVEEPGVNLIRSYAYSGPLEDLRLKRP
Ga0190265_100729173	3300018422	Soil	VTHIPIYELAFIWGVGPTVEEPGINLIRSFAYSGPLEDLRLKKP
Ga0066655_100821913	3300018431	Grasslands Soil	ELAFTWGIGPRLEEPGISLIRGYAYSAPYEDLKLKRP
Ga0066655_104867102	3300018431	Grasslands Soil	VTHIPIYELAFIWGVGPRVEEPGINQIRSFSYSGPLEDLRVKRP
Ga0180118_11622941	3300020063	Groundwater Sediment	IYELAFIWGVSPRVEEPGVNLIRSFAYSAPLEDLRLKRP
Ga0210379_103273662	3300021081	Groundwater Sediment	AFIWGVGPRVDEPGINLVRSFAYSAPLEDLRLKRP
Ga0210377_107950402	3300021090	Groundwater Sediment	THIPIYELAFIWGVGPTVDEPGVNLIRSFAYSAPLEDLRLKRP
Ga0209824_101487312	3300025173	Wastewater	MERAVLTHIPLYELAFIWGVGPGVEEPGINLIRSFAYSGPLEDVKLKRP
Ga0207646_102827673	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	LYELAFIWGVGPRVEEPGINLIRSFAYSGPLEDLRLKRP
Ga0207708_102470911	3300026075	Corn, Switchgrass And Miscanthus Rhizosphere	LAFIWGVGPRVEEPGINLIRSYAYSAPLEDLRIKK
Ga0209438_11366082	3300026285	Grasslands Soil	ELAFIWGVGPRVEEPGINLIRSYAYSAPLEDLRIKK
Ga0209238_11118552	3300026301	Grasslands Soil	VTHIPIYELAFIWGVGPRVEEPGINQILSFSYSGPLEDLRVKRP
Ga0209470_10272711	3300026324	Soil	LGFIWGVGPRVEEPGINLIRGFAYSAPLEDVKLKRP
Ga0209801_10328551	3300026326	Soil	PDHPPRGVTHIPIYELAFIWGVGPRVEEPGINQIRSFSYSGPLEDLRVKRP
Ga0209807_11164742	3300026530	Soil	ELGFIWGVGPRVEEPGINLIRGFAYSAPLEDVKLKRP
Ga0209376_13660521	3300026540	Soil	AFIWGVGPRVDEPGINLVRSFAYSAPLEDMKLKRP
Ga0209488_108674282	3300027903	Vadose Zone Soil	LAFIWGVGPRVEEPGINLIRSFAYSGPLEDVRIKRP
Ga0209857_10838481	3300027957	Groundwater Sand	YELAFIWGVGPRVEEPGINLIRSFAYSGPLEDVKLKRP
Ga0307469_103989821	3300031720	Hardwood Forest Soil	LAFIWGVGPRVEEPGVNLIRSFAYSGPLEDVKLKKP
Ga0307469_104017981	3300031720	Hardwood Forest Soil	PIYELAFIWGVGPSVEEPGINLVRSFAYSAPLEDIKLKKP
Ga0307469_118413052	3300031720	Hardwood Forest Soil	IYELAFIWGVGPRVEEPGINLVRSFAYSAPLEDVKLKRP
Ga0307469_118480613	3300031720	Hardwood Forest Soil	ELAFIWGVGPTVAEPGINLIRSFAYSGPLEDVRLKGR
Ga0318509_100955691	3300031768	Soil	AFIWGVGPRVEEPGINLIRSFAYSGPLEDVRIKRP
Ga0307473_101176913	3300031820	Hardwood Forest Soil	THIPIYELAFIWGVGSRVEEPGINLVRSFAYSAPLEDVKLKRP
Ga0318527_101583201	3300031859	Soil	SFIWGVSPRVEEPGINLIRSYAYSAPYEDLRLKRP
Ga0214473_114615481	3300031949	Soil	RVTQIPIYELGFIWGVGPRAEEPGINLIRSYAYSAPLEDLKLKKP
Ga0306922_115383911	3300032001	Soil	YENAFIWGVGPRVEEPGINLVRGYAYSAPYEELRLRRP
Ga0307411_107039152	3300032005	Rhizosphere	RVTHIPIYELAFIWGVGPTVEEPGINLIRSFAYSGPLEDLRLKKP
Ga0310890_100394821	3300032075	Soil	IPIYELAFIWGVGPTVEEPGINLIRSFAYSGPLEDLRLKRP
Ga0307471_1008345472	3300032180	Hardwood Forest Soil	PIYELAFIWGVGPSVEEPGINLIRSFAYSAPLEDLKLKKP
Ga0307471_1014982601	3300032180	Hardwood Forest Soil	VPIYELAFIWGVGPTVAEPGINLIRSFAYSGPLEDVRLKGR
Ga0307472_1006124481	3300032205	Hardwood Forest Soil	VTHVPIYELAFIWGVGPTVAEPGINLIRSFAYSGPLEDVRLKGR
Ga0314793_021782_570_704	3300034668	Soil	VTHIPIYELAFIWGVGPTVEEPGINLIRSFAYSGPLEDLRLKRP

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign