| Basic Information | |
|---|---|
| Family ID | F093493 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 44 residues |
| Representative Sequence | LSTDVKALLELANKGKGGFWMGMTIASFMGGVITFVADRLWK |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 0.95 % |
| % of genes near scaffold ends (potentially truncated) | 95.28 % |
| % of genes from short scaffolds (< 2000 bps) | 96.23 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (64.151 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (28.302 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.830 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (64.151 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 78.57% β-sheet: 0.00% Coil/Unstructured: 21.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.64 % |
| Unclassified | root | N/A | 27.36 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001837|RCM39_1080104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1251 | Open in IMG/M |
| 3300003277|JGI25908J49247_10051647 | Not Available | 1073 | Open in IMG/M |
| 3300003394|JGI25907J50239_1060633 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 759 | Open in IMG/M |
| 3300003412|JGI25912J50252_10043606 | All Organisms → Viruses → Predicted Viral | 1271 | Open in IMG/M |
| 3300004789|Ga0007752_11096464 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
| 3300005580|Ga0049083_10257028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
| 3300005581|Ga0049081_10221945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
| 3300005582|Ga0049080_10239782 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
| 3300005584|Ga0049082_10183990 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 718 | Open in IMG/M |
| 3300005584|Ga0049082_10316009 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
| 3300005955|Ga0073922_1018820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 824 | Open in IMG/M |
| 3300006805|Ga0075464_10235246 | All Organisms → Viruses | 1093 | Open in IMG/M |
| 3300006805|Ga0075464_10303462 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 961 | Open in IMG/M |
| 3300006805|Ga0075464_10960499 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
| 3300007708|Ga0102859_1020114 | All Organisms → Viruses → Predicted Viral | 1736 | Open in IMG/M |
| 3300009026|Ga0102829_1139550 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 772 | Open in IMG/M |
| 3300009056|Ga0102860_1223715 | Not Available | 542 | Open in IMG/M |
| 3300009168|Ga0105104_10371413 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 793 | Open in IMG/M |
| 3300009183|Ga0114974_10283756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 979 | Open in IMG/M |
| 3300009183|Ga0114974_10370793 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 826 | Open in IMG/M |
| 3300010368|Ga0129324_10228759 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
| 3300010885|Ga0133913_11663546 | Not Available | 1607 | Open in IMG/M |
| 3300010885|Ga0133913_11819835 | Not Available | 1523 | Open in IMG/M |
| 3300011995|Ga0153800_1008410 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 998 | Open in IMG/M |
| 3300012663|Ga0157203_1042194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
| 3300013005|Ga0164292_10167823 | All Organisms → Viruses → Predicted Viral | 1590 | Open in IMG/M |
| 3300013005|Ga0164292_10566840 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 737 | Open in IMG/M |
| 3300013014|Ga0164295_11456353 | Not Available | 531 | Open in IMG/M |
| 3300013372|Ga0177922_11339686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 944 | Open in IMG/M |
| 3300017701|Ga0181364_1052227 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
| 3300017716|Ga0181350_1027258 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1582 | Open in IMG/M |
| 3300017716|Ga0181350_1071217 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 893 | Open in IMG/M |
| 3300017716|Ga0181350_1161429 | Not Available | 519 | Open in IMG/M |
| 3300017722|Ga0181347_1138353 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
| 3300017722|Ga0181347_1164406 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
| 3300017723|Ga0181362_1071481 | Not Available | 704 | Open in IMG/M |
| 3300017723|Ga0181362_1107760 | Not Available | 550 | Open in IMG/M |
| 3300017736|Ga0181365_1123767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
| 3300017736|Ga0181365_1124634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 616 | Open in IMG/M |
| 3300017761|Ga0181356_1249507 | Not Available | 506 | Open in IMG/M |
| 3300017766|Ga0181343_1149211 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
| 3300017774|Ga0181358_1287518 | Not Available | 505 | Open in IMG/M |
| 3300017777|Ga0181357_1098136 | Not Available | 1113 | Open in IMG/M |
| 3300017780|Ga0181346_1147278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 883 | Open in IMG/M |
| 3300017785|Ga0181355_1240897 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 696 | Open in IMG/M |
| 3300018420|Ga0181563_10290829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 959 | Open in IMG/M |
| 3300019784|Ga0181359_1216980 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
| 3300022043|Ga0196909_101984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
| 3300022072|Ga0196889_1105574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
| 3300022190|Ga0181354_1089863 | All Organisms → Viruses → Predicted Viral | 1007 | Open in IMG/M |
| 3300022190|Ga0181354_1155800 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 711 | Open in IMG/M |
| 3300022190|Ga0181354_1182742 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
| 3300022200|Ga0196901_1264641 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300022407|Ga0181351_1130255 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 931 | Open in IMG/M |
| 3300024351|Ga0255141_1000725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7489 | Open in IMG/M |
| 3300024480|Ga0255223_1023589 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1011 | Open in IMG/M |
| 3300025896|Ga0208916_10395828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
| 3300026415|Ga0256298_1014516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1033 | Open in IMG/M |
| 3300026931|Ga0209850_1010547 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 768 | Open in IMG/M |
| 3300027128|Ga0255099_1029932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 927 | Open in IMG/M |
| 3300027137|Ga0255092_1042339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 767 | Open in IMG/M |
| 3300027138|Ga0255064_1054444 | Not Available | 631 | Open in IMG/M |
| 3300027295|Ga0255126_1091275 | Not Available | 546 | Open in IMG/M |
| 3300027306|Ga0255220_1018012 | Not Available | 1477 | Open in IMG/M |
| 3300027487|Ga0255091_1014753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1570 | Open in IMG/M |
| 3300027489|Ga0255095_1056963 | Not Available | 691 | Open in IMG/M |
| 3300027593|Ga0255118_1049343 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
| 3300027595|Ga0255122_1041400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 814 | Open in IMG/M |
| 3300027608|Ga0208974_1079315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 900 | Open in IMG/M |
| 3300027608|Ga0208974_1086202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 853 | Open in IMG/M |
| 3300027608|Ga0208974_1182872 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
| 3300027621|Ga0208951_1187387 | Not Available | 522 | Open in IMG/M |
| 3300027688|Ga0209553_1002389 | Not Available | 9169 | Open in IMG/M |
| 3300027721|Ga0209492_1308012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
| 3300027759|Ga0209296_1069619 | All Organisms → Viruses → Predicted Viral | 1768 | Open in IMG/M |
| 3300027759|Ga0209296_1267023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
| 3300027785|Ga0209246_10100853 | All Organisms → Viruses → Predicted Viral | 1131 | Open in IMG/M |
| 3300027785|Ga0209246_10379795 | Not Available | 533 | Open in IMG/M |
| 3300027797|Ga0209107_10205620 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 969 | Open in IMG/M |
| 3300027798|Ga0209353_10371985 | Not Available | 592 | Open in IMG/M |
| 3300027808|Ga0209354_10346226 | Not Available | 585 | Open in IMG/M |
| 3300027969|Ga0209191_1178595 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 849 | Open in IMG/M |
| 3300028025|Ga0247723_1068936 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 957 | Open in IMG/M |
| 3300028091|Ga0255184_1059441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 750 | Open in IMG/M |
| 3300031578|Ga0307376_10728536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
| 3300031707|Ga0315291_11400292 | Not Available | 557 | Open in IMG/M |
| 3300031746|Ga0315293_11182285 | Not Available | 532 | Open in IMG/M |
| 3300031834|Ga0315290_10307247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1389 | Open in IMG/M |
| 3300031885|Ga0315285_10542473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 786 | Open in IMG/M |
| 3300032018|Ga0315272_10730494 | Not Available | 505 | Open in IMG/M |
| 3300032053|Ga0315284_12030447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
| 3300032053|Ga0315284_12118137 | Not Available | 564 | Open in IMG/M |
| 3300032164|Ga0315283_12320029 | Not Available | 524 | Open in IMG/M |
| 3300032173|Ga0315268_11097758 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 803 | Open in IMG/M |
| 3300032173|Ga0315268_11128556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 792 | Open in IMG/M |
| 3300032342|Ga0315286_11014413 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 825 | Open in IMG/M |
| 3300033233|Ga0334722_10441356 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 938 | Open in IMG/M |
| 3300033996|Ga0334979_0644856 | Not Available | 558 | Open in IMG/M |
| 3300034022|Ga0335005_0314336 | Not Available | 926 | Open in IMG/M |
| 3300034062|Ga0334995_0139251 | All Organisms → Viruses → Predicted Viral | 1769 | Open in IMG/M |
| 3300034093|Ga0335012_0346712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 740 | Open in IMG/M |
| 3300034104|Ga0335031_0177981 | Not Available | 1454 | Open in IMG/M |
| 3300034112|Ga0335066_0085877 | All Organisms → Viruses → Predicted Viral | 2012 | Open in IMG/M |
| 3300034120|Ga0335056_0340382 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 821 | Open in IMG/M |
| 3300034272|Ga0335049_0706923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 28.30% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 12.26% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 11.32% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.38% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 8.49% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.60% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.60% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.89% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.89% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.89% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 1.89% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.94% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.94% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.94% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001836 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM27, ROCA_DNA191_0.2um_MCP-N_C_3a | Environmental | Open in IMG/M |
| 3300001837 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM39, ROCA_DNA237_0.2um_Ob_C_3a | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003412 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD | Environmental | Open in IMG/M |
| 3300004789 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005955 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022043 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300024351 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300024480 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026415 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026931 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027128 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8d | Environmental | Open in IMG/M |
| 3300027137 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8d | Environmental | Open in IMG/M |
| 3300027138 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300027295 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepA_8d | Environmental | Open in IMG/M |
| 3300027306 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepB_8d | Environmental | Open in IMG/M |
| 3300027487 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8d | Environmental | Open in IMG/M |
| 3300027489 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8d | Environmental | Open in IMG/M |
| 3300027593 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8h | Environmental | Open in IMG/M |
| 3300027595 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepC_8h | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028091 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| RCM27_10025307 | 3300001836 | Marine Plankton | LLELANKGKGGFWMGMTIASMVGGFITFVGGKFIK* |
| RCM39_10801041 | 3300001837 | Marine Plankton | EVHQLSKDVKALLELANKAKGGFWTGMMIASTIGGFITFVGGKLIR* |
| JGI25908J49247_100516473 | 3300003277 | Freshwater Lake | LSTDVKALLELANKGKGGFWMGMTIASFMGGVITFVADRLWK* |
| JGI25907J50239_10606331 | 3300003394 | Freshwater Lake | QVEALXGQVTQLSNDVKALLELANKGKGGFWMGMTIASFMGGVITFVADRLWK* |
| JGI25912J50252_100436065 | 3300003412 | Freshwater Lake | QLQVSQLSTDVKALLELANKGKGGFWMGMTIASFMGGVXTFVADRLWK* |
| Ga0007752_110964641 | 3300004789 | Freshwater Lake | VEALNGQVSQLSTDVKALLELANKGKGGFWMGMTIASFMGGVITFVADRLWK* |
| Ga0049083_102570281 | 3300005580 | Freshwater Lentic | HGQVTQLSNDVKALLELANKGKGGFWMGMTIASFMGGVITFVADRLWK* |
| Ga0049081_102219451 | 3300005581 | Freshwater Lentic | EALQKEMHLLSADVKSLLELANKGKGGFWMGMTIASFMGGIVTFIVDRIWK* |
| Ga0049080_102397823 | 3300005582 | Freshwater Lentic | EVHSLSKDVKALLELANKGKGGFWMGMTIASFMGGVITFVADRVWK* |
| Ga0049082_101839901 | 3300005584 | Freshwater Lentic | LGADVKALLELANKGKGGFWMGMTIASFMGGVITFVADRVWK* |
| Ga0049082_103160091 | 3300005584 | Freshwater Lentic | KALLELANKGKGGFWVGMTIASFMGGVITFIADRVWK* |
| Ga0073922_10188204 | 3300005955 | Sand | QAEVHSLSQDVKALLELANKGKGGFWMGMTIASAVGGVLTFIGERLFK* |
| Ga0075464_102352466 | 3300006805 | Aqueous | LSTDVKSLLELANKGKGGFWMGMTIASFMGGVITFVADRLWK* |
| Ga0075464_103034621 | 3300006805 | Aqueous | AQVETLHGQVTQLSTDVKALLELANKGKGGFWVGMTIASFMGGVITFVADRLWK* |
| Ga0075464_109604992 | 3300006805 | Aqueous | DALQKEVHSLSSDVKALLELANKGKGGFWGGMMVASAVGGLITFVADRVFK* |
| Ga0102859_10201141 | 3300007708 | Estuarine | SKDVKELLELANKGKGGFWMGMTIASAVGGVLTFIGERLFK* |
| Ga0102829_11395501 | 3300009026 | Estuarine | ETLHGQVTQLSTDVKALLELANKGKGGFWMGMTIASIMGGVITFIADKLWK* |
| Ga0102860_12237151 | 3300009056 | Estuarine | VETLQGQVTQLSTDVKALLELANKGKGGFWVGMTIASFMGGIITFIADRVWK* |
| Ga0105104_103714134 | 3300009168 | Freshwater Sediment | HQLSADVKSLLELANKGKGGFWMGMTIASFMGGIVTFIVDRIWK* |
| Ga0114974_102837564 | 3300009183 | Freshwater Lake | EALQKEMHILSADVKALLELANKGKGGFWMGMTIASFAGGAITFLADRLWK* |
| Ga0114974_103707931 | 3300009183 | Freshwater Lake | TQLSTDVKALLELANKGKGGFWMGMTIASFMGGVITFIADKLWK* |
| Ga0129324_102287591 | 3300010368 | Freshwater To Marine Saline Gradient | MHSLSSDVNALLELANKGKGGFWMGMTIASFMGGIVTFVADRIWK* |
| Ga0133913_116635461 | 3300010885 | Freshwater Lake | ALQAEVHSLSKDVKALLELANKGKGGFWMGMTIASFMGGAITFVADRVWK* |
| Ga0133913_118198351 | 3300010885 | Freshwater Lake | LELANKGKGGFWMGMTIASFMGGVITFVADRLWK* |
| Ga0153800_10084101 | 3300011995 | Freshwater | VTQLSTDVKALLELANKGKGGFWMGMTIASFMGGIITFIADRLWK* |
| Ga0157203_10421943 | 3300012663 | Freshwater | HSLSKDVKALLELANKGKGGFWMGMTIASAVGGVLTFIGERVFK* |
| Ga0164292_101678231 | 3300013005 | Freshwater | KEMHLLSADVKSLLELANKGKGGFWMGMTIASFMGGIVTFIVDRIWK* |
| Ga0164292_105668401 | 3300013005 | Freshwater | DVKSLLELANKGKGGFWMGMTIASFMGGVITFVADRLWK* |
| Ga0164295_114563531 | 3300013014 | Freshwater | TLHGQVTQLSNDVKALLELANKGKGGFWMGMTIASFMGGVITFVADRLWK* |
| Ga0177922_113396861 | 3300013372 | Freshwater | KALLELANKGKGGFWMGMTIASFMGGVITFVADRLWK* |
| Ga0181364_10522271 | 3300017701 | Freshwater Lake | ESLQDQVTQLSADVKALLELANKGKGGIWIGMTIASIAGGFITFMTDRLFK |
| Ga0181350_10272586 | 3300017716 | Freshwater Lake | SHLSADVKSLLELANNGKGGFWMGMTIASFMGGVITFVADRLWK |
| Ga0181350_10712171 | 3300017716 | Freshwater Lake | SLSKDVKTLLELANKGKGGFWMGMTIASFMGGVITFVADRVWK |
| Ga0181350_11614291 | 3300017716 | Freshwater Lake | ADVKALLELANKGKGGFWMGMTIASFMGGVITFVADRIWK |
| Ga0181347_11383531 | 3300017722 | Freshwater Lake | LSTDVKALLELANKGKGGIWIGMTIASFMGGVITFIADRLWK |
| Ga0181347_11644063 | 3300017722 | Freshwater Lake | LQVSQLSTDVKSLLELANKGKGGFWMGMTIASFMGGVITFVADRLWK |
| Ga0181362_10714811 | 3300017723 | Freshwater Lake | VESLHGQVSQLSVDVKSLLELANKGKGGFWVGMTIASFMGGVITFVADRLWK |
| Ga0181362_11077601 | 3300017723 | Freshwater Lake | LQTEVHSLSKDVKALLELANKGKGGFWMGMTIASFMGGAITFVADRVWK |
| Ga0181365_11237671 | 3300017736 | Freshwater Lake | VKSLLELANKGKGGFWMGMTIASFMGGVITFVADRLWK |
| Ga0181365_11246341 | 3300017736 | Freshwater Lake | LQLQVSQLSTDVKSLLELANKGKGGFWMGMTIASFMGGVITFVADRLWK |
| Ga0181356_12495073 | 3300017761 | Freshwater Lake | SLHSQVSQLSVDVKSLLELANKGKGGFWVGMTIASFMGGVITFVADRLWK |
| Ga0181343_11492114 | 3300017766 | Freshwater Lake | LQTEVHSLSKDVKTLLELANKGKGGFWMGMTIASFMGGAITFVADRVWK |
| Ga0181358_12875183 | 3300017774 | Freshwater Lake | STDVKSLLELANKGKGGFWVGMTIASFMGGVITFVADRLWK |
| Ga0181357_10981361 | 3300017777 | Freshwater Lake | DVKALLELANKGKGGFWVGMTIASFMGGVITFIADRLWK |
| Ga0181346_11472781 | 3300017780 | Freshwater Lake | ADVKSLLELANKGKGGFWMGMTIASFMGGIVTFIVDRVWK |
| Ga0181355_12408973 | 3300017785 | Freshwater Lake | VEVLQAQVSQLSADVKSLLELANKGKGGFWVGMTIASFMGGVITFVADRLWK |
| Ga0181563_102908294 | 3300018420 | Salt Marsh | ELANKSKGGFWMGMTIASGIGGIVTFFIDRMFKXVL |
| Ga0181359_12169801 | 3300019784 | Freshwater Lake | HSLSKDVKALLELANKGKGGFWMGMTIASFMGGAITFVADRVWK |
| Ga0196909_1019841 | 3300022043 | Aqueous | KVDSMEKDIKELLELANKGKGGFWVTVGIASAIGTFLGFIGHNLFGK |
| Ga0196889_11055742 | 3300022072 | Aqueous | DVKALLELANKGKGGFWMGMTIASIMGGVITFIADKLWK |
| Ga0181354_10898631 | 3300022190 | Freshwater Lake | QVDSLQLQVSQLSTDVKALLELANKGKGGFWMGMTIASFMGGVITFVADRLWK |
| Ga0181354_11558004 | 3300022190 | Freshwater Lake | KALLELANKGKGGIWIGMTIASIAGGFITFMTDRLFK |
| Ga0181354_11827421 | 3300022190 | Freshwater Lake | KALLELANKGKGGFWMGMTIASFMGGAITFVADRVWK |
| Ga0196901_12646411 | 3300022200 | Aqueous | GQVTQLSTDVKALLELANKGKGGFWMGMTIASIMGGVITFIADKLWK |
| Ga0181351_11302555 | 3300022407 | Freshwater Lake | AQVDSLQLQVSQLSTDVKALLELANKGKGGFWMGMTIASFMGGVITFVADRLWK |
| Ga0255141_100072513 | 3300024351 | Freshwater | ALQSEVHSLSQDVKALLELANKGKGGFWMGMTIASAMGGVVTFVGERLMK |
| Ga0255223_10235891 | 3300024480 | Freshwater | VEALQAEVHSLSKDVKALLELANKGKGGFWVGMTIASFMGGIITFIADRVWK |
| Ga0208916_103958281 | 3300025896 | Aqueous | ALQKEVHSLSSDVKALLELANKGKGGFWGGMMVASAVGGLITFVADRVFK |
| Ga0256298_10145165 | 3300026415 | Freshwater | VETLHGQVTQLSTDVKALLELANKGKGGFWVGMTIASFMGGIITFIADRVWK |
| Ga0209850_10105471 | 3300026931 | Sand | LQAEVHSLSQDVKALLELANKGKGGFWMGMTIASAVGGVLTFIGERLFK |
| Ga0255099_10299321 | 3300027128 | Freshwater | ADVKSLLELANKGKGGFWMGMTIASFMGGVITFVADRLWK |
| Ga0255092_10423394 | 3300027137 | Freshwater | GQVTQLSTDVKALLELANKGKGGFWVGMTIASFMGGIITFIADRVWK |
| Ga0255064_10544441 | 3300027138 | Freshwater | TQLSTDVKSLLELANKGKGGFWMGMTIASFMGGVITFVADRLWK |
| Ga0255126_10912753 | 3300027295 | Freshwater | QVSQLSTDVKSLLELANKGKGGFWVGMTIASFMGGVITFVADRLWK |
| Ga0255220_10180121 | 3300027306 | Freshwater | VKALLELANKGKGGFWMGMTIASFMGGIVTFVADRIWK |
| Ga0255091_10147537 | 3300027487 | Freshwater | EVHSLSKDVKALLELANKGKGGFWMGMTIASFMGGAITFVADRVWK |
| Ga0255095_10569634 | 3300027489 | Freshwater | VKALLELANKGKGGFWMGMTIASFMGGVITFVADRLWK |
| Ga0255118_10493434 | 3300027593 | Freshwater | KDVKTLLELANKGKGGFWMGMTIASFMGGVITFVADRLWK |
| Ga0255122_10414004 | 3300027595 | Freshwater | NGQVTQLSTDVKALLELANKGKGGFWMGMTIASFMGGVITFVADRLWK |
| Ga0208974_10793155 | 3300027608 | Freshwater Lentic | TDVKALLELANKGKGGFWVGMTIASFMGGIITFIADRLWK |
| Ga0208974_10862025 | 3300027608 | Freshwater Lentic | VEALNGQVTQLSTDVKALLELANKGKGGFWMGMTIASFMGGVITFVADRLWK |
| Ga0208974_11828721 | 3300027608 | Freshwater Lentic | VHSLSKDVKALLELANKGKGGFWVGMTIASFMGGAITFVADRVWK |
| Ga0208951_11873871 | 3300027621 | Freshwater Lentic | HGQVSQLSTDVKSLLELANKGKGGFWVGMTIASFMGGVITFVADRLWK |
| Ga0209553_100238919 | 3300027688 | Freshwater Lake | VEVLQAQVSQLSADVKSLLELANKGKGGFWVGMTIASFMGGVITFIADRVWK |
| Ga0209492_13080121 | 3300027721 | Freshwater Sediment | KSLLELANKGKGGFWMGMTIASFIGGLITFVADRLWK |
| Ga0209296_10696191 | 3300027759 | Freshwater Lake | LLELANKGKGGFWMGMTIASAVGGVLTFIGERLFK |
| Ga0209296_12670231 | 3300027759 | Freshwater Lake | SLLELANKGKGGFWMGMTIASFMGGIVTFIVDRIWK |
| Ga0209246_101008536 | 3300027785 | Freshwater Lake | DVKALLELANKGKGGFWMGMTIASFMGGVVTFVADRLWK |
| Ga0209246_103797951 | 3300027785 | Freshwater Lake | LLELANKGKGGFWMGMTIASFMGGAITFVADRVWK |
| Ga0209107_102056205 | 3300027797 | Freshwater And Sediment | QLSMDVKSLLELANKGKGGFWMGMTIASFMGGVITFVADRLWK |
| Ga0209353_103719851 | 3300027798 | Freshwater Lake | ALLELANKGKGGFWMGMTIASFMGGAITFVADRVWK |
| Ga0209354_103462261 | 3300027808 | Freshwater Lake | VKALLELANKGKGGFWMGMTIASFMGGAITFVADRVWK |
| Ga0209191_11785951 | 3300027969 | Freshwater Lake | KALLELANKGKGGFWMGMTIASAVGGVLTFIGERLFK |
| Ga0247723_10689365 | 3300028025 | Deep Subsurface Sediment | EALQKEMHQLSADVKSLLELANKGKGGFWMGMTIASFMGGIVTFIVDRVWK |
| Ga0255184_10594411 | 3300028091 | Freshwater | SEVHSLSQDVKTLLELANKGKGGFWMGMTIASAMGGVFTYIGERLMK |
| Ga0307376_107285364 | 3300031578 | Soil | QLSTDVKSLLELANKGKGGFWMGMTIASFMGGVITFVADRLWK |
| Ga0315291_114002921 | 3300031707 | Sediment | LLELANKGKGGFWMGMTIASFMGGVITFVADRVWK |
| Ga0315293_111822853 | 3300031746 | Sediment | LQVQVTQLSTDVKALLELANKGKGGFWMGMTIASFMGGIITFIADRLWK |
| Ga0315290_103072478 | 3300031834 | Sediment | KALLELANKGKGGFWVGMTIASFMGGVITFVADRLWK |
| Ga0315285_105424731 | 3300031885 | Sediment | AQVDSLQLQVSQLSTDVKALLELANKGKGGFWMGMTIASFMGGVITFIADRLWK |
| Ga0315272_107304943 | 3300032018 | Sediment | KSLLELANKGKGGFWMGMTIASFLGGIITFVADRLWK |
| Ga0315284_120304471 | 3300032053 | Sediment | QVTQLSADVKALLELANKGKGGFWMGMTIASAVGGVLTFIGERLFK |
| Ga0315284_121181371 | 3300032053 | Sediment | LSTDVKALLELANKGKGGFWMGMTIASFMGGIITFIADRLWK |
| Ga0315283_123200291 | 3300032164 | Sediment | TQLSTDVKALLELANKGKGGFWVGMTIASFMGGVITFVADRLWK |
| Ga0315268_110977581 | 3300032173 | Sediment | VKALLELANKGKGGFWVGMTIASFMGGVITFIADRLWK |
| Ga0315268_111285564 | 3300032173 | Sediment | LQLQVSQLSTDVKALLELANKGKGGFWMGMTIASFMGGVITFVADRLWK |
| Ga0315286_110144131 | 3300032342 | Sediment | VHSLSKDVKELLELANKGKGGFWMGMTIASAVGGVLTFIGERLFK |
| Ga0334722_104413565 | 3300033233 | Sediment | LSTDVKALLELANKGKGGFWVGMTIASFMGGVITFVADRLWK |
| Ga0334979_0644856_7_135 | 3300033996 | Freshwater | LSTDVKSLLELANKGKGGFWVGMTIASFMGGVITFVADRLWK |
| Ga0335005_0314336_3_119 | 3300034022 | Freshwater | VKALLELANKGKGGFWMGMTIASFMGGVITFIADRLWK |
| Ga0334995_0139251_1619_1768 | 3300034062 | Freshwater | LHGQVTQLSHDVKSLLELANKGKGGFWMGMTIASFMGGVITFVADRLWK |
| Ga0335012_0346712_32_160 | 3300034093 | Freshwater | LSHDVKSLLELANKGKGGFWMGMTIASFMGGVITFVADRLWK |
| Ga0335031_0177981_1324_1452 | 3300034104 | Freshwater | LSADVKALLELANKGKGGFWMGMTIASFMGGIVTFVADRLWK |
| Ga0335066_0085877_1870_2010 | 3300034112 | Freshwater | VSAMQSDVKALLELANKSKGSLWTGMAIASALGGVGTLLVERLFRS |
| Ga0335056_0340382_690_821 | 3300034120 | Freshwater | QLSHDVKSLLELANKGKGGFWMGMTIASFMGGVITFVADRLWK |
| Ga0335049_0706923_476_607 | 3300034272 | Freshwater | SLSADVKALLELANKGKGGFWMGMTIASFMGGIITFIADRLWK |
| ⦗Top⦘ |