NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F093541

Metagenome / Metatranscriptome Family F093541

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F093541
Family Type Metagenome / Metatranscriptome
Number of Sequences 106
Average Sequence Length 54 residues
Representative Sequence NYNFAKERCDREWTKALELMNFYDLYQDAPNGPTTKLEENWTADVDYFNGDRRYF
Number of Associated Samples 96
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.95 %
% of genes near scaffold ends (potentially truncated) 91.51 %
% of genes from short scaffolds (< 2000 bps) 83.96 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (61.321 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(18.868 % of family members)
Environment Ontology (ENVO) Unclassified
(50.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(46.226 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 43.37%    β-sheet: 0.00%    Coil/Unstructured: 56.63%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF09718Tape_meas_lam_C 6.60
PF07460NUMOD3 2.83
PF00210Ferritin 0.94



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A61.32 %
All OrganismsrootAll Organisms38.68 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001282|B570J14230_10192257Not Available566Open in IMG/M
3300001849|RCM26_1080764Not Available506Open in IMG/M
3300001850|RCM37_1107219All Organisms → Viruses → Predicted Viral1200Open in IMG/M
3300001952|GOS2224_1006116All Organisms → Viruses → Predicted Viral1406Open in IMG/M
3300003375|JGI26470J50227_1007643All Organisms → Viruses → Predicted Viral2846Open in IMG/M
3300004481|Ga0069718_10892358All Organisms → Viruses → Predicted Viral1679Open in IMG/M
3300004685|Ga0065177_1042053All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage860Open in IMG/M
3300004694|Ga0065170_1042574Not Available608Open in IMG/M
3300004770|Ga0007804_1137823Not Available614Open in IMG/M
3300004774|Ga0007794_10114997All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage803Open in IMG/M
3300004774|Ga0007794_10164146Not Available663Open in IMG/M
3300004804|Ga0007796_10211691Not Available568Open in IMG/M
3300004805|Ga0007792_10081065All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage987Open in IMG/M
3300004805|Ga0007792_10165261Not Available680Open in IMG/M
3300005590|Ga0070727_10767934Not Available541Open in IMG/M
3300005805|Ga0079957_1175891All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1059Open in IMG/M
3300006072|Ga0007881_1127496Not Available627Open in IMG/M
3300006108|Ga0007862_1049751Not Available857Open in IMG/M
3300006109|Ga0007870_1092204Not Available589Open in IMG/M
3300006129|Ga0007834_1112520Not Available568Open in IMG/M
3300006802|Ga0070749_10015585All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4839Open in IMG/M
3300006805|Ga0075464_10929119Not Available544Open in IMG/M
3300006868|Ga0075481_10359217Not Available502Open in IMG/M
3300006919|Ga0070746_10229987Not Available872Open in IMG/M
3300007169|Ga0102976_1069602All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5887Open in IMG/M
3300007345|Ga0070752_1005772All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7145Open in IMG/M
3300007542|Ga0099846_1149424All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage841Open in IMG/M
3300007542|Ga0099846_1219011Not Available667Open in IMG/M
3300007559|Ga0102828_1002781All Organisms → Viruses → Predicted Viral3223Open in IMG/M
3300007640|Ga0070751_1199463Not Available778Open in IMG/M
3300007960|Ga0099850_1138137Not Available987Open in IMG/M
3300008107|Ga0114340_1206669Not Available651Open in IMG/M
3300008107|Ga0114340_1206939Not Available651Open in IMG/M
3300008114|Ga0114347_1090240All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1771Open in IMG/M
3300008262|Ga0114337_1270928Not Available632Open in IMG/M
3300009068|Ga0114973_10482032Not Available644Open in IMG/M
3300009081|Ga0105098_10406458Not Available677Open in IMG/M
3300009149|Ga0114918_10022051All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4737Open in IMG/M
3300009159|Ga0114978_10426780Not Available789Open in IMG/M
3300010316|Ga0136655_1079616All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1000Open in IMG/M
3300010354|Ga0129333_10018811All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6571Open in IMG/M
3300010368|Ga0129324_10188960All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage842Open in IMG/M
3300010370|Ga0129336_10132149All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1450Open in IMG/M
3300010885|Ga0133913_13308526Not Available1060Open in IMG/M
3300012689|Ga0157565_1091353Not Available712Open in IMG/M
3300012700|Ga0157576_1163915Not Available845Open in IMG/M
3300012704|Ga0157574_1068991All Organisms → Viruses → Predicted Viral1147Open in IMG/M
3300012719|Ga0157600_1152229Not Available766Open in IMG/M
3300012970|Ga0129338_1100331Not Available642Open in IMG/M
3300012970|Ga0129338_1350474Not Available732Open in IMG/M
3300012970|Ga0129338_1600093Not Available740Open in IMG/M
3300013093|Ga0164296_1049226Not Available2046Open in IMG/M
3300013094|Ga0164297_10123212All Organisms → Viruses → Predicted Viral1065Open in IMG/M
(restricted) 3300013129|Ga0172364_10915038Not Available537Open in IMG/M
(restricted) 3300013130|Ga0172363_10039333All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3508Open in IMG/M
(restricted) 3300013131|Ga0172373_10568285Not Available682Open in IMG/M
3300017737|Ga0187218_1002470All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5472Open in IMG/M
3300019781|Ga0181360_112146Not Available714Open in IMG/M
3300020562|Ga0208597_1066241Not Available644Open in IMG/M
3300021142|Ga0214192_1069115All Organisms → Viruses → Predicted Viral1035Open in IMG/M
3300021963|Ga0222712_10256562All Organisms → Viruses → Predicted Viral1116Open in IMG/M
3300021963|Ga0222712_10451505Not Available770Open in IMG/M
3300022198|Ga0196905_1100522Not Available772Open in IMG/M
3300024262|Ga0210003_1261246Not Available679Open in IMG/M
3300024262|Ga0210003_1338369Not Available564Open in IMG/M
3300024512|Ga0255186_1001483All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3199Open in IMG/M
3300025379|Ga0208738_1036364Not Available735Open in IMG/M
3300025387|Ga0207959_1030757Not Available854Open in IMG/M
3300025466|Ga0208497_1107380Not Available507Open in IMG/M
3300025470|Ga0208389_1034349All Organisms → Viruses → Predicted Viral1022Open in IMG/M
3300025476|Ga0208495_1026032All Organisms → Viruses → Predicted Viral1079Open in IMG/M
3300025647|Ga0208160_1076661Not Available902Open in IMG/M
3300025653|Ga0208428_1201172Not Available510Open in IMG/M
3300025655|Ga0208795_1041854All Organisms → Viruses → Predicted Viral1390Open in IMG/M
3300025687|Ga0208019_1101442Not Available882Open in IMG/M
3300025889|Ga0208644_1016353All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4819Open in IMG/M
3300027160|Ga0255198_1057572Not Available683Open in IMG/M
3300027192|Ga0208673_1017469Not Available1241Open in IMG/M
3300027193|Ga0208800_1057950Not Available527Open in IMG/M
3300027721|Ga0209492_1328733Not Available505Open in IMG/M
3300027764|Ga0209134_10141653Not Available829Open in IMG/M
3300027764|Ga0209134_10309726Not Available536Open in IMG/M
3300027785|Ga0209246_10026164All Organisms → Viruses → Predicted Viral2203Open in IMG/M
3300027798|Ga0209353_10223060Not Available819Open in IMG/M
(restricted) 3300028044|Ga0247838_1178328Not Available782Open in IMG/M
3300028393|Ga0304728_1190753Not Available717Open in IMG/M
3300031669|Ga0307375_10367465Not Available902Open in IMG/M
3300031857|Ga0315909_10003462All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage19198Open in IMG/M
3300031951|Ga0315904_10027961All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6629Open in IMG/M
3300032118|Ga0315277_11468175Not Available586Open in IMG/M
3300032676|Ga0316229_1370710Not Available506Open in IMG/M
3300033742|Ga0314858_027783All Organisms → Viruses → Predicted Viral1289Open in IMG/M
3300033995|Ga0335003_0402309Not Available586Open in IMG/M
3300034013|Ga0334991_0087607All Organisms → Viruses → Predicted Viral1521Open in IMG/M
3300034020|Ga0335002_0249022All Organisms → Viruses → Predicted Viral1068Open in IMG/M
3300034060|Ga0334983_0317813All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage925Open in IMG/M
3300034082|Ga0335020_0522435Not Available561Open in IMG/M
3300034092|Ga0335010_0437426Not Available705Open in IMG/M
3300034119|Ga0335054_0105359All Organisms → Viruses → Predicted Viral1737Open in IMG/M
3300034120|Ga0335056_0120127All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1593Open in IMG/M
3300034120|Ga0335056_0493264Not Available646Open in IMG/M
3300034122|Ga0335060_0395318Not Available733Open in IMG/M
3300034200|Ga0335065_0024630All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4253Open in IMG/M
3300034279|Ga0335052_0143226All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1414Open in IMG/M
3300034374|Ga0348335_134416Not Available706Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater18.87%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous18.87%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater16.98%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake4.72%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton3.77%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.77%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient3.77%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater2.83%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment2.83%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface2.83%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.83%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.89%
Marine PlanktonEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton1.89%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater1.89%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.89%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.89%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.94%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater0.94%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.94%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.94%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.94%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.94%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.94%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.94%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.94%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001282Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300001849Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM26, ROCA_DNA190_2.0um_MCP-N_C_2bEnvironmentalOpen in IMG/M
3300001850Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2aEnvironmentalOpen in IMG/M
3300001952Marine microbial communities from Newport Harbor, Rhode Island, USA - GS008EnvironmentalOpen in IMG/M
3300003375Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6EnvironmentalOpen in IMG/M
3300004481Combined Assembly of Gp0112041, Gp0112042, Gp0112043EnvironmentalOpen in IMG/M
3300004685Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul08 (version 2)EnvironmentalOpen in IMG/M
3300004694Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE17Sep08 (version 2)EnvironmentalOpen in IMG/M
3300004770Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07EnvironmentalOpen in IMG/M
3300004774Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5MEnvironmentalOpen in IMG/M
3300004804Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0MEnvironmentalOpen in IMG/M
3300004805Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6MEnvironmentalOpen in IMG/M
3300005590Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2EnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300006072Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09EnvironmentalOpen in IMG/M
3300006108Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07EnvironmentalOpen in IMG/M
3300006109Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH04Jul08EnvironmentalOpen in IMG/M
3300006129Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE06Nov07EnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300007169Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projectsEnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008114Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NAEnvironmentalOpen in IMG/M
3300008262Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NAEnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300010316Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNAEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300012689Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES065 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012700Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES079 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012704Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES077 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012719Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES123 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012970Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013093Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaGEnvironmentalOpen in IMG/M
3300013094Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaGEnvironmentalOpen in IMG/M
3300013129 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cmEnvironmentalOpen in IMG/M
3300013130 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2EnvironmentalOpen in IMG/M
3300013131 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10mEnvironmentalOpen in IMG/M
3300017737Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2)EnvironmentalOpen in IMG/M
3300019781Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM15.S.DEnvironmentalOpen in IMG/M
3300020562Freshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021142Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnionEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300024262Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024512Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepC_0hEnvironmentalOpen in IMG/M
3300025379Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 (SPAdes)EnvironmentalOpen in IMG/M
3300025387Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 (SPAdes)EnvironmentalOpen in IMG/M
3300025466Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 (SPAdes)EnvironmentalOpen in IMG/M
3300025470Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 (SPAdes)EnvironmentalOpen in IMG/M
3300025476Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA14M (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025653Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025655Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025687Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300027160Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Law_RepC_8hEnvironmentalOpen in IMG/M
3300027192Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 (SPAdes)EnvironmentalOpen in IMG/M
3300027193Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes)EnvironmentalOpen in IMG/M
3300027721Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027764Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300028044 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_15mEnvironmentalOpen in IMG/M
3300028393Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300031669Soil microbial communities from Risofladan, Vaasa, Finland - TR-1EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300032118Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15EnvironmentalOpen in IMG/M
3300032676Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18023EnvironmentalOpen in IMG/M
3300033742Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawaterEnvironmentalOpen in IMG/M
3300033995Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056EnvironmentalOpen in IMG/M
3300034013Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034EnvironmentalOpen in IMG/M
3300034020Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055EnvironmentalOpen in IMG/M
3300034060Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016EnvironmentalOpen in IMG/M
3300034082Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088EnvironmentalOpen in IMG/M
3300034092Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069EnvironmentalOpen in IMG/M
3300034119Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166EnvironmentalOpen in IMG/M
3300034120Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172EnvironmentalOpen in IMG/M
3300034122Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181EnvironmentalOpen in IMG/M
3300034200Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190EnvironmentalOpen in IMG/M
3300034279Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163EnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
B570J14230_1019225723300001282FreshwaterSNMNEVDLQNYNFAKERAYNEWTKAGELSNWYDLFQDAPNGPTTKLEENWTADPNYFNGDRRYF*
RCM26_108076423300001849Marine PlanktonTKAMELMNFYDLYQNSPQGPTTKLEENWTADVDYFNGDRRYF*
RCM37_110721913300001850Marine PlanktonNYNFAKERCDREWTKALELMNFYDLYQDAPNGPTTKLEENWTADVDYFNGDRRYF*
GOS2224_100611613300001952MarineLERYEKEQEKALQLMNFYDLNQDAPDGPTTKLEENWTADPDYFNNNRRWF*
JGI26470J50227_100764393300003375FreshwaterAKDRXDREWVKALELMNFYDLYQNSPNGPTTKLEENWTADVDYFNGDRRFF*
Ga0069718_1089235813300004481SedimentVDLANFNHSRTRYDREWTKALELMNFYDLFQDAPDGPTTKLEENWTADVDYFNGDRRYF*
Ga0065177_104205313300004685FreshwaterVKALELMNFYDLYQNSPNGPTTKLEENWTADVDYFNGDRRFF*
Ga0065170_104257423300004694FreshwaterAKDRCDREWIKALELMNFYDLYQNNPNGPTTKLEENWTADVDYFNGDRRFF*
Ga0007804_113782323300004770FreshwaterSNMNDVDKMNYEFAKDRCDREWVKALELMNFYDLYQNSPNGPTTKLEENWTADVDYFNGDRRFF*
Ga0007794_1011499713300004774FreshwaterKMNYDFAKDRCDREWIKALELMNFYDLYGNSPNGPTTKLEENWTADVDYFNGDRRFF*
Ga0007794_1016414623300004774FreshwaterMNDVDKMNYDFAKDRCDREWIKALELMNFYDLYGNSPNGPATKLEENWTADVDYFNGDRRFF*
Ga0007796_1021169113300004804FreshwaterAKDRCDREWIKALELMNFYDLYGNSPNGPATKLEENWVADVDYFNGDRRFF*
Ga0007792_1008106533300004805FreshwaterDRCDREWIKALELMNFYDLYGNSPNGPATKLEENWTADVDYFNGDRRFF*
Ga0007792_1016526123300004805FreshwaterYESLVTEVSNMNDVDKMNYDFAKDRCDREWIKALELMNFYDLYGNSPNGPTTKLEENWTADVDYFNGDRRFF*
Ga0070727_1076793413300005590Marine SedimentEKEWEKALQLMNFYDLNQDAPDGPTTKLEENWTADPDYFNNNRRWF*
Ga0079957_117589113300005805LakeNEWIKALELMNFYDLSGQNPDGPTTKLEENWTADVDYFNNDRRFF*
Ga0007881_112749623300006072FreshwaterEVSNMNDVDKMNYEFAKDRCDREWVKALELMNFYDLYQNSPNGPTTKLEENWTADVDYFNGDRRFF*
Ga0007862_104975113300006108FreshwaterLNDVDKMNYDFAKDRCDREWTKACELMNFYNLYQGNPNGPTSKLEENWTADVDYFNGDRRYF*
Ga0007870_109220423300006109FreshwaterKDRCDREWVKALELMNFYDLYQNSPNGPTTKLEENWTADVDYFNGDRRFF*
Ga0007834_111252013300006129FreshwaterMNYEFAKDRCDREWVKALELMNFYDLYQNSPNGPTTKLEENWTADVDYFNGDRRFF*
Ga0070749_1001558513300006802AqueousNYNHALERYEKEQEKALQLMNFYDLYQDAPNGPTTKLEENWVADPDYFNNNRRWF*
Ga0075464_1092911923300006805AqueousMANYKFAQERCETEWAKARELSNFYDLANNAPNGPATKLEENWLADVDYFNGDRRFF*
Ga0075481_1035921713300006868AqueousRYEKEQEKALQLQNFYDLYQDAPNGPTTKLEENWVADPDYFNNNRRWF*
Ga0070746_1022998733300006919AqueousFYDLNQDAPDGPTTKLEENWTADPDYFNNNRRWF*
Ga0102976_106960213300007169Freshwater LakeRRYQFEWEKALQLMNFYDLNQNAPNGPTTKLEENWTADVDYFNNDRRYF*
Ga0070752_1005772133300007345AqueousANYNHALERYEKEQEKALQLQNFHDLYQDAPNGPTTKLEENWQADPDYFNNNRRWF*
Ga0099848_132565123300007541AqueousMAIKIFYESIVSDTSNVNSVDTANFNHALDRFTAEWTKALELMNFYDLNQDSPNGPTTKLEENWVADPDYFTGDRRYF*
Ga0099846_114942433300007542AqueousRELSNFYDLANNAPNGPATKLEENWLADVDYFNGDRRFF*
Ga0099846_121901123300007542AqueousDVDRANYDHALRRYMTEWEKALQLMNFYDLNQDAPNGPTTKLEENWTADVDYFNNDRRYF
Ga0102828_100278183300007559EstuarineSNMNDVDKMNYDFAKDRCDREWIKALELMNFYDLYQNSPNGPTTKLEENWTADVDYFNGDRRFF*
Ga0070751_119946313300007640AqueousAANYNHALERYEKEWEKALQLQNFYDLYQDAPNGPTTKLEENWVADPDYFNGDRRYF*
Ga0099850_113813713300007960AqueousALRRYMTEWEKALQLMNFYDLNQDAPNGPTTKLEENWTADVDYFNNDRRYF*
Ga0114340_120666913300008107Freshwater, PlanktonTDVSNMNEVDIQNYEFAQKRCDDEWTKALQLMNFYDLYQDSPQGPTTKLEENWTADVDYFNGDRRYF*
Ga0114340_120693923300008107Freshwater, PlanktonTDVSNMNEVDIQNYEFAQKRCDDEWTKALQLMNFYDLYMDSPQGPTTKLEENWTADVDYFNGDRRYF*
Ga0114347_109024013300008114Freshwater, PlanktonQLMNFYDLYGDGTVTKLEENWTADVDYFNGDRRYF*
Ga0114337_127092813300008262Freshwater, PlanktonNEVDIQNYEFAQKRCDDEWTKALQLMNFYDLYQDSPQGPTTKLEENWTADVDYFNGDRRYF*
Ga0114973_1048203213300009068Freshwater LakeMQNYDFAVRRCENEWTKALQLMNFYNLYDDSPNGPTTKLEENWTADVDFFNGDRRYF*
Ga0105098_1040645823300009081Freshwater SedimentVFYESLVTDVSNMNEVDLQNYNFAKERAYNEWTKAGELSNWYDLFQDAPNGPTTKLEENWTADPNYFNGDRRYF*
Ga0114918_1002205183300009149Deep SubsurfaceERYEKEYEKILQLMNFYDLYQDAPDGPTTKLEENWTADSSYFNDNRRFF*
Ga0114978_1042678033300009159Freshwater LakeAKKRCEDEWTKALQLMNFYDLYMDSPQGPTTKLEENWTADVDYFNGDRRYF*
Ga0136655_107961613300010316Freshwater To Marine Saline GradientYKFAQERCETEWAKARELSNFYDLANNAPNGPATKLEENWLADVDYFNGDRRFF*
Ga0129333_1001881113300010354Freshwater To Marine Saline GradientMNDVDKQNYDFAKMRCETEWTKAQELSNWYDLFQDSPRGPTTKLEENWVADPNYFNGARRYF*
Ga0129324_1018896013300010368Freshwater To Marine Saline GradientEWAKARELSNFYDLANNAPNGPATKLEENWLADVDYFNGDRRFF*
Ga0129336_1013214913300010370Freshwater To Marine Saline GradientESLVTDVSNLNEVDQQNYDFAKGRCEREWTKALELMNFYDLYQDSPQGPTTKLEENWTADVDYFNGDRRYF*
Ga0133913_1330852613300010885Freshwater LakeDDEWTKALQLMNFYDLYMDSPQGPTTKLEENWTADVDYFNGDRRYF*
Ga0157565_109135313300012689FreshwaterFYESLVTEVSNMNDVDKMNYEFAKDRCDREWTKALELMNFYNLYQGNPNGPTSKLEENWTADVDYFNGDRRYF*
Ga0157576_116391513300012700FreshwaterMNFYNLYQGNPNGPTSKLEENWTADVDYFNGDRRYF*
Ga0157574_106899133300012704FreshwaterTEVSNMNDVDKMNYEFAKDRCDREWTKALELMNFYNLYQGNPNGPTSKLEENWTADVDYFNGDRRYF*
Ga0157600_115222913300012719FreshwaterLQNFNFAKERAYNEWEKAQQLSNWYDLFQDAPQGPTTKLEENWTADPNYFNGDRRYF*
Ga0129338_110033113300012970AqueousHALRRYQFEWEKALQLMNFYDLSQNAPNGPTTKLEENWTADVDYFNNDRRYF*
Ga0129338_135047433300012970AqueousHALRRYQFEWEKALQLMNFYDLNQDAPNGPTTKLEENWTSDVDYFNGDRRYF*
Ga0129338_160009333300012970AqueousHATNRYMKEWQKALQLMNFYDLNQDAPDGPTTKLEENWTADVDYFNNDRRYF*
Ga0164296_104922613300013093FreshwaterKDRCDREWTKALELMNFYDLYGNSPNGPTTKLEENWTADVDYFNGDRRFF*
Ga0164297_1012321213300013094FreshwaterMNFYNLYQGNPNGPTSKLEENWTADVDYFNGDRRFF*
(restricted) Ga0172364_1091503813300013129SedimentHALRRYQFEWEKALQLMNFYDLNQDAPNGPTTKLEENWTADVDYFNNDRRYF*
(restricted) Ga0172363_1003933313300013130SedimentRRYQFEWEKALQLMNFYDLNQDAPNGPTTKLEENWTADVDYFNNDRRYF*
(restricted) Ga0172373_1056828513300013131FreshwaterKSLQLMNFYDLTQNAPNGPTTKLEENWTTDPDYFAGDRRYF*
Ga0187218_100247013300017737SeawaterANYGHALERYEKEWEKALQLMNFYDLNQDAPDGPTTKLEENWTADPDYFNNNRRWF
Ga0181360_11214613300019781Freshwater LakeTDVSNMNEVDLQNYNFAKERAYNEWTKAGELSNWYDLFQDAPNGPTTKLEENWTADPNYFNGDRRYF
Ga0208597_106624113300020562FreshwaterYEFAKKRCEDEWTKALQLMNFYDLYMDNPQGPTTKLEENWTADVDYFNGDRRYF
Ga0214192_106911513300021142FreshwaterNYEFAKDRCDREWVKALELMNFYDLYQNSPNGPTTKLEENWTADVDYFNGDRRFF
Ga0222712_1025656213300021963Estuarine WaterVTDVSNMNEVDVQNYEFAKKRCDSEWTKALELMNFYDLYQDSPQGPTTKLEENWTADVDYFNGDRRYF
Ga0222712_1045150513300021963Estuarine WaterDEWTKALQLMNFYDLYQDSPQGPTTKLEENWTADVDYFNGDRRYF
Ga0196905_110052213300022198AqueousALRRYQNEWEKALQLMNFYDLNQNAPNGPTTKLEENWTADVDYFNNDRRYF
Ga0210003_126124633300024262Deep SubsurfaceKALQLMNFYDLYQDAPDGPTTKLEENWTADSSYFNDNRRFF
Ga0210003_133836913300024262Deep SubsurfaceKALQLMNFYDLYQDSPEGPTTKLEENWTADSSYFNDNRRFF
Ga0255186_100148383300024512FreshwaterYDFAKMRCEEEWRKAQELSNWYDLNQDAPNGPTTKLEENWTADPNYFNGDRRYF
Ga0208738_103636413300025379FreshwaterSLVTEVSNMNDVDKMNYEFAKDRCDREWVKALELMNFYDLYQNSPNGPTTKLEENWTADVDYFNGDRRFF
Ga0207959_103075733300025387FreshwaterNDVDKMNYDFAKDRCDREWTKACELMNFYNLYQGNPNGPTSKLEENWTADVDYFNGDRRY
Ga0208497_110738023300025466FreshwaterSNMNDVDKMNYEFAKDRCDREWVKALELMNFYDLYQNSPNGPTTKLEENWTADVDYFNGDRRFF
Ga0208389_103434913300025470FreshwaterEVSNMNDVDKMNYEFAKDRCDREWVKALELMNFYDLYQNSPNGPTTKLEENWTADVDYFNGDRRFF
Ga0208495_102603233300025476FreshwaterDAEWTKALELMNFYDLMQDAPNGPTTKLEENWTADVDYFNGDRRFF
Ga0208160_107666133300025647AqueousRANYDHALRRYMTEWEKALQLMNFYDLNQDAPNGPTTKLEENWTADVDYFNNDRRYF
Ga0208428_120117223300025653AqueousLERYEKEQEKALQLQNFYDLYQDAPNGPTTKLEENWVADPDYFNNNRRWF
Ga0208795_104185413300025655AqueousLVFYESLVTEVSNMNDVDKMNYDFAKDRCDREWIKALELMNFYDLYKNSPNGPATKLEENWTADVDYFNGDRRFF
Ga0208019_110144233300025687AqueousDHALRRYMTEWEKALQLMNFYDLNQDAPNGPTTKLEENWTADVDYFNNDRRYF
Ga0208644_101635313300025889AqueousANYNHALERYEKEQEKALQLMNFYDLYQDAPNGPTTKLEENWVADPDYFNNNRRWF
Ga0255198_105757233300027160FreshwaterRRYQFEWEKALQLMNWYDLNQDAPNGPTTKLEENWTADVDYFNNDRRYF
Ga0208673_101746933300027192EstuarineKALQLMNFYDLYQDAPEGPTTKLEENWTADADFFNNNRRWF
Ga0208800_105795013300027193EstuarineSNMNDVDKMNYDFAKDRCDREWIKALELMNFYDLYQNSPNGPTTKLEENWTADVDYFNGDRRFF
Ga0209492_132873323300027721Freshwater SedimentATQLSNWYDLFQDAPDGPTTKLEENWTADPNFFNGDRRYF
Ga0209134_1014165333300027764Freshwater LakeFAKMRCETEWTKALQLMNFYDLYMDNPQGPTTKLEENWTADVDYFNGDRRYF
Ga0209134_1030972613300027764Freshwater LakeEFAKKRCEDEWTKALQLMNFYDLYMDNPQGPTTKLEENWTADVDYFNGDRRYF
Ga0209246_1002616473300027785Freshwater LakeLMNFYDLYDNAPEGPTTKLEENWTADVDYFNNDRRFF
Ga0209353_1022306033300027798Freshwater LakeILVFYESLVTEVSNMNDVDKMNYDFAKDRCDREWIKALELMNFYDLYKNSPNGPATKLEENWTADPDYFNGDRRFF
(restricted) Ga0247838_117832833300028044FreshwaterFAKKRCDDEWTKALQLMNFYDLYMDSPQGPTTKLEENWTADVDYFNGDRRYF
Ga0304728_119075333300028393Freshwater LakeMNFYDLYGNSPNGPATKLEENWVADVDYFNGDRRFF
Ga0307375_1036746533300031669SoilANYNHALQRYEKEYEKALQLMNFYDLYQDAPNGPTTKLEENWTADSSFFNDNRRFF
Ga0315909_1000346213300031857FreshwaterMNEVDIQNYEFAQKRCDDEWTKALQLMNFYDLYQDSPQGPTTKLEENWTADVDYFNGDRRYF
Ga0315904_1002796113300031951FreshwaterAQKRCDDEWTKALQLMNFYDLYQDSPQGPTTKLEENWTADVDYFNGDRRYF
Ga0315277_1146817513300032118SedimentDEWTKALQLMNFYDLYMDSPQGPTTKLEENWTADVDYFNGDRRYF
Ga0316229_137071013300032676FreshwaterYEFAKDRCDREWTKALELMNFYNLYQGNPNGPTSKLEENWTADVDYFNGDRRYF
Ga0314858_027783_1120_12873300033742Sea-Ice BrineKDNHALERYEKEYEKALQLMNFYDLYQDAPDGPTTKLEENWTADSSYFNDNRRFF
Ga0335003_0402309_314_5023300033995FreshwaterMNEVDVQNYNFAKKRCEDEWTKALQLMNFYDLYMDSPNGPTTKLEENWTADVDFFNGDRRYF
Ga0334991_0087607_1186_13743300034013FreshwaterMNEVDLQNFNFAKERAYNEWIKAGELSNWYDLFQDAPNGPTTKLEENWTADPNYFNGDRRYF
Ga0335002_0249022_816_10043300034020FreshwaterMNEVDLQNYEFAQKRCENEWTKALQLMNFYDLYQDAPNGPTTKLEENWTADVDYFNGDRRYF
Ga0334983_0317813_718_9063300034060FreshwaterMNEVDLQNYNFAKERAYNEWTKAGELSNWYDLFQDAPNGPTTKLEENWTADPNYFNGDRRYF
Ga0335020_0522435_58_2463300034082FreshwaterMNEVDVQNYEFAKKRCEDEWTKALQLMNFYDLYQDNPQGPTTKLEENWTADVDYFNGDRRYF
Ga0335010_0437426_498_6863300034092FreshwaterMNEVDVQNYEFAKKRCEDEWTKALQLMNFYDLYMDNPQGPTTKLEENWTADVDYFNGDRRYF
Ga0335054_0105359_1575_17363300034119FreshwaterNFAKERCTTEWEKALQLMNFYDLYQDNPNGPTTKLEENWTADVDYFNGDRRYF
Ga0335056_0120127_106_2943300034120FreshwaterMNEVDMQNYDFAVKRCENEWTKALQLMNFYDLYQDSPNGPTTKLEENWTADVDFFNGDRRYF
Ga0335056_0493264_68_2563300034120FreshwaterMNEVDLQNYEFAQTRCEREWTKAIELMNWYDLYQDAPNGPTTKLEENWQADVDYFNGDRRYF
Ga0335060_0395318_623_7333300034122FreshwaterMNFYDLNEDAPNGPTTKLEENWTADVDYFNNDRRYF
Ga0335065_0024630_4146_42533300034200FreshwaterNWYDLFQDAPNGPTTKLEENWTADPNYFNGDRRYF
Ga0335052_0143226_1_1563300034279FreshwaterAQTRCEREWTKAIELMNWYDLYQDAPNGPTTKLEENWQADVDYFNGDRRYF
Ga0348335_134416_573_7043300034374AqueousWEKALQLQNFYDLYQDAPNGPTTKLEENWVADPDYFNGDRRYF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.