Basic Information | |
---|---|
Family ID | F093516 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 106 |
Average Sequence Length | 45 residues |
Representative Sequence | MIGFFKRYVVHNFGLKVLSLLLATGLWFMISRDEQPAEVAV |
Number of Associated Samples | 97 |
Number of Associated Scaffolds | 106 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 100.00 % |
% of genes near scaffold ends (potentially truncated) | 99.06 % |
% of genes from short scaffolds (< 2000 bps) | 87.74 % |
Associated GOLD sequencing projects | 91 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (100.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (16.038 % of family members) |
Environment Ontology (ENVO) | Unclassified (32.075 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.887 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.83% β-sheet: 0.00% Coil/Unstructured: 52.17% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 106 Family Scaffolds |
---|---|---|
PF02457 | DAC | 88.68 |
PF02601 | Exonuc_VII_L | 5.66 |
PF01039 | Carboxyl_trans | 1.89 |
PF13742 | tRNA_anti_2 | 0.94 |
PF07690 | MFS_1 | 0.94 |
COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
---|---|---|---|
COG1570 | Exonuclease VII, large subunit | Replication, recombination and repair [L] | 5.66 |
COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 1.89 |
COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 1.89 |
COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 1.89 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000837|AP72_2010_repI_A100DRAFT_1000670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5490 | Open in IMG/M |
3300001593|JGI12635J15846_10177128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1434 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101405670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
3300002568|C688J35102_119034849 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300005344|Ga0070661_101337134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 602 | Open in IMG/M |
3300005436|Ga0070713_101944226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 571 | Open in IMG/M |
3300005437|Ga0070710_10019075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3540 | Open in IMG/M |
3300005529|Ga0070741_11477415 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
3300005557|Ga0066704_10656661 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300005586|Ga0066691_10018128 | All Organisms → cellular organisms → Bacteria | 3448 | Open in IMG/M |
3300005587|Ga0066654_10108624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1353 | Open in IMG/M |
3300005602|Ga0070762_11113321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
3300005610|Ga0070763_10468435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
3300005712|Ga0070764_10549455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
3300005764|Ga0066903_101045949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1498 | Open in IMG/M |
3300006162|Ga0075030_100259754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1392 | Open in IMG/M |
3300006804|Ga0079221_10675509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
3300007788|Ga0099795_10539851 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
3300009521|Ga0116222_1365232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
3300009522|Ga0116218_1221753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 851 | Open in IMG/M |
3300010048|Ga0126373_10307880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 1582 | Open in IMG/M |
3300010048|Ga0126373_10315039 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1565 | Open in IMG/M |
3300010048|Ga0126373_13174028 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
3300010337|Ga0134062_10744744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
3300010376|Ga0126381_100934835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 1249 | Open in IMG/M |
3300012354|Ga0137366_10444873 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 940 | Open in IMG/M |
3300012361|Ga0137360_11298797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
3300012469|Ga0150984_121078113 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1057 | Open in IMG/M |
3300012924|Ga0137413_10920889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
3300015054|Ga0137420_1337956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4164 | Open in IMG/M |
3300015245|Ga0137409_11046706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
3300015357|Ga0134072_10456631 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
3300015374|Ga0132255_100960566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1280 | Open in IMG/M |
3300016357|Ga0182032_10828830 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
3300016357|Ga0182032_11089737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
3300016404|Ga0182037_10591510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 941 | Open in IMG/M |
3300016445|Ga0182038_11617663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
3300017822|Ga0187802_10378000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
3300017930|Ga0187825_10005674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4163 | Open in IMG/M |
3300017955|Ga0187817_10426382 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 846 | Open in IMG/M |
3300017970|Ga0187783_11046600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
3300017972|Ga0187781_11186461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
3300018019|Ga0187874_10354420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
3300018038|Ga0187855_10299001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 942 | Open in IMG/M |
3300018038|Ga0187855_10552897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
3300018090|Ga0187770_10988090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
3300020581|Ga0210399_10157207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1881 | Open in IMG/M |
3300021088|Ga0210404_10175455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1137 | Open in IMG/M |
3300021170|Ga0210400_10163784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1796 | Open in IMG/M |
3300021180|Ga0210396_11250929 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
3300021401|Ga0210393_11544776 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
3300021402|Ga0210385_10020764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4159 | Open in IMG/M |
3300021405|Ga0210387_11884787 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
3300021407|Ga0210383_11564650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
3300021420|Ga0210394_11639684 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
3300021475|Ga0210392_11498160 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
3300021477|Ga0210398_10539720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 949 | Open in IMG/M |
3300021477|Ga0210398_10561883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 928 | Open in IMG/M |
3300021478|Ga0210402_10015055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6611 | Open in IMG/M |
3300021861|Ga0213853_10753614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
3300025320|Ga0209171_10134569 | All Organisms → cellular organisms → Bacteria | 1466 | Open in IMG/M |
3300025898|Ga0207692_10303851 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 972 | Open in IMG/M |
3300025898|Ga0207692_10388585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 868 | Open in IMG/M |
3300025905|Ga0207685_10217574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 906 | Open in IMG/M |
3300025906|Ga0207699_10203487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1343 | Open in IMG/M |
3300025916|Ga0207663_10645607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 835 | Open in IMG/M |
3300025929|Ga0207664_10650125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 948 | Open in IMG/M |
3300025993|Ga0208415_1020669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
3300026538|Ga0209056_10049430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3777 | Open in IMG/M |
3300027376|Ga0209004_1022698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1002 | Open in IMG/M |
3300027567|Ga0209115_1115158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
3300027591|Ga0209733_1175097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
3300027660|Ga0209736_1018079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2185 | Open in IMG/M |
3300027825|Ga0209039_10117139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1130 | Open in IMG/M |
3300027826|Ga0209060_10113504 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1264 | Open in IMG/M |
3300027855|Ga0209693_10349906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
3300027879|Ga0209169_10040276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2449 | Open in IMG/M |
3300027884|Ga0209275_10692454 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
3300027911|Ga0209698_11210165 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
3300028798|Ga0302222_10029895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2229 | Open in IMG/M |
3300028906|Ga0308309_10127380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2016 | Open in IMG/M |
3300029636|Ga0222749_10666491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
3300030509|Ga0302183_10033095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2087 | Open in IMG/M |
3300030847|Ga0075405_12094684 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 985 | Open in IMG/M |
3300031027|Ga0302308_10449623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
3300031446|Ga0170820_11760793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1068 | Open in IMG/M |
3300031544|Ga0318534_10452131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
3300031711|Ga0265314_10419165 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
3300031715|Ga0307476_10641612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 787 | Open in IMG/M |
3300031718|Ga0307474_11352400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
3300031718|Ga0307474_11513140 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
3300031823|Ga0307478_10939437 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
3300031910|Ga0306923_12146600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
3300032059|Ga0318533_11225853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
3300032174|Ga0307470_10242454 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1184 | Open in IMG/M |
3300032180|Ga0307471_102372432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
3300032180|Ga0307471_104170875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
3300032205|Ga0307472_101499379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
3300032783|Ga0335079_12003253 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
3300032828|Ga0335080_10773295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 995 | Open in IMG/M |
3300032829|Ga0335070_10587739 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1049 | Open in IMG/M |
3300032895|Ga0335074_11177318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
3300032955|Ga0335076_11170444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
3300033412|Ga0310810_10702332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 940 | Open in IMG/M |
3300033412|Ga0310810_11234513 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
3300033807|Ga0314866_104618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.04% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.55% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.60% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.60% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.66% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.66% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.72% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.72% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.77% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.83% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.83% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.83% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.83% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.89% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.89% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.89% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.89% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.89% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.94% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.94% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.94% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.94% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.94% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.94% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.94% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.94% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.94% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.94% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.94% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.94% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.94% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025993 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
3300030847 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AP72_2010_repI_A100DRAFT_10006701 | 3300000837 | Forest Soil | VITFVKRYVVQNFFLKVLSLLLASLLWLAISRDEQPAIVAIRAPIVFQ |
JGI12635J15846_101771283 | 3300001593 | Forest Soil | MIGVFQRYVLHNFGLKFLSLLLASGLWFLISPDEQPAEVA |
JGIcombinedJ26739_1014056701 | 3300002245 | Forest Soil | MIGFVQRYVFHNLGLKFLSLLMATGLWFLIAPDEQ |
C688J35102_1190348492 | 3300002568 | Soil | VIPFFKRYVVHNFGLKFLSLLLATGMWFMIARDEQPSEVAIRAPIVF |
Ga0070661_1013371342 | 3300005344 | Corn Rhizosphere | MIGLFKRYVVHNFSLKLMSLIFATALWFMISRDDRPAELAVRAPIVFQNVPSELEISSES |
Ga0070713_1019442261 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MITFLRRHVFHNFGLKLMSVLLATALWLIISRDERPAEVAVRAPIVFQNVPPN |
Ga0070710_100190755 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | LIALFQRLVVHNFGLKILSLLLASGLWFMISRDEQPAEVALHAPIVFQHVPSQLEI |
Ga0070741_114774151 | 3300005529 | Surface Soil | VTGFLKRYVFHNFSLKLMSLVFATALWFMISRDDRPAEVAVR |
Ga0066704_106566612 | 3300005557 | Soil | MKELFRRYVLHNFGLKVLSLLLATGLWMAISPENQPAEMA |
Ga0066691_100181285 | 3300005586 | Soil | VIALFKRYVVHNFSLKFLSLLLATGLWFMIARDEQPAEVAI |
Ga0066654_101086241 | 3300005587 | Soil | MIGLFKRYVVHNFSFKLMSLIFATALWFMISRDDRPAELAVRAPIVFHNVPSELEI |
Ga0070762_111133212 | 3300005602 | Soil | MIGLVQRYVFHNFGLKVLSLLLASGLWFVISRDDQLAEVSLHAPIVFQ |
Ga0070763_104684352 | 3300005610 | Soil | MIGFFQRYVLHNFWLKVLSLLLAAFLWWRIAPDEQPAEV |
Ga0070764_105494551 | 3300005712 | Soil | MIVFFQRYVLHNFGLKILSLLLATGLWFMISRDEQPAEVALRAPIVFQH |
Ga0066903_1010459491 | 3300005764 | Tropical Forest Soil | MINFVKRYVVQNLFLKVLSLLLASLLWLAISRDEQPAIV |
Ga0075030_1002597542 | 3300006162 | Watersheds | VSALFKRYVVQNFGLKFLSLVLATGLWFMISRDEQPAEVAIRAPIVFQHVPEQL |
Ga0079221_106755092 | 3300006804 | Agricultural Soil | MIGLFKRYVVHNFSLKLMSLIFATALWFMISRDDRPAELAVRAPIVFQNV |
Ga0099795_105398511 | 3300007788 | Vadose Zone Soil | MTGFFQRYVLHNFGLKLMSLLLAAGLWFLISLDEQPAEVAVRAPIVFQH |
Ga0116222_13652321 | 3300009521 | Peatlands Soil | MISFFQRHVLHNFGLKVLSLLLATGLWFLISPDEQPAEVA |
Ga0116218_12217531 | 3300009522 | Peatlands Soil | MISFFQRHVLHNFGLKVLSLLLATGLWFLISPDEQHAEVAVRGLLVG |
Ga0126373_103078801 | 3300010048 | Tropical Forest Soil | MIWFLKRYVLRNLGLKLLSLALASGLWFLISRDEQPAEVAVRAPIVFEHVPPNL |
Ga0126373_103150391 | 3300010048 | Tropical Forest Soil | VIAFFKRYVVHNFSLKFLSLVLATGLWFMIARDEQPAEVAIRAPI |
Ga0126373_131740281 | 3300010048 | Tropical Forest Soil | MITFVQRYVLHNLGLKVLSLVLATGMWFTISRDEQPAEVAVRAPIVF |
Ga0134062_107447441 | 3300010337 | Grasslands Soil | MIGLFKRYVVHNFSFKLMSLIFATALWFMISRDDRPAELAVRAPIVF |
Ga0126381_1009348351 | 3300010376 | Tropical Forest Soil | MIWFIKRYVLHNLGLKLLSLALAAGLWFLISRDEQP |
Ga0137366_104448731 | 3300012354 | Vadose Zone Soil | MIPLFERYVLHNFGLKLLALLLATGLWLVISPDEQP |
Ga0137360_112987971 | 3300012361 | Vadose Zone Soil | MIGFFKHLVLHNFGLKVLSLLLASGLWFLISRDEQPAEVALRAPI |
Ga0150984_1210781132 | 3300012469 | Avena Fatua Rhizosphere | MIPFFKRYVVHNFGLKFLSLLLATGMWFMIARDEQPSEVAI |
Ga0137413_109208892 | 3300012924 | Vadose Zone Soil | MNFFRRYVLHNLPLKLLSLVLAVGLWLAISPDERPAEVAVRAPIVFQNVP |
Ga0137420_13379561 | 3300015054 | Vadose Zone Soil | MIGFFQRHVLHNVGLKMLSLLLATGLWYVTSPDEQPAELAVRAPIRI* |
Ga0137409_110467061 | 3300015245 | Vadose Zone Soil | VSQSKSIGFFQRYVLHNFGLKALSLLLAALLWALISRDEEPAEVALRAPIVFQHVPS |
Ga0134072_104566312 | 3300015357 | Grasslands Soil | MIGFLKRFVFHNFSLKVMSLLFATALWFMIARDERPAEVALRAPIVFQNV |
Ga0132255_1009605661 | 3300015374 | Arabidopsis Rhizosphere | MNFVKRYVVQNLFLKVLSLLLASLLWLAISRDEQPAIVAIRAPIVFQH |
Ga0182032_108288301 | 3300016357 | Soil | VIQFFQRYVIHNFGLKFLSLLLATGLWFMIAREEQPAEVAIRA |
Ga0182032_110897372 | 3300016357 | Soil | MIAFFKRYVIHNFGLKALSLILAAGLWFMISRDEQPAEVAIRAPIVFQ |
Ga0182037_105915101 | 3300016404 | Soil | VISFFKRYVIHNFGLKVLSLLLATGLWFMIARDEQPAEIAIRAPIV |
Ga0182038_116176632 | 3300016445 | Soil | VINLFKRYVLRNFGLKLLSLLLATGLWFMIARDEQPAEVAIHAPIVFQHVPEQL |
Ga0187802_103780002 | 3300017822 | Freshwater Sediment | MIGFFKRYVVHNFGLKVLSLLLATGLWFMISRDEQPAEVAV |
Ga0187825_100056741 | 3300017930 | Freshwater Sediment | MIELLKRAILHNFFLKFMSLLLAAGLWWLISPDEQPAEVSLRAPIVFQ |
Ga0187817_104263821 | 3300017955 | Freshwater Sediment | MIQFFQRYVFHNFGLKVLSLLLATGLWFLISRDEQPAEVAL |
Ga0187783_110466002 | 3300017970 | Tropical Peatland | MIDFFKRYVLHNFWLKVLSLLLAAGLWWRISPDEQPA |
Ga0187781_111864611 | 3300017972 | Tropical Peatland | MISLFKRYVLHNFWIKALSLLMAGGLWWFILPDDQPAEVAVRA |
Ga0187874_103544201 | 3300018019 | Peatland | MIGLFQRYVLHNFGLKFLSLLLAAGLWFLISPDEQP |
Ga0187855_102990012 | 3300018038 | Peatland | MAGFLQRTLFHNLGLKIVSLLLAAGLWTWLVARDP |
Ga0187855_105528972 | 3300018038 | Peatland | MSGFFKRFVFHNFGLKILSLALAAGLWLLISPGEHPAEVALRG |
Ga0187770_109880902 | 3300018090 | Tropical Peatland | MIALFKRYIVHNFLLKVLSLLLATGLWFLLSHEQPA |
Ga0210399_101572071 | 3300020581 | Soil | MIGLFQRYVVHNVGLKFLSLLLAAGLWLLISPDEQPAEVAVRAPIVFQHVPRHLE |
Ga0210404_101754551 | 3300021088 | Soil | MSGFFERYVLHNFVLKVSSLLLAAGLWLLISPDEQPAEVAVHAPIVFQHVP |
Ga0210400_101637843 | 3300021170 | Soil | MIGVFQRYVLHNFGLKFLSLLLASGLWFLISPDEQPAEVAVRAPIVFQH |
Ga0210396_112509292 | 3300021180 | Soil | MIVFFQRYVLHNFGLKVLSLLLATGLWFLISPDEQP |
Ga0210393_115447761 | 3300021401 | Soil | MIAFFQRYVLHNFGLKILSLLLATGLWFMISRDEQP |
Ga0210385_100207641 | 3300021402 | Soil | MIQFFQRYVLHNFGLKVLSLLLATGLWFLISRDEQPAEV |
Ga0210387_118847872 | 3300021405 | Soil | MIGFFQRYVLHNFGLKVLSLLLATGLWFLISPDEQPAEVAVRAPIVFQHVPSQ |
Ga0210383_115646501 | 3300021407 | Soil | MIQFFQRHVLHNFGLKVLSLLLATGLWFLISRDEQPAEVALHAP |
Ga0210394_116396841 | 3300021420 | Soil | MTGLFQRYVVHNVGLKFLSLLLAAGLWLLISPDEQPAEVAVRAPIVFQHVPRHLEI |
Ga0210392_114981601 | 3300021475 | Soil | MSQNSVTGFFKRYVLHNFGLKVLSLLLATGLWLLISRDEEPAE |
Ga0210398_105397202 | 3300021477 | Soil | MITLFKRYVVHNFGLKVLSLLLAAGMWFIISRDEQPAEVAVRAPVVFQHV |
Ga0210398_105618832 | 3300021477 | Soil | MIQFFQRYVLHNFGLKVLSLLLATGLWFLISRDEQ |
Ga0210402_100150558 | 3300021478 | Soil | MIGLVQRYVFHNFGLKVLSLLLASGLWFVISRDDQLAEVSLHAPIVFQHVP |
Ga0213853_107536142 | 3300021861 | Watersheds | VSAPFKRYVVQNFGLKFLSLVLATGLWFMISKDEQPAE |
Ga0209171_101345693 | 3300025320 | Iron-Sulfur Acid Spring | MIGLFQRYVVHNVGLKFLSLLLAAGLWLLISPDEQPAEVAVRAPIVFQHV |
Ga0207692_103038512 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VIALFKRYVVHNFSLKFLSLLLATGIWFMIARDEQP |
Ga0207692_103885851 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LIALFQRLVVHNFGLKILSLLLASGLWFMISRDEQPAEVALHAPIVFQHVPSQLEISSES |
Ga0207685_102175741 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFVKRYVVQNFFLKVLSLLLASLLWLAISRDEQPAIVAIR |
Ga0207699_102034871 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MIALFQRLIVHNFGLKVLSLLLASGLWFLISRDEQP |
Ga0207663_106456072 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MIALFQRLVIHNFGLKILSLLLASGLWFLISRDEQPAEVA |
Ga0207664_106501251 | 3300025929 | Agricultural Soil | MIGFLKRYVFHNFSLKLMSLVFATALWFMISRDDRP |
Ga0208415_10206692 | 3300025993 | Rice Paddy Soil | MIGFLKRYVFHNFSLKVMSLLFATALWFMIARDERPAEVALRAPIV |
Ga0209056_100494305 | 3300026538 | Soil | MNFFRRYVLHNLPLKLLSLVLAVGLWLAISPDERPAEVAVRAPIVFQ |
Ga0209004_10226981 | 3300027376 | Forest Soil | MTGFLKHLFFHNFALKLMSLLLATGLWFMISRDEQPAEVAVRAPIVFEHVPSDLEVS |
Ga0209115_11151581 | 3300027567 | Forest Soil | MITLFKRYVVHNFGLKVLSFLLAAGMWFIISRDEQPAEVAVRAP |
Ga0209733_11750971 | 3300027591 | Forest Soil | MIGLFQRYFLHNFGLKFLSLLLATGLWFLISPDEQPAEVAVRAPIVFQHV |
Ga0209736_10180791 | 3300027660 | Forest Soil | MILLVQRYVLHNFGLKFLSLLLATGLWFLISPHEQPAEVAVRAPIVFQHVP |
Ga0209039_101171392 | 3300027825 | Bog Forest Soil | MIAFFKRYVLHNFGLKVLSLLLAAGLWFLISHEEPAEV |
Ga0209060_101135043 | 3300027826 | Surface Soil | MIGFFQWYVLHNFGIKVLSLLLATGMWFMISRDEQP |
Ga0209693_103499061 | 3300027855 | Soil | MIGFFQRYVLHNFWLKVLSLLLAAFLWWRIAPDEQPAEVA |
Ga0209169_100402763 | 3300027879 | Soil | MITFFKHYVVHNFGLKVLSLLLATGLWFLISRDEQPAEVALHAPIVFENVPS |
Ga0209275_106924542 | 3300027884 | Soil | MITFFKHYVVHNFGLKVLSLLLATGLWFLISRDEQPAEVALHAPIVFENVPSQLEI |
Ga0209698_112101651 | 3300027911 | Watersheds | VIALFKRYVIQNFGLKFLSLVLATGLWFMISKDEQPAEVAIRAPIVFQHVPEQLE |
Ga0302222_100298953 | 3300028798 | Palsa | MTGFFQRYVLHNFGLKFLSLLMATGLWFLISPDEQPAEVAIRA |
Ga0308309_101273801 | 3300028906 | Soil | MMPLFQRYVLHNFTLKLLSLLLAAGLWMMIARDEQPAEVALHAPI |
Ga0222749_106664911 | 3300029636 | Soil | MSQNSVTGFFKRYVLHNFGLKVLSLLLATGLWLLISRDEEPAEVALRAPIG |
Ga0302183_100330953 | 3300030509 | Palsa | MIDFFQRYVIHNFSLKLLSLLMAAGLWFMISRDEQPAEVAIR |
Ga0075405_120946841 | 3300030847 | Soil | MIGLFKHLVLHNFGLKVLSLLLASGLWFLISRDEQPAEVALRAPIVFQHV |
Ga0302308_104496231 | 3300031027 | Palsa | MTGFFQRYVLHNFGLKFLSLLMATGLWFLISPDEQPAEVAIRAPIVFQH |
Ga0170820_117607933 | 3300031446 | Forest Soil | MIAFAQRYVLHNFGLKVLSLLLAAGMWFLIAPDEQPAEVAVRAPIVFQHVPAQ |
Ga0318534_104521312 | 3300031544 | Soil | VINLFKRYVLRNFGLKLLSLLLATGLWFMIARDEQPAEVAIHAPI |
Ga0265314_104191652 | 3300031711 | Rhizosphere | MSGFFKRFVFHNFGLKILSLALAAGLWLLISPGEHPAEVALRGPIVFQNVPSSIEISS |
Ga0307476_106416121 | 3300031715 | Hardwood Forest Soil | MIGFVQRYVFHNFGLKFLSLVMATGLWFLIAPDEQPAE |
Ga0307474_113524002 | 3300031718 | Hardwood Forest Soil | MIPFLQRYVLHNFGLKVVSLLLAAGLWFLIAQDEEPS |
Ga0307474_115131402 | 3300031718 | Hardwood Forest Soil | MSQNSVTGFFKRYVLHNFGLKVLSLLLATGLWLLISRDEEPAEVALRAPIV |
Ga0307478_109394372 | 3300031823 | Hardwood Forest Soil | MMALFQRYIVHNFGLKLLSLFLAAGLWMMIARDEQPAEVALHAPIVFKNV |
Ga0306923_121466001 | 3300031910 | Soil | VIQFLQRYVIHNFGLKFLSLLLATGLWFMIAREEQPSEVAIRAPIVFQHVPRQL |
Ga0318533_112258531 | 3300032059 | Soil | VIQFFQRYVIHNFGLKFLSLLLATGLWFMIAREEQPAEVAIRAPI |
Ga0307470_102424542 | 3300032174 | Hardwood Forest Soil | VISFFKRYVVHNFSLKFLSLLLATGLWFMIARDEQPAEVAIRAPIVFQH |
Ga0307471_1023724321 | 3300032180 | Hardwood Forest Soil | MSGFVQRYVLHNLGLKILSLLLATGLWFLVSPDERPAEV |
Ga0307471_1041708751 | 3300032180 | Hardwood Forest Soil | MIAFFQRYVLHNFGLKLLSLVLATGLWFMISPDEQSAEVAVR |
Ga0307472_1014993792 | 3300032205 | Hardwood Forest Soil | VISLFKRYVVHNFSLKFLSLLLATGLWFMIARDEQPA |
Ga0335079_120032531 | 3300032783 | Soil | MIGFFKRYVFHNFGLKILSLLLATGLWFMISRDEQP |
Ga0335080_107732952 | 3300032828 | Soil | MIALFKRYVFHNFFLKILSLLLATGLWFGISRDEQPAEVAV |
Ga0335070_105877391 | 3300032829 | Soil | MIGVFQRYILHNVGLKLLSLVIAAGLWFMISPDEQPAEVAVRAPIVFQHV |
Ga0335074_111773182 | 3300032895 | Soil | MIGFFKRYVLHNLGLKLLSLALAAGIWFLISPQEQPAE |
Ga0335076_111704441 | 3300032955 | Soil | MIALFRRYVIHNFGLKALSLILATGLWFMISRDEQ |
Ga0310810_107023321 | 3300033412 | Soil | MIGFFKRHVFHNFGLKLMSLILATALWFMISRNDRPAEVAVRAPIVFQNVPAELEISAES |
Ga0310810_112345131 | 3300033412 | Soil | MIGLFKRYVVHNFSFKLMSLIFATALWFMISRDDRPAELAVRAPIVFQNVPSELEI |
Ga0314866_104618_383_511 | 3300033807 | Peatland | MIWFVKRYMLHNLGLKLLSLALATGLWFLISRDEQPAEVAVRA |
⦗Top⦘ |