Metagenome / Metatranscriptome Family F093445

Basic Information
Family ID	F093445
Family Type	Metagenome / Metatranscriptome
Number of Sequences	106
Average Sequence Length	40 residues
Representative Sequence	LARGAYKVLYQAGYRNMVILDEGIPGWAKKRYPTEKTVGKS
Number of Associated Samples	87
Number of Associated Scaffolds	106

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	79.25 %
% of genes near scaffold ends (potentially truncated)	23.58 %
% of genes from short scaffolds (< 2000 bps)	85.85 %
Associated GOLD sequencing projects	82
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.33

Most Common Taxonomy
Group	Bacteria (96.226 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (9.434 % of family members)
Environment Ontology (ENVO)	Unclassified (30.189 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (33.019 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 31.88% β-sheet: 0.00% Coil/Unstructured: 68.12%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 106 Family Scaffolds
PF00581	Rhodanese	48.11
PF01523	PmbA_TldD	14.15
PF00456	Transketolase_N	6.60
PF03454	MoeA_C	2.83
PF02779	Transket_pyr	1.89
PF00535	Glycos_transf_2	0.94
PF07978	NIPSNAP	0.94
PF03737	RraA-like	0.94
PF06271	RDD	0.94
PF00005	ABC_tran	0.94

COG ID	Name	Functional Category	% Frequency in 106 Family Scaffolds
COG0312	Zn-dependent protease PmbA/TldA or its inactivated homolog	General function prediction only [R]	14.15
COG0021	Transketolase	Carbohydrate transport and metabolism [G]	6.60
COG3959	Transketolase, N-terminal subunit	Carbohydrate transport and metabolism [G]	6.60
COG0303	Molybdopterin Mo-transferase (molybdopterin biosynthesis)	Coenzyme transport and metabolism [H]	2.83
COG0684	RNA degradosome component RraA (regulator of RNase E activity)	Translation, ribosomal structure and biogenesis [J]	0.94
COG1714	Uncharacterized membrane protein YckC, RDD family	Function unknown [S]	0.94

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	96.23 %
Unclassified	root	N/A	3.77 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	96.23 %
Unclassified	root	N/A	3.77 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	96.23 %
Unclassified	root	N/A	3.77 %

Name	Rank	Taxonomy	Distribution
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	26.42 %
Unclassified	root	N/A	3.77 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	26.42 %
Unclassified	root	N/A	3.77 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	25.47 %
Unclassified	root	N/A	3.77 %
Patescibacteria group	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group	0.94 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	25.47 %
Unclassified	root	N/A	3.77 %
Parcubacteria group	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group	0.94 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	25.47 %
Unclassified	root	N/A	3.77 %
Candidatus Parcubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Parcubacteria	0.94 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.94 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000364\|INPhiseqgaiiFebDRAFT_101890398	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	604	Open in IMG/M
3300003319\|soilL2_10211153	All Organisms → cellular organisms → Bacteria	1358	Open in IMG/M
3300003995\|Ga0055438_10090143	All Organisms → cellular organisms → Bacteria	853	Open in IMG/M
3300004114\|Ga0062593_100970154	Not Available	868	Open in IMG/M
3300004114\|Ga0062593_103238433	All Organisms → cellular organisms → Bacteria	522	Open in IMG/M
3300005186\|Ga0066676_11106278	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	522	Open in IMG/M
3300005328\|Ga0070676_10726741	All Organisms → cellular organisms → Bacteria	727	Open in IMG/M
3300005332\|Ga0066388_106644257	All Organisms → cellular organisms → Bacteria	583	Open in IMG/M
3300005332\|Ga0066388_107468046	All Organisms → cellular organisms → Bacteria	549	Open in IMG/M
3300005440\|Ga0070705_101350294	All Organisms → cellular organisms → Bacteria	592	Open in IMG/M
3300005445\|Ga0070708_100231428	All Organisms → cellular organisms → Bacteria	1734	Open in IMG/M
3300005467\|Ga0070706_101578085	Not Available	599	Open in IMG/M
3300005471\|Ga0070698_100471664	All Organisms → cellular organisms → Bacteria	1191	Open in IMG/M
3300005577\|Ga0068857_100622929	All Organisms → cellular organisms → Bacteria	1021	Open in IMG/M
3300005617\|Ga0068859_101082476	All Organisms → cellular organisms → Bacteria	881	Open in IMG/M
3300005617\|Ga0068859_101764544	All Organisms → cellular organisms → Bacteria	683	Open in IMG/M
3300005618\|Ga0068864_100238450	All Organisms → cellular organisms → Bacteria	1684	Open in IMG/M
3300005713\|Ga0066905_101318557	All Organisms → cellular organisms → Bacteria	650	Open in IMG/M
3300005764\|Ga0066903_100357120	All Organisms → cellular organisms → Bacteria	2368	Open in IMG/M
3300005764\|Ga0066903_101091638	All Organisms → cellular organisms → Bacteria	1470	Open in IMG/M
3300005764\|Ga0066903_103299929	All Organisms → cellular organisms → Bacteria	872	Open in IMG/M
3300005764\|Ga0066903_105525919	All Organisms → cellular organisms → Bacteria	666	Open in IMG/M
3300005764\|Ga0066903_106134671	All Organisms → cellular organisms → Bacteria	629	Open in IMG/M
3300005843\|Ga0068860_100081490	All Organisms → cellular organisms → Bacteria	3077	Open in IMG/M
3300005981\|Ga0081538_10010063	All Organisms → cellular organisms → Bacteria	7796	Open in IMG/M
3300006845\|Ga0075421_100125238	All Organisms → cellular organisms → Bacteria	3223	Open in IMG/M
3300006847\|Ga0075431_100275038	All Organisms → cellular organisms → Bacteria	1706	Open in IMG/M
3300006852\|Ga0075433_11092376	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Parcubacteria	694	Open in IMG/M
3300006854\|Ga0075425_103117670	All Organisms → cellular organisms → Bacteria	505	Open in IMG/M
3300006894\|Ga0079215_10538085	All Organisms → cellular organisms → Bacteria	741	Open in IMG/M
3300009090\|Ga0099827_10197748	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1670	Open in IMG/M
3300009094\|Ga0111539_10983796	All Organisms → cellular organisms → Bacteria	981	Open in IMG/M
3300009101\|Ga0105247_11878215	Not Available	500	Open in IMG/M
3300009148\|Ga0105243_10704016	All Organisms → cellular organisms → Bacteria	985	Open in IMG/M
3300009176\|Ga0105242_10790131	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	938	Open in IMG/M
3300009553\|Ga0105249_10139559	All Organisms → cellular organisms → Bacteria	2322	Open in IMG/M
3300009818\|Ga0105072_1084780	All Organisms → cellular organisms → Bacteria	625	Open in IMG/M
3300010046\|Ga0126384_10393072	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1169	Open in IMG/M
3300010048\|Ga0126373_12111468	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	625	Open in IMG/M
3300010359\|Ga0126376_10986198	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	841	Open in IMG/M
3300010361\|Ga0126378_11242687	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	841	Open in IMG/M
3300010362\|Ga0126377_12964596	All Organisms → cellular organisms → Bacteria	548	Open in IMG/M
3300010376\|Ga0126381_100420187	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1868	Open in IMG/M
3300010376\|Ga0126381_103581662	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	609	Open in IMG/M
3300010391\|Ga0136847_11285595	All Organisms → cellular organisms → Bacteria	1332	Open in IMG/M
3300010391\|Ga0136847_12969528	All Organisms → cellular organisms → Bacteria	637	Open in IMG/M
3300010398\|Ga0126383_12769098	All Organisms → cellular organisms → Bacteria	572	Open in IMG/M
3300011419\|Ga0137446_1032374	All Organisms → cellular organisms → Bacteria	1116	Open in IMG/M
3300011433\|Ga0137443_1151325	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	687	Open in IMG/M
3300011439\|Ga0137432_1151299	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	745	Open in IMG/M
3300012204\|Ga0137374_10001017	All Organisms → cellular organisms → Bacteria	31085	Open in IMG/M
3300012349\|Ga0137387_10537271	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	848	Open in IMG/M
3300012923\|Ga0137359_11414925	All Organisms → cellular organisms → Bacteria	583	Open in IMG/M
3300014321\|Ga0075353_1152626	All Organisms → cellular organisms → Bacteria	584	Open in IMG/M
3300014968\|Ga0157379_11892313	All Organisms → cellular organisms → Bacteria	588	Open in IMG/M
3300015259\|Ga0180085_1004405	All Organisms → cellular organisms → Bacteria	3970	Open in IMG/M
3300015372\|Ga0132256_103896230	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	502	Open in IMG/M
3300015373\|Ga0132257_100804926	All Organisms → cellular organisms → Bacteria	1173	Open in IMG/M
3300015373\|Ga0132257_102501345	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	671	Open in IMG/M
3300015374\|Ga0132255_102590789	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	775	Open in IMG/M
3300017959\|Ga0187779_10111131	All Organisms → cellular organisms → Bacteria	1660	Open in IMG/M
3300018058\|Ga0187766_10032562	All Organisms → cellular organisms → Bacteria	3030	Open in IMG/M
3300018060\|Ga0187765_10035090	All Organisms → cellular organisms → Bacteria	2502	Open in IMG/M
3300018060\|Ga0187765_10324374	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	930	Open in IMG/M
3300018061\|Ga0184619_10396503	All Organisms → cellular organisms → Bacteria	624	Open in IMG/M
3300018063\|Ga0184637_10018363	All Organisms → cellular organisms → Bacteria	4205	Open in IMG/M
3300018084\|Ga0184629_10716946	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	503	Open in IMG/M
3300018089\|Ga0187774_11447522	Not Available	506	Open in IMG/M
3300018433\|Ga0066667_11602693	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	580	Open in IMG/M
3300019458\|Ga0187892_10001576	All Organisms → cellular organisms → Bacteria	51346	Open in IMG/M
3300019458\|Ga0187892_10004442	All Organisms → cellular organisms → Bacteria	23511	Open in IMG/M
3300020060\|Ga0193717_1084301	All Organisms → cellular organisms → Bacteria	1033	Open in IMG/M
3300020063\|Ga0180118_1345140	All Organisms → cellular organisms → Bacteria	780	Open in IMG/M
3300021051\|Ga0206224_1005037	All Organisms → cellular organisms → Bacteria	1378	Open in IMG/M
3300021063\|Ga0206227_1033993	All Organisms → cellular organisms → Bacteria	890	Open in IMG/M
3300021560\|Ga0126371_10278541	All Organisms → cellular organisms → Bacteria	1794	Open in IMG/M
3300021560\|Ga0126371_11810474	All Organisms → cellular organisms → Bacteria	732	Open in IMG/M
3300025289\|Ga0209002_10729257	All Organisms → cellular organisms → Bacteria	513	Open in IMG/M
3300025549\|Ga0210094_1034227	All Organisms → cellular organisms → Bacteria	861	Open in IMG/M
3300025560\|Ga0210108_1088125	All Organisms → cellular organisms → Bacteria	614	Open in IMG/M
3300025900\|Ga0207710_10309781	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	799	Open in IMG/M
3300025910\|Ga0207684_10295549	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1396	Open in IMG/M
3300025935\|Ga0207709_10343115	All Organisms → cellular organisms → Bacteria	1125	Open in IMG/M
3300025941\|Ga0207711_10529724	All Organisms → cellular organisms → Bacteria	1099	Open in IMG/M
3300026075\|Ga0207708_11184023	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	668	Open in IMG/M
3300026095\|Ga0207676_11282885	All Organisms → cellular organisms → Bacteria	727	Open in IMG/M
3300026524\|Ga0209690_1144455	All Organisms → cellular organisms → Bacteria	885	Open in IMG/M
3300028807\|Ga0307305_10063981	All Organisms → cellular organisms → Bacteria	1696	Open in IMG/M
3300028814\|Ga0307302_10596469	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	549	Open in IMG/M
3300031226\|Ga0307497_10598691	All Organisms → cellular organisms → Bacteria	557	Open in IMG/M
3300031740\|Ga0307468_100154731	All Organisms → cellular organisms → Bacteria	1479	Open in IMG/M
3300031740\|Ga0307468_102380047	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	516	Open in IMG/M
3300031820\|Ga0307473_10866331	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	650	Open in IMG/M
3300031949\|Ga0214473_10036977	All Organisms → cellular organisms → Bacteria → Proteobacteria	5733	Open in IMG/M
3300031949\|Ga0214473_12078168	All Organisms → cellular organisms → Bacteria	551	Open in IMG/M
3300032076\|Ga0306924_11797867	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	639	Open in IMG/M
3300032174\|Ga0307470_10505815	All Organisms → cellular organisms → Bacteria	882	Open in IMG/M
3300032174\|Ga0307470_10657050	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	792	Open in IMG/M
3300032180\|Ga0307471_100815646	All Organisms → cellular organisms → Bacteria	1100	Open in IMG/M
3300032180\|Ga0307471_101483591	All Organisms → cellular organisms → Bacteria	837	Open in IMG/M
3300032180\|Ga0307471_102799777	All Organisms → cellular organisms → Bacteria	619	Open in IMG/M
3300032397\|Ga0315287_11022798	All Organisms → cellular organisms → Bacteria	961	Open in IMG/M
3300032770\|Ga0335085_10962934	All Organisms → cellular organisms → Bacteria	925	Open in IMG/M
3300033004\|Ga0335084_10064192	All Organisms → cellular organisms → Bacteria	3797	Open in IMG/M
3300033004\|Ga0335084_10082486	All Organisms → cellular organisms → Bacteria	3335	Open in IMG/M
3300034165\|Ga0364942_0280015	All Organisms → cellular organisms → Bacteria	545	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	76.42%
Host-Associated	Host-Associated	23.58%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	63.21%
Plants	Host-Associated → Plants	23.58%
Aquatic	Environmental → Aquatic	13.21%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	58.49%
Rhizosphere	Host-Associated → Plants → Rhizosphere	14.15%
Rhizoplane	Host-Associated → Plants → Rhizoplane	8.49%
Sediment	Environmental → Aquatic → Sediment	6.60%
Freshwater	Environmental → Aquatic → Freshwater	3.77%
Marine	Environmental → Aquatic → Marine	2.83%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	1.89%
Cave	Environmental → Terrestrial → Cave	1.89%
Floodplain	Environmental → Terrestrial → Floodplain	0.94%
Roots	Host-Associated → Plants → Roots	0.94%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	35.85%
Loam	Environmental → Terrestrial → Soil → Loam	13.21%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	12.26%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	8.49%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	6.60%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.66%
Lake	Environmental → Aquatic → Freshwater → Lake	2.83%
Wetlands	Environmental → Aquatic → Marine → Wetlands	2.83%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.83%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	1.89%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	1.89%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.89%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.94%
Sand	Environmental → Terrestrial → Soil → Sand	0.94%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.94%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.94%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	17.92%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	12.26%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	8.49%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	8.49%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	7.55%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	6.60%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.66%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.66%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	3.77%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	3.77%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	2.83%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	2.83%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.83%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	1.89%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	1.89%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	1.89%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.89%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.94%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.94%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.94%
Unclassified	Host-Associated → Plants → Roots → Rhizosphere → Unclassified	0.94%

Habitat	Taxonomy	Distribution
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	9.43%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	7.55%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	7.55%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	5.66%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	4.72%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	4.72%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	4.72%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	3.77%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.77%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	3.77%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	3.77%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	2.83%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	2.83%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	2.83%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	2.83%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	2.83%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.83%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment	1.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	1.89%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	1.89%
Bio-Ooze	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze	1.89%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.94%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.94%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.94%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.94%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	0.94%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.94%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.94%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.94%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.94%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.94%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.94%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere	0.94%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.94%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.94%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.94%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300003319	Sugarcane bulk soil Sample L2	Environmental	Open in IMG/M
3300003995	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300005186	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125	Environmental	Open in IMG/M
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Environmental	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006894	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009818	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010391	Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300011419	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2	Environmental	Open in IMG/M
3300011433	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2	Environmental	Open in IMG/M
3300011439	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2	Environmental	Open in IMG/M
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental	Open in IMG/M
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental	Open in IMG/M
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental	Open in IMG/M
3300014321	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1	Environmental	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015259	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D	Environmental	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017959	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG	Environmental	Open in IMG/M
3300018058	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG	Environmental	Open in IMG/M
3300018060	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG	Environmental	Open in IMG/M
3300018061	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1	Environmental	Open in IMG/M
3300018063	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2	Environmental	Open in IMG/M
3300018084	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1	Environmental	Open in IMG/M
3300018089	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300019458	Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG	Environmental	Open in IMG/M
3300020060	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2	Environmental	Open in IMG/M
3300020063	Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021051	Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos A1	Environmental	Open in IMG/M
3300021063	Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300025289	Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2	Environmental	Open in IMG/M
3300025549	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 (SPAdes)	Environmental	Open in IMG/M
3300025560	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 (SPAdes)	Environmental	Open in IMG/M
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026524	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)	Environmental	Open in IMG/M
3300028807	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186	Environmental	Open in IMG/M
3300028814	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183	Environmental	Open in IMG/M
3300031226	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300031949	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197	Environmental	Open in IMG/M
3300032076	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032397	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0	Environmental	Open in IMG/M
3300032770	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5	Environmental	Open in IMG/M
3300033004	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4	Environmental	Open in IMG/M
3300034165	Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
INPhiseqgaiiFebDRAFT_1018903982	3300000364	Soil	LARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTEXKS*
soilL2_102111532	3300003319	Sugarcane Root And Bulk Soil	LARAAYRILYQAGYRNMAILDEGIPGWHAKKYPTESSAGPRGKTG*
Ga0055438_100901432	3300003995	Natural And Restored Wetlands	LARGAYKVLYLAGYRNMLILDEGIPGWVQKRYPVQSTGGKG*
Ga0062593_1009701541	3300004114	Soil	CPHALARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTERSEGKS*
Ga0062593_1032384332	3300004114	Soil	LARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTVGKS*
Ga0066676_111062782	3300005186	Soil	LARGAFKVLYQAGYRNMVILDEGIPGWARKRYPTERTAAG*
Ga0070676_107267411	3300005328	Miscanthus Rhizosphere	LARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKSEGKS*
Ga0066388_1066442572	3300005332	Tropical Forest Soil	LARGAYRVLYLAGYRNMMILDEGIPGWVQKHYPVDTAVGKG*
Ga0066388_1074680461	3300005332	Tropical Forest Soil	LARAAYKILYQAGYRNMAILDEGIPGWHAKNYPTEAGAGSRGKAG
Ga0070705_1013502942	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	LARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTEGKS*
Ga0070708_1002314283	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	LARGAFKLLYLAGYRNMMILDEGLPGWAEKRYPVEKTAAKS*
Ga0070706_1015780852	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	LARGAYKVLYQAGYRNMVILDEGIPGWAKKRYPTEKTVGKS*
Ga0070698_1004716641	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	LARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTERTEGKS*
Ga0068857_1006229292	3300005577	Corn Rhizosphere	LARAAYRILYQAGYRNMAILDEGIPGWHGKKYPTESSAPPRGKSG*
Ga0068859_1010824762	3300005617	Switchgrass Rhizosphere	RGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTVGKS*
Ga0068859_1017645442	3300005617	Switchgrass Rhizosphere	LARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTEGKG*
Ga0068864_1002384502	3300005618	Switchgrass Rhizosphere	LARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKAEAKS*
Ga0066905_1013185572	3300005713	Tropical Forest Soil	LARAAYKVLYQAGFRNMAILDEGIPGWARKRYPTETTGKG*
Ga0066903_1003571202	3300005764	Tropical Forest Soil	LARAAYKVLYNAGYRNMAILDEGIPGWARKRYPTETTGKG*
Ga0066903_1010916381	3300005764	Tropical Forest Soil	VLYLAGYRNMAILDEGIPGWADKGYPVEASSGKG*
Ga0066903_1032999292	3300005764	Tropical Forest Soil	MARAAYKMLYLAGYRNMAILDEGIPGWASKGYPVDKS*
Ga0066903_1055259192	3300005764	Tropical Forest Soil	LARGAYKVLYQAGYRNMAILDEGIPGWAKKRYPTEKTVGKS*
Ga0066903_1061346712	3300005764	Tropical Forest Soil	LARGAYKLLYLAGYRNMSILDEGIPGWADKGYPVDKGKS*
Ga0068860_1000814904	3300005843	Switchgrass Rhizosphere	AYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTVGKS*
Ga0081538_100100636	3300005981	Tabebuia Heterophylla Rhizosphere	LARGAYKILYLAGYRNMLILDEGLPGWVDNRYPTARKP*
Ga0075421_1001252383	3300006845	Populus Rhizosphere	LARAAYRILYQARYRNMAILDEGIPGWHAKKYPTESSAGPPGKTG*
Ga0075431_1002750383	3300006847	Populus Rhizosphere	LARAAYRILYQARYRNMAILDEGIPGWHAKKYPTESSAGPRGKTG*
Ga0075433_110923761	3300006852	Populus Rhizosphere	LARGAYKVLYLAGRRNMVILDEGLPGWAGKEYPLAKTQKTG*
Ga0075425_1031176701	3300006854	Populus Rhizosphere	LARAAYKILYLAGYRNMMILDEGIPGWAEKGYPVEPSAAKS*
Ga0079215_105380852	3300006894	Agricultural Soil	LARGAYRILYAAGYRNMFILDEGLPGWIAQGYPTEP*
Ga0099827_101977482	3300009090	Vadose Zone Soil	VLYIAGYRNMMILDEGIPGWYAKKYPTEATTSKG*
Ga0111539_109837962	3300009094	Populus Rhizosphere	LARAAYRILYQAGYRNMAILDEGIPGWHGKKYPTESSAPLRGKSG*
Ga0105247_118782152	3300009101	Switchgrass Rhizosphere	LARGAYKVLYDAGYRNMVILDEGLLGWAKKRYPTEKSEGKS*
Ga0105243_107040162	3300009148	Miscanthus Rhizosphere	LARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPMEKTEGKS*
Ga0105242_107901311	3300009176	Miscanthus Rhizosphere	LARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEMSVGKS*
Ga0105249_101395591	3300009553	Switchgrass Rhizosphere	GAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTVGKS*
Ga0105072_10847802	3300009818	Groundwater Sand	LARGAYKVLYQAGYRNMVILDEGIPGWAQKRYPTAKTVAKS*
Ga0126384_103930723	3300010046	Tropical Forest Soil	MARAAYRTLYQAGYRNMMILDEGIPGWAEKRYPTAMTAARRP*
Ga0126373_121114682	3300010048	Tropical Forest Soil	MARAAYKVLYLAGFRNMAILDEGIPGWASKGYPVDKS*
Ga0126376_109861982	3300010359	Tropical Forest Soil	LARGAYKILYLAGRRNMVILDEGLPGWVDKEYPLAKTG*
Ga0126378_112426871	3300010361	Tropical Forest Soil	KILYLAGYRNMMILDEGIPGWADKGYPVEQSAAKS*
Ga0126377_129645962	3300010362	Tropical Forest Soil	LARAAYKVLYQEGYRNMVILDEGIPGWAKKRYPTEATGKS*
Ga0126381_1004201872	3300010376	Tropical Forest Soil	MARAAYKVLYLAGYRNMAILDEGIPGWASKGYPVDKS*
Ga0126381_1035816623	3300010376	Tropical Forest Soil	LARAAYKVLYNAGYRNMAILDEGITGWARKRYPTETTGKG*
Ga0136847_112855953	3300010391	Freshwater Sediment	LARGANEILYVAGYRNMLILDEGLPGWNQKKYPTAVTAVRQR*
Ga0136847_129695282	3300010391	Freshwater Sediment	HALARGANEILYTAGYRNMLILDEGIPGWHEKKYPTAVTAVRQQ*
Ga0126383_127690982	3300010398	Tropical Forest Soil	LARAAYKVLYQAGYRNMAILDEGIPGWARRRYPTETTGQG*
Ga0137446_10323742	3300011419	Soil	LARGANEILYTAGYRNMLILDEGIPGWHQKRYPTAVTAVRQR*
Ga0137443_11513252	3300011433	Soil	LARAAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTVEKS*
Ga0137432_11512991	3300011439	Soil	PARGAYRTLYTAGFRNMLILDEGLPGRMAQGYPTKP*
Ga0137374_1000101718	3300012204	Vadose Zone Soil	VLYLAGYRNMMILDEGIPGWYAKKYPTEATAPKG*
Ga0137387_105372712	3300012349	Vadose Zone Soil	LARGAYKVLYQAGYRNMTILDEGIPGWVDKSYPTDKSAKG*
Ga0137359_114149252	3300012923	Vadose Zone Soil	VLYLAGYRNMLILDEGIPGWAEKGYPLEKPAAKS*
Ga0075353_11526262	3300014321	Natural And Restored Wetlands	VLYLAGYRNMSILDEGIPGWADKGYPLEKSVRKS*
Ga0157379_118923132	3300014968	Switchgrass Rhizosphere	LARGASKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTEGKS*
Ga0180085_10044052	3300015259	Soil	LARGAYKVLYLAGYRNMTILDEGLPGWDQKGYPLEKTAAKG*
Ga0132256_1038962302	3300015372	Arabidopsis Rhizosphere	LARAAYKILYQAGYRNMAILYEGIPGWHAKQYPTDSGAGARGKPG
Ga0132257_1008049262	3300015373	Arabidopsis Rhizosphere	LARAAYKILYLAGYRNMMILDEGIPGWTDKGYPVEQSAAKS*
Ga0132257_1025013452	3300015373	Arabidopsis Rhizosphere	LARAAYKILYQAGYRSLAILDEGIPGWHAKKYPTESGAAARGKAG*
Ga0132255_1025907892	3300015374	Arabidopsis Rhizosphere	YRVLYQAGYRNMVILDEGLPGWHAKNYPTEVTASRGKSG*
Ga0187779_101111313	3300017959	Tropical Peatland	LARGAYKILYLAGYRNMSILDEGIPGWADKGYPLEEGPRKG
Ga0187766_100325623	3300018058	Tropical Peatland	VLYLAGYRNLAILDEGMPGWADRGYPVEGSSKQAS
Ga0187765_100350902	3300018060	Tropical Peatland	VLYLAGYRNLAILDEGMPGWADRGYPVEGSSKKAS
Ga0187765_103243742	3300018060	Tropical Peatland	MARAAYKILYLAGYRNMQILDEGIPGWANKGYPIAEASATRG
Ga0184619_103965033	3300018061	Groundwater Sediment	LARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEK
Ga0184637_100183635	3300018063	Groundwater Sediment	VLARGAFKILYQAGYRNMAILDEGIPGWQAKKYPTASAAATPKTRT
Ga0184629_107169462	3300018084	Groundwater Sediment	LARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTVGKS
Ga0187774_114475221	3300018089	Tropical Peatland	LARGAYKVLYLVGFRNMSILDEGIPGWARRGYPVDQSARKGP
Ga0066667_116026932	3300018433	Grasslands Soil	ARAAYRTLYQAGYRNMMILDEGIPGWTEKRYPTAVTAARRP
Ga0187892_1000157648	3300019458	Bio-Ooze	MARAAYKILYQAGHRNMVILDEGLPDWARKRYPTEGPDRRS
Ga0187892_1000444219	3300019458	Bio-Ooze	MARAAYKTLYQAGYRNMAILDEGIPGWVKANYPTVRGTKKS
Ga0193717_10843013	3300020060	Soil	LARGAYKVLYDAGYRNMVILDEGIPGWAKKRYPTEKTVGKS
Ga0180118_13451402	3300020063	Groundwater Sediment	LARGAYKVLYLAGYRNMTILDEGLPGWDQKGYPLEKTAAKG
Ga0206224_10050372	3300021051	Deep Subsurface Sediment	LARGANEILYTAAYRNMLILDEGIPGWHQKKYPTAVTAVRQR
Ga0206227_10339932	3300021063	Deep Subsurface Sediment	LARGANEILYTAGYRNMLILDEGIPGWHQKRYPTAVTVVRRP
Ga0126371_102785413	3300021560	Tropical Forest Soil	MARAAYKVLYLAGFRNMAILDEGIPGWASKGYPVDKS
Ga0126371_118104742	3300021560	Tropical Forest Soil	MARAAYKVLYLAGYRNMAILDEGIPGWASKGYPVDKS
Ga0209002_107292572	3300025289	Soil	ASEILYAAGYRNMLILDEGMPGWDKKKYPTAVTALRKP
Ga0210094_10342272	3300025549	Natural And Restored Wetlands	LARGAYKVLYLAGYRNMLILDEGIPGWVQKRYPVQSTGGKG
Ga0210108_10881251	3300025560	Natural And Restored Wetlands	GANEILYVAGYRNMVILNEGIPGWHEKNYPTAVTAARRP
Ga0207710_103097813	3300025900	Switchgrass Rhizosphere	LARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKSEGKS
Ga0207684_102955492	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	LARGAFKLLYLAGYRNMMILDEGLPGWAEKRYPVEKTAAKS
Ga0207709_103431153	3300025935	Miscanthus Rhizosphere	LARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPMEKTEGKS
Ga0207711_105297243	3300025941	Switchgrass Rhizosphere	LARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTEGKG
Ga0207708_111840231	3300026075	Corn, Switchgrass And Miscanthus Rhizosphere	LARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTEGTS
Ga0207676_112828851	3300026095	Switchgrass Rhizosphere	HALARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKAEAKS
Ga0209690_11444552	3300026524	Soil	LARAAYRTLYQAGYRNMMILDEGIPGWTEKRYPTAVTAARRP
Ga0307305_100639811	3300028807	Soil	ARGAYRILYVAGYRNMLILDEGLPGWIAQGYPTEP
Ga0307302_105964691	3300028814	Soil	LARGAYKVLYDVGYRNMVILDEGLPGWAKKRYPTEKTEGKS
Ga0307497_105986912	3300031226	Soil	LARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTEGKS
Ga0307468_1001547313	3300031740	Hardwood Forest Soil	LARGAYKVLYQAGYRNMVILDEGIPGWAKKRYPTEKTVGKS
Ga0307468_1023800472	3300031740	Hardwood Forest Soil	LARAAYKVLYQAGYRNMAILDEGIPGWHAKNYPTDSTPRGKSS
Ga0307473_108663313	3300031820	Hardwood Forest Soil	LARGAYKVLYQAGYRNMAILDEGIPGWAKKRYPTEKTVGKS
Ga0214473_100369773	3300031949	Soil	LARGAYKVLYRAGYRNMVILDEGIPGWVQKRYPTARTAGKS
Ga0214473_120781681	3300031949	Soil	LARGAYKVLYQAGYRNMVILDEGIPGWAQKRYPTAR
Ga0306924_117978672	3300032076	Soil	ELARAAYKILYLAGHRNMMILDEGIPGWADKGYPVEPSAAKS
Ga0307470_105058151	3300032174	Hardwood Forest Soil	ACPHALARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTEGKS
Ga0307470_106570503	3300032174	Hardwood Forest Soil	LARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKSAGKS
Ga0307471_1008156462	3300032180	Hardwood Forest Soil	AFKLLYLAGYRNMMILDEGLPGWADKRYPVEKTAAKS
Ga0307471_1014835912	3300032180	Hardwood Forest Soil	LARGAYQVLYQAGYRNMVILDEGIPGWVDKHYPTETSAAS
Ga0307471_1027997772	3300032180	Hardwood Forest Soil	VQARAAFGILYQAGFRNMAILDEGIPGWDAKRYPTESTAGKRTS
Ga0315287_110227981	3300032397	Sediment	LARGANEVLYVAGYRNMAILDEGIPGWHEKKYPTAVTAARKP
Ga0335085_109629342	3300032770	Soil	LARGAYKVLYLAGYRNMVILDEGIPGWVQKHYPVETAVGKG
Ga0335084_100641924	3300033004	Soil	LARGAYKVLYQAGYRNMAILDEGIPGWAKKRYPTEKTVGKG
Ga0335084_100824862	3300033004	Soil	LARGAFKILYRAGYRNAAILDEGIPGWADKQYPVASGPG
Ga0364942_0280015_240_368	3300034165	Sediment	LARGANEILYTAGYRNMLILDEGIPGWHQKRYPTAVTAVRRP

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.33
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.33
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F093445

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign