| Basic Information | |
|---|---|
| Family ID | F093498 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MPGGYEVGDVQRPTIQSVGASNLLVADLAVSTYYTQQTI |
| Number of Associated Samples | 82 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.06 % |
| % of genes from short scaffolds (< 2000 bps) | 88.68 % |
| Associated GOLD sequencing projects | 76 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (75.472 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (22.642 % of family members) |
| Environment Ontology (ENVO) | Unclassified (61.321 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (56.604 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 34.33% Coil/Unstructured: 65.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF01844 | HNH | 0.94 |
| PF05257 | CHAP | 0.94 |
| PF13539 | Peptidase_M15_4 | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.13 % |
| Unclassified | root | N/A | 18.87 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000928|OpTDRAFT_10081811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 716 | Open in IMG/M |
| 3300003404|JGI25920J50251_10118157 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
| 3300004282|Ga0066599_100607222 | Not Available | 734 | Open in IMG/M |
| 3300005580|Ga0049083_10159027 | Not Available | 774 | Open in IMG/M |
| 3300005580|Ga0049083_10280596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
| 3300005581|Ga0049081_10047631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1624 | Open in IMG/M |
| 3300005583|Ga0049085_10019003 | All Organisms → Viruses → Predicted Viral | 2612 | Open in IMG/M |
| 3300006037|Ga0075465_10158544 | Not Available | 517 | Open in IMG/M |
| 3300006805|Ga0075464_10134386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1445 | Open in IMG/M |
| 3300006805|Ga0075464_10854298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
| 3300006920|Ga0070748_1077810 | All Organisms → Viruses → Predicted Viral | 1284 | Open in IMG/M |
| 3300006920|Ga0070748_1195699 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 740 | Open in IMG/M |
| 3300006920|Ga0070748_1304347 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
| 3300007363|Ga0075458_10111807 | Not Available | 849 | Open in IMG/M |
| 3300007559|Ga0102828_1084531 | Not Available | 763 | Open in IMG/M |
| 3300008111|Ga0114344_1071854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1299 | Open in IMG/M |
| 3300009068|Ga0114973_10405931 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
| 3300009068|Ga0114973_10696795 | Not Available | 517 | Open in IMG/M |
| 3300009159|Ga0114978_10166772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1409 | Open in IMG/M |
| 3300009159|Ga0114978_10457927 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 755 | Open in IMG/M |
| 3300009161|Ga0114966_10591234 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
| 3300009164|Ga0114975_10298510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 893 | Open in IMG/M |
| 3300009181|Ga0114969_10189781 | All Organisms → Viruses → Predicted Viral | 1268 | Open in IMG/M |
| 3300009181|Ga0114969_10760279 | Not Available | 517 | Open in IMG/M |
| 3300009183|Ga0114974_10030186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3753 | Open in IMG/M |
| 3300009184|Ga0114976_10099612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1659 | Open in IMG/M |
| 3300010885|Ga0133913_12035589 | All Organisms → Viruses → Predicted Viral | 1425 | Open in IMG/M |
| 3300012709|Ga0157608_1024807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
| 3300012723|Ga0157604_1205362 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 908 | Open in IMG/M |
| 3300012763|Ga0138289_1209438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 935 | Open in IMG/M |
| 3300012768|Ga0138276_1254934 | Not Available | 805 | Open in IMG/M |
| 3300012774|Ga0138283_1113894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
| 3300013295|Ga0170791_14770050 | Not Available | 655 | Open in IMG/M |
| 3300013372|Ga0177922_10885732 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 905 | Open in IMG/M |
| 3300013372|Ga0177922_11103972 | Not Available | 718 | Open in IMG/M |
| 3300014811|Ga0119960_1022612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 829 | Open in IMG/M |
| 3300017716|Ga0181350_1009034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2860 | Open in IMG/M |
| 3300017716|Ga0181350_1131222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
| 3300017722|Ga0181347_1183858 | Not Available | 556 | Open in IMG/M |
| 3300017736|Ga0181365_1102602 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
| 3300017774|Ga0181358_1008977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4158 | Open in IMG/M |
| 3300017774|Ga0181358_1038149 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1854 | Open in IMG/M |
| 3300017780|Ga0181346_1002237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8596 | Open in IMG/M |
| 3300017780|Ga0181346_1185101 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 760 | Open in IMG/M |
| 3300017784|Ga0181348_1006715 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5059 | Open in IMG/M |
| 3300017785|Ga0181355_1090256 | All Organisms → Viruses → Predicted Viral | 1274 | Open in IMG/M |
| 3300017785|Ga0181355_1162436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 896 | Open in IMG/M |
| 3300019784|Ga0181359_1103308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1042 | Open in IMG/M |
| 3300019784|Ga0181359_1271411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
| 3300020205|Ga0211731_11682821 | Not Available | 681 | Open in IMG/M |
| 3300021519|Ga0194048_10173809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 803 | Open in IMG/M |
| 3300022190|Ga0181354_1236146 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
| 3300022407|Ga0181351_1160247 | Not Available | 798 | Open in IMG/M |
| 3300022407|Ga0181351_1230038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
| 3300022407|Ga0181351_1252312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
| 3300023174|Ga0214921_10394014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 711 | Open in IMG/M |
| 3300024262|Ga0210003_1049452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2156 | Open in IMG/M |
| 3300024346|Ga0244775_10573692 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 917 | Open in IMG/M |
| 3300025451|Ga0208426_1019479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1011 | Open in IMG/M |
| 3300025585|Ga0208546_1074021 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 785 | Open in IMG/M |
| 3300025645|Ga0208643_1109356 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 746 | Open in IMG/M |
| 3300025732|Ga0208784_1202803 | Not Available | 578 | Open in IMG/M |
| 3300025843|Ga0209182_10110664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 773 | Open in IMG/M |
| 3300027213|Ga0208555_1045527 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 683 | Open in IMG/M |
| 3300027213|Ga0208555_1049517 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
| 3300027631|Ga0208133_1086049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
| 3300027707|Ga0209443_1161065 | Not Available | 810 | Open in IMG/M |
| 3300027707|Ga0209443_1227470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
| 3300027707|Ga0209443_1239389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
| 3300027736|Ga0209190_1028998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2990 | Open in IMG/M |
| 3300027736|Ga0209190_1226962 | Not Available | 753 | Open in IMG/M |
| 3300027770|Ga0209086_10137203 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1200 | Open in IMG/M |
| 3300027782|Ga0209500_10170862 | Not Available | 1005 | Open in IMG/M |
| 3300027797|Ga0209107_10123363 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1356 | Open in IMG/M |
| 3300027798|Ga0209353_10252279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 758 | Open in IMG/M |
| 3300027798|Ga0209353_10263090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 739 | Open in IMG/M |
| 3300027808|Ga0209354_10304959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 633 | Open in IMG/M |
| 3300028394|Ga0304730_1004725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8875 | Open in IMG/M |
| 3300031539|Ga0307380_10724122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 834 | Open in IMG/M |
| 3300031669|Ga0307375_10404507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 846 | Open in IMG/M |
| 3300031772|Ga0315288_10811478 | Not Available | 862 | Open in IMG/M |
| 3300031772|Ga0315288_11100519 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
| 3300031834|Ga0315290_11331242 | Not Available | 591 | Open in IMG/M |
| 3300031963|Ga0315901_10090400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2855 | Open in IMG/M |
| 3300032053|Ga0315284_11578564 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 691 | Open in IMG/M |
| 3300032143|Ga0315292_11701264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
| 3300032156|Ga0315295_12014323 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
| 3300032173|Ga0315268_11618682 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
| 3300032177|Ga0315276_11712092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
| 3300032516|Ga0315273_10440140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1752 | Open in IMG/M |
| 3300033233|Ga0334722_10283651 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1210 | Open in IMG/M |
| 3300033233|Ga0334722_10596266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 789 | Open in IMG/M |
| 3300034051|Ga0335024_0322264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 788 | Open in IMG/M |
| 3300034062|Ga0334995_0485541 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
| 3300034066|Ga0335019_0615885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
| 3300034101|Ga0335027_0302821 | All Organisms → Viruses → Predicted Viral | 1079 | Open in IMG/M |
| 3300034102|Ga0335029_0664201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
| 3300034103|Ga0335030_0889909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
| 3300034106|Ga0335036_0500432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 757 | Open in IMG/M |
| 3300034112|Ga0335066_0585147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
| 3300034117|Ga0335033_0417197 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
| 3300034122|Ga0335060_0005353 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8553 | Open in IMG/M |
| 3300034122|Ga0335060_0334482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 818 | Open in IMG/M |
| 3300034356|Ga0335048_0323891 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
| 3300034356|Ga0335048_0580895 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 22.64% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 18.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 15.09% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 10.38% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.38% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.77% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.77% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.83% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.89% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.94% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.94% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.94% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 0.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.94% |
| Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.94% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.94% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000928 | Marine plume microbial communities from the Columbia River - 25 PSU | Environmental | Open in IMG/M |
| 3300003404 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD | Environmental | Open in IMG/M |
| 3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300006037 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012709 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES134 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012723 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES129 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012763 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140108_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012768 | Freshwater microbial communities from Lake Montjoie, Canada - M_130710_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012774 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130109_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025451 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025843 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027213 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300034051 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13May2013-rr0097 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| OpTDRAFT_100818113 | 3300000928 | Freshwater And Marine | IISIIAAMPAGYEVGDVQRPTIQQVGATNLLVADLAVSTYYTQQTI* |
| JGI25920J50251_101181572 | 3300003404 | Freshwater Lake | AMPAGYEVGDVQRPTIQQVGATNLLVADLAVSTYYTQQTI* |
| Ga0066599_1006072223 | 3300004282 | Freshwater | ILGAMPSGYVVGDVQLPSIVSVGASNLLVADLSVSTYFTQENN* |
| Ga0049083_101590271 | 3300005580 | Freshwater Lentic | LIIEILGVMPNGYVVGDVQRPTITNINTSSILIADLAVSTYYNQDI* |
| Ga0049083_102805962 | 3300005580 | Freshwater Lentic | LEQLIIAIMGAMPAGYTVGDVQRPTVQSVGASNLLVADLAVSTYYTQQTI* |
| Ga0049081_100476311 | 3300005581 | Freshwater Lentic | QLVISIMAAMPAGYEVGDVQRPTIQQVGATNLLVADLAVSTYYTQQTI* |
| Ga0049085_100190035 | 3300005583 | Freshwater Lentic | YVVGDVDRPAVTQVGASPLLVADLAVSTYYTQQSI* |
| Ga0075465_101585441 | 3300006037 | Aqueous | QLVIQILGVMPNGYVVGDVQRPAITSVGASTLLTADLSVSTYYNQD* |
| Ga0075464_101343861 | 3300006805 | Aqueous | IIAAMPAGYEVGDVQRPTIQQVGATNLLVADLAVSTYYTQQTI* |
| Ga0075464_108542981 | 3300006805 | Aqueous | QLVISIMAAMPAGYEVGDVQRPTIQQVGATNLLVADLSVSTYYTQQTI* |
| Ga0070748_10778101 | 3300006920 | Aqueous | KLIISILAAMPTGYVVGDVQRPTITSVGASNLLVADLSVSTYYTQVN* |
| Ga0070748_11956991 | 3300006920 | Aqueous | IIAAMPGGYEVGDVQRPTIQSVGASNLLVADLAVSTYYTQETI* |
| Ga0070748_13043472 | 3300006920 | Aqueous | IIAAMPTGYEVGDVQRPTIQSVGASNLLVADLAVSTYYTQQTI* |
| Ga0075458_101118071 | 3300007363 | Aqueous | LGVMPNGYVVGDVQRPAITSVGASTLLTADLSVSTYYNQD* |
| Ga0102828_10845311 | 3300007559 | Estuarine | MPDGYVVGDVQRPTITNLTTSSILIADLSVSTYYNQDI* |
| Ga0114344_10718541 | 3300008111 | Freshwater, Plankton | YEVGDVQRPTIQSVGASNLLVADLAVSTYYTQQTI* |
| Ga0114973_104059313 | 3300009068 | Freshwater Lake | PAGYEVGDVQRPTIQQVGATNLLVADLAVSTYYTQQTI* |
| Ga0114973_106967951 | 3300009068 | Freshwater Lake | GYVVGDVQRPSIVSVGASNLLVADLNVSTYFTQENN* |
| Ga0114978_101667721 | 3300009159 | Freshwater Lake | ISIIAAMPAGYEVGDVQRPTIQQVGATNLLVADLAVSTYYTQQTI* |
| Ga0114978_104579271 | 3300009159 | Freshwater Lake | LIIEILGAIPSGYVVGDVQRPSITSVGASNLLVADISISTYYTQT* |
| Ga0114966_105912341 | 3300009161 | Freshwater Lake | GYEVGDVQRPTIQQVGATNLLVADLAVSTYYTQQTI* |
| Ga0114975_102985101 | 3300009164 | Freshwater Lake | IAIMGAMPAGYTVGDVQRPTVQSVGASNLLVADLAVSTYYTQQTI* |
| Ga0114969_101897814 | 3300009181 | Freshwater Lake | ISILAAMPVGYVVGDVQRPTVMQVGASNLLVADLSVSTYYTQQTI* |
| Ga0114969_107602792 | 3300009181 | Freshwater Lake | MPNGYVVGDVQRPAITSVGASTLLTADLSVSTYYNQD* |
| Ga0114974_100301866 | 3300009183 | Freshwater Lake | IISILGAMPSGYVVGDVQRPSIVSVGASNLLVADLSVSTYYTQENN* |
| Ga0114976_100996121 | 3300009184 | Freshwater Lake | EALIISILGAMPAGYVVGDVQRPSIVSVGASNLLVADLNVSTYFTQENN* |
| Ga0114967_101611191 | 3300010160 | Freshwater Lake | EILLMQILGAVPSGYVVGDVQTPQIVNVGTASLLSADLSVSTYYTQTN* |
| Ga0133913_120355891 | 3300010885 | Freshwater Lake | SILAAMPVGYVVGDVQRPTVMQVGASNLLVADLSVSTYYTQQTI* |
| Ga0157608_10248072 | 3300012709 | Freshwater | YEVSDVQRPTVTQVGASNLLVADIVVSTHYTRTN* |
| Ga0157604_12053623 | 3300012723 | Freshwater | SGYVVGDVQRPSIISVGASNLLVADLNVSTYFTQINT* |
| Ga0138289_12094383 | 3300012763 | Freshwater Lake | PTGYVVGDVQRPTITSVGASNLLVADLSVSTYYTQVN* |
| Ga0138276_12549343 | 3300012768 | Freshwater Lake | QILGVMPNGYVVGDVQRPAITSVGASTLLTADLSVSTYYNQD* |
| Ga0138283_11138941 | 3300012774 | Freshwater Lake | GAMPAGYTVGDVQRPTVQSVGASNLLVADLAVSTYYTQQTI* |
| Ga0170791_147700501 | 3300013295 | Freshwater | GYVVGDVQRPTITNTNTSSLLIADLAVSTYYNQDI* |
| Ga0177922_108857323 | 3300013372 | Freshwater | MPAGYEVGDVQRPTIQQVGATNLLVADLAVSTYYTQQTI* |
| Ga0177922_111039723 | 3300013372 | Freshwater | YEVGNVQRPTIQSVGASNLLVADLAVSTYYTQQTI* |
| Ga0119960_10226123 | 3300014811 | Aquatic | FPSHDREQLVISIMAAMPAGYEVGDVQRPTIQSVGASNLLVADLAVSTYYTQQTI* |
| Ga0181350_10090341 | 3300017716 | Freshwater Lake | ILGVMPNGYVVGDVQRPTITNINTSSILIADLAVSTYYNQDI |
| Ga0181350_11312222 | 3300017716 | Freshwater Lake | GYVVGDVDRPAVTQVGASPLLVADLAVSTYYTQQTI |
| Ga0181347_11838582 | 3300017722 | Freshwater Lake | IQILGVMPNGYVVGDVQRPTITNINTSSILIADLAVSTYYNQDI |
| Ga0181365_11026021 | 3300017736 | Freshwater Lake | AMPTGYTVGDVQRPTVQSVGASNLLVADLAVSTYYTQQTI |
| Ga0181358_10089776 | 3300017774 | Freshwater Lake | EQLIIAIMGAMPAGYTVGDVQRPTVQSVGASNLLVADLAVSTYYTQQTI |
| Ga0181358_10381491 | 3300017774 | Freshwater Lake | NIAIMRAMPAGYTVGDVQRPTVQSVGASNLLVADLAVSTYYTQQTI |
| Ga0181346_100223718 | 3300017780 | Freshwater Lake | GYTVGDVQRPTIQSVGASSLLVADLAVSTYYTQQSI |
| Ga0181346_11851011 | 3300017780 | Freshwater Lake | GAGYVVGDVDRPAVTQVGASPLLVADLAVSTYYTQQTI |
| Ga0181348_10067158 | 3300017784 | Freshwater Lake | NLEQLIISILGAMPSGYVVGDVDRPAVTQVGASPLLVADLAVSTYYTQQTI |
| Ga0181355_10902561 | 3300017785 | Freshwater Lake | SGYVVGDVDRPAVTQVGASPLLVADLAVSTYYTQQSI |
| Ga0181355_11624363 | 3300017785 | Freshwater Lake | VGYVVGDVQRPTVMQVGASNLLIADLSVSTYYTQQTI |
| Ga0181359_11033081 | 3300019784 | Freshwater Lake | IIAIMGAMPAGYTVGDVQRPTVQSVGASNLLVADLAVSTYYTQQTI |
| Ga0181359_12714112 | 3300019784 | Freshwater Lake | NLEQLIIAIMGAMPTGYTVGDVQRPTVQSVGASNLLVADLAVSTYYTQQTI |
| Ga0211731_116828211 | 3300020205 | Freshwater | VIQILGAMPDGYVVGDVQRPTITNVNTSSLLIADISVSTYYNQDQP |
| Ga0194048_101738093 | 3300021519 | Anoxic Zone Freshwater | MPGGYEVGDVQRPTIQSVGASNLLVADLAVSTYYTQQTI |
| Ga0181354_12361462 | 3300022190 | Freshwater Lake | LIIAIMGAMPAGYTVGDVQRPTVQSVGASNLLVADLAVSTYYTQQTI |
| Ga0181351_11602473 | 3300022407 | Freshwater Lake | LIIEILGVMPNGYVVGDVQRPTITNINTSSILIADLAVSTYYNQDI |
| Ga0181351_12300381 | 3300022407 | Freshwater Lake | QLIISIMQAMPTGYTVGDVQRPTIQSVGASSLLVADLAVSTYYTQQSI |
| Ga0181351_12523121 | 3300022407 | Freshwater Lake | LIISIIAAMPTGYEVGDVQRPTIQSVGASNLLVADLAVSTYYTQQTI |
| Ga0214921_103940143 | 3300023174 | Freshwater | SAMPTGYEVGDVQRPTIQSVGASNLLVADLAVSTYYTQQTI |
| Ga0210003_10494521 | 3300024262 | Deep Subsurface | LGYVVGDVQRPTIQSVGASNLLIADLSVSTFYTQT |
| Ga0244775_105736923 | 3300024346 | Estuarine | MAAMPAGYEVGDVQRPTIQQVGATNLLVADLSVSTYYTQQTI |
| Ga0208426_10194791 | 3300025451 | Aqueous | KLIISILAAMPTGYVVGDVQRPTITSVGASNLLVADLSVSTYYTQVN |
| Ga0208546_10740213 | 3300025585 | Aqueous | SIIAAMPGGYEVGDVQRPTIQSVGASNLLVADLAVSTYYTQQTI |
| Ga0208643_11093563 | 3300025645 | Aqueous | MPAGYEVGDVQRPTIQQVGATNLLVADLAVSTYYTQQTI |
| Ga0208784_12028031 | 3300025732 | Aqueous | AGYEISDVQRPTVTQVGASNLLVADIGVSTHYTRTV |
| Ga0209182_101106643 | 3300025843 | Lake Sediment | LMPAGYEVGDVSRPTIISVGATNLLSADLSVSTYYTQT |
| Ga0208555_10455271 | 3300027213 | Estuarine | PAGYEVGDVQRPTIQSVGASNLLVADLAVSTYYTQQTI |
| Ga0208555_10495171 | 3300027213 | Estuarine | AAMPAGYEVGDVQRPTIQQVGATNLLVADLSVSTYYTQQTI |
| Ga0208133_10860491 | 3300027631 | Estuarine | PTGYEVGDVQRPTIQQVGATNLLVADLSVSTYYTQQTI |
| Ga0209443_11610651 | 3300027707 | Freshwater Lake | LDNLEQLVIQILGVMPNGYVVGDVQRPAITSVGASTLLTADLSVSTYYNQD |
| Ga0209443_12274703 | 3300027707 | Freshwater Lake | PAGYTVGDVQRPTVQSVGASNLLVADLAVSTYYTQQTI |
| Ga0209443_12393891 | 3300027707 | Freshwater Lake | EQLVISIMAAMPAGYEVGDVQRPTIQQVGATNLLVADLSVSTYYTQQTI |
| Ga0209190_10289981 | 3300027736 | Freshwater Lake | LEALIISILGAMPSGYVVGDVQRPSIVSVGASNLLVADLSVSTYFTQENN |
| Ga0209190_12269623 | 3300027736 | Freshwater Lake | NGYVVGDVQRPAITSVGASTLLTADLSVSTYYNQD |
| Ga0209086_101372031 | 3300027770 | Freshwater Lake | MPNGYVVGDVQRPAITSVGASTLLTADLSVSTYYNQD |
| Ga0209500_101708621 | 3300027782 | Freshwater Lake | DNLEKLVIELLGAMPSGYVVGDVQRPQITQVGAANLLTADISVSTYYTQEN |
| Ga0209107_101233631 | 3300027797 | Freshwater And Sediment | ISAMPAGYEVGDVQRPTIQSVGASNLLVADLAVSTYYTQQTI |
| Ga0209353_102522793 | 3300027798 | Freshwater Lake | ISILAAMPVGYVVGDVQRPTVMQVGASNLLIADLSVSTYYTQQSI |
| Ga0209353_102630903 | 3300027798 | Freshwater Lake | TGYTVGDVQRPTVQSVGASNLLVADLAVSTYYTQQTI |
| Ga0209354_103049593 | 3300027808 | Freshwater Lake | YTVGDVQRPTVQSVGASNLLVADLAVSTYYTQQTI |
| Ga0304730_10047251 | 3300028394 | Freshwater Lake | QLVIQILGVMPNGYVVGDVQRPAITSVGASTLLTADLSVSTYYNQD |
| Ga0307380_107241223 | 3300031539 | Soil | NNTAGALDGLEKLIISILTALPLGYVVGDVQRPTIQSVGASNLLIADLSVSTFYTQT |
| Ga0307375_104045073 | 3300031669 | Soil | TAGALDGLEKLIISILTALPLGYVVGDVQRPTIQSVGASNLLIADLSVSTFYTQT |
| Ga0315288_108114783 | 3300031772 | Sediment | PNGYVVGDVQRPAITSVGASTLLTADLSVSTYYNQD |
| Ga0315288_111005191 | 3300031772 | Sediment | AGYTVGDVQRPTVQSVGASNLLVADLAVSTYYTQQTI |
| Ga0315290_113312422 | 3300031834 | Sediment | LEQLVIQILGVMPNGYVVGDVQRPAITSVGASTLLTADLSVSTYYNQD |
| Ga0315901_100904001 | 3300031963 | Freshwater | AGYEVGDVQRPTIQSVGASNLLVADLAVSTYYTQQTI |
| Ga0315284_115785641 | 3300032053 | Sediment | NAGALDQLEVLIITLIGLMPVGYEVGDVSRPTIISVGASNLLSADLSVSTYYTQT |
| Ga0315292_117012641 | 3300032143 | Sediment | RSILGAMPSGYVVGDVDRPAVTQVGASPLLVADLAVSTYYTQQSI |
| Ga0315295_120143232 | 3300032156 | Sediment | AMPTGYVVGDVQRPTIQSVGASNLLVADLAVSTYYTQQSI |
| Ga0315268_116186823 | 3300032173 | Sediment | LLPVGYEVGDVSRPTIISVGASNLLSADLSVSTYYTQT |
| Ga0315276_117120922 | 3300032177 | Sediment | TAGALDQLEVLIITLIGLMPVGYEVGDVSRPTIISVGASNLLSADLSVSTYYTQT |
| Ga0315273_104401401 | 3300032516 | Sediment | LMPVGYEVGDVSRPTIISVGASNLLSADLSVSTYYTQT |
| Ga0334722_102836511 | 3300033233 | Sediment | LEQLIIAIMGAMPAGYTVGDVQRPTVQSVGASNLLVADLAVSTYYTQQTI |
| Ga0334722_105962663 | 3300033233 | Sediment | LIITLIGLMPVGYEVGDVSRPTIISVGASNLLSADLSVSTYYTQT |
| Ga0335024_0322264_647_787 | 3300034051 | Freshwater | VISIMAAMPAGYEVGDVQRPTIQQVGATNLLVADLAVSTYYTQQTI |
| Ga0334995_0485541_1_135 | 3300034062 | Freshwater | SIMAAMPAGYEVGDVQRPTIQQVGATNLLVADLAVSTYYTQQTI |
| Ga0335019_0615885_489_632 | 3300034066 | Freshwater | LVISIMAAMPAGYEVGDVQRPTIQQVGATNLLVADLAVSTYYTQQTI |
| Ga0335027_0302821_919_1077 | 3300034101 | Freshwater | DNLEQLVISILAAMPVGYVVGDVQRPTVMQVGASNLLIADLSVSTYYTQQTI |
| Ga0335029_0664201_2_109 | 3300034102 | Freshwater | YTVGDVQQPTVQSVGASNLLVADLAVSTYYTQQTI |
| Ga0335030_0889909_3_143 | 3300034103 | Freshwater | IISIIAAMPGGYEVGDVQRPTIQQVGATNLLVADLAVSTYYTQETI |
| Ga0335036_0500432_627_755 | 3300034106 | Freshwater | IAAMPGGYEVGDVQRPTIQQVGATNLLVADLAVSTYYTQETI |
| Ga0335066_0585147_427_579 | 3300034112 | Freshwater | LEQLIISIIAAMPGGYEVGDVQRPTIQQVGATNLLVADLAVSTYYTQETI |
| Ga0335033_0417197_508_657 | 3300034117 | Freshwater | EQLVISIMQAMPTGYVVGDVQQPTIQSVGASNLLVADLAVSTYYTQETI |
| Ga0335060_0005353_2_109 | 3300034122 | Freshwater | YVVGDVQQPTIQSVGASNLLVADLAVSTYYTQETI |
| Ga0335060_0334482_658_816 | 3300034122 | Freshwater | DNLEQLVISIMQAMPTGYVVGDVQQPTIQSVGASNLLVADLAVSTYYTQETI |
| Ga0335048_0323891_1_108 | 3300034356 | Freshwater | YEVGDVQRPTIQQVGATNLLVADLAVSTYYTQQTI |
| Ga0335048_0580895_1_114 | 3300034356 | Freshwater | GGYEVGDVQRPTIQQVGATNLLVADLAVSTYYTQETI |
| ⦗Top⦘ |