| Basic Information | |
|---|---|
| Family ID | F093445 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 40 residues |
| Representative Sequence | LARGAYKVLYQAGYRNMVILDEGIPGWAKKRYPTEKTVGKS |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 79.25 % |
| % of genes near scaffold ends (potentially truncated) | 23.58 % |
| % of genes from short scaffolds (< 2000 bps) | 85.85 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.226 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (9.434 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.189 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (33.019 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.88% β-sheet: 0.00% Coil/Unstructured: 68.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF00581 | Rhodanese | 48.11 |
| PF01523 | PmbA_TldD | 14.15 |
| PF00456 | Transketolase_N | 6.60 |
| PF03454 | MoeA_C | 2.83 |
| PF02779 | Transket_pyr | 1.89 |
| PF00535 | Glycos_transf_2 | 0.94 |
| PF07978 | NIPSNAP | 0.94 |
| PF03737 | RraA-like | 0.94 |
| PF06271 | RDD | 0.94 |
| PF00005 | ABC_tran | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG0312 | Zn-dependent protease PmbA/TldA or its inactivated homolog | General function prediction only [R] | 14.15 |
| COG0021 | Transketolase | Carbohydrate transport and metabolism [G] | 6.60 |
| COG3959 | Transketolase, N-terminal subunit | Carbohydrate transport and metabolism [G] | 6.60 |
| COG0303 | Molybdopterin Mo-transferase (molybdopterin biosynthesis) | Coenzyme transport and metabolism [H] | 2.83 |
| COG0684 | RNA degradosome component RraA (regulator of RNase E activity) | Translation, ribosomal structure and biogenesis [J] | 0.94 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.23 % |
| Unclassified | root | N/A | 3.77 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101890398 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 604 | Open in IMG/M |
| 3300003319|soilL2_10211153 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
| 3300003995|Ga0055438_10090143 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300004114|Ga0062593_100970154 | Not Available | 868 | Open in IMG/M |
| 3300004114|Ga0062593_103238433 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300005186|Ga0066676_11106278 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 522 | Open in IMG/M |
| 3300005328|Ga0070676_10726741 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300005332|Ga0066388_106644257 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300005332|Ga0066388_107468046 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300005440|Ga0070705_101350294 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300005445|Ga0070708_100231428 | All Organisms → cellular organisms → Bacteria | 1734 | Open in IMG/M |
| 3300005467|Ga0070706_101578085 | Not Available | 599 | Open in IMG/M |
| 3300005471|Ga0070698_100471664 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300005577|Ga0068857_100622929 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300005617|Ga0068859_101082476 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300005617|Ga0068859_101764544 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300005618|Ga0068864_100238450 | All Organisms → cellular organisms → Bacteria | 1684 | Open in IMG/M |
| 3300005713|Ga0066905_101318557 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300005764|Ga0066903_100357120 | All Organisms → cellular organisms → Bacteria | 2368 | Open in IMG/M |
| 3300005764|Ga0066903_101091638 | All Organisms → cellular organisms → Bacteria | 1470 | Open in IMG/M |
| 3300005764|Ga0066903_103299929 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300005764|Ga0066903_105525919 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300005764|Ga0066903_106134671 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300005843|Ga0068860_100081490 | All Organisms → cellular organisms → Bacteria | 3077 | Open in IMG/M |
| 3300005981|Ga0081538_10010063 | All Organisms → cellular organisms → Bacteria | 7796 | Open in IMG/M |
| 3300006845|Ga0075421_100125238 | All Organisms → cellular organisms → Bacteria | 3223 | Open in IMG/M |
| 3300006847|Ga0075431_100275038 | All Organisms → cellular organisms → Bacteria | 1706 | Open in IMG/M |
| 3300006852|Ga0075433_11092376 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Parcubacteria | 694 | Open in IMG/M |
| 3300006854|Ga0075425_103117670 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300006894|Ga0079215_10538085 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300009090|Ga0099827_10197748 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1670 | Open in IMG/M |
| 3300009094|Ga0111539_10983796 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300009101|Ga0105247_11878215 | Not Available | 500 | Open in IMG/M |
| 3300009148|Ga0105243_10704016 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300009176|Ga0105242_10790131 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 938 | Open in IMG/M |
| 3300009553|Ga0105249_10139559 | All Organisms → cellular organisms → Bacteria | 2322 | Open in IMG/M |
| 3300009818|Ga0105072_1084780 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300010046|Ga0126384_10393072 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1169 | Open in IMG/M |
| 3300010048|Ga0126373_12111468 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 625 | Open in IMG/M |
| 3300010359|Ga0126376_10986198 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 841 | Open in IMG/M |
| 3300010361|Ga0126378_11242687 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 841 | Open in IMG/M |
| 3300010362|Ga0126377_12964596 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300010376|Ga0126381_100420187 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1868 | Open in IMG/M |
| 3300010376|Ga0126381_103581662 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 609 | Open in IMG/M |
| 3300010391|Ga0136847_11285595 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
| 3300010391|Ga0136847_12969528 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300010398|Ga0126383_12769098 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300011419|Ga0137446_1032374 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300011433|Ga0137443_1151325 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 687 | Open in IMG/M |
| 3300011439|Ga0137432_1151299 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 745 | Open in IMG/M |
| 3300012204|Ga0137374_10001017 | All Organisms → cellular organisms → Bacteria | 31085 | Open in IMG/M |
| 3300012349|Ga0137387_10537271 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 848 | Open in IMG/M |
| 3300012923|Ga0137359_11414925 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300014321|Ga0075353_1152626 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300014968|Ga0157379_11892313 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300015259|Ga0180085_1004405 | All Organisms → cellular organisms → Bacteria | 3970 | Open in IMG/M |
| 3300015372|Ga0132256_103896230 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 502 | Open in IMG/M |
| 3300015373|Ga0132257_100804926 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300015373|Ga0132257_102501345 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 671 | Open in IMG/M |
| 3300015374|Ga0132255_102590789 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 775 | Open in IMG/M |
| 3300017959|Ga0187779_10111131 | All Organisms → cellular organisms → Bacteria | 1660 | Open in IMG/M |
| 3300018058|Ga0187766_10032562 | All Organisms → cellular organisms → Bacteria | 3030 | Open in IMG/M |
| 3300018060|Ga0187765_10035090 | All Organisms → cellular organisms → Bacteria | 2502 | Open in IMG/M |
| 3300018060|Ga0187765_10324374 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 930 | Open in IMG/M |
| 3300018061|Ga0184619_10396503 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300018063|Ga0184637_10018363 | All Organisms → cellular organisms → Bacteria | 4205 | Open in IMG/M |
| 3300018084|Ga0184629_10716946 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 503 | Open in IMG/M |
| 3300018089|Ga0187774_11447522 | Not Available | 506 | Open in IMG/M |
| 3300018433|Ga0066667_11602693 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 580 | Open in IMG/M |
| 3300019458|Ga0187892_10001576 | All Organisms → cellular organisms → Bacteria | 51346 | Open in IMG/M |
| 3300019458|Ga0187892_10004442 | All Organisms → cellular organisms → Bacteria | 23511 | Open in IMG/M |
| 3300020060|Ga0193717_1084301 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300020063|Ga0180118_1345140 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300021051|Ga0206224_1005037 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
| 3300021063|Ga0206227_1033993 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300021560|Ga0126371_10278541 | All Organisms → cellular organisms → Bacteria | 1794 | Open in IMG/M |
| 3300021560|Ga0126371_11810474 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300025289|Ga0209002_10729257 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300025549|Ga0210094_1034227 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300025560|Ga0210108_1088125 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300025900|Ga0207710_10309781 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 799 | Open in IMG/M |
| 3300025910|Ga0207684_10295549 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1396 | Open in IMG/M |
| 3300025935|Ga0207709_10343115 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300025941|Ga0207711_10529724 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300026075|Ga0207708_11184023 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 668 | Open in IMG/M |
| 3300026095|Ga0207676_11282885 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300026524|Ga0209690_1144455 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300028807|Ga0307305_10063981 | All Organisms → cellular organisms → Bacteria | 1696 | Open in IMG/M |
| 3300028814|Ga0307302_10596469 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 549 | Open in IMG/M |
| 3300031226|Ga0307497_10598691 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300031740|Ga0307468_100154731 | All Organisms → cellular organisms → Bacteria | 1479 | Open in IMG/M |
| 3300031740|Ga0307468_102380047 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 516 | Open in IMG/M |
| 3300031820|Ga0307473_10866331 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 650 | Open in IMG/M |
| 3300031949|Ga0214473_10036977 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5733 | Open in IMG/M |
| 3300031949|Ga0214473_12078168 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300032076|Ga0306924_11797867 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 639 | Open in IMG/M |
| 3300032174|Ga0307470_10505815 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300032174|Ga0307470_10657050 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 792 | Open in IMG/M |
| 3300032180|Ga0307471_100815646 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300032180|Ga0307471_101483591 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300032180|Ga0307471_102799777 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300032397|Ga0315287_11022798 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300032770|Ga0335085_10962934 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300033004|Ga0335084_10064192 | All Organisms → cellular organisms → Bacteria | 3797 | Open in IMG/M |
| 3300033004|Ga0335084_10082486 | All Organisms → cellular organisms → Bacteria | 3335 | Open in IMG/M |
| 3300034165|Ga0364942_0280015 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.43% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.55% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.66% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.72% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.72% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.77% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.77% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.83% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.83% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.89% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.89% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 1.89% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.94% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.94% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.94% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.94% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.94% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.94% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300003995 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011419 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2 | Environmental | Open in IMG/M |
| 3300011433 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2 | Environmental | Open in IMG/M |
| 3300011439 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300014321 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
| 3300020063 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021051 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos A1 | Environmental | Open in IMG/M |
| 3300021063 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025289 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2 | Environmental | Open in IMG/M |
| 3300025549 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025560 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1018903982 | 3300000364 | Soil | LARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTEXKS* |
| soilL2_102111532 | 3300003319 | Sugarcane Root And Bulk Soil | LARAAYRILYQAGYRNMAILDEGIPGWHAKKYPTESSAGPRGKTG* |
| Ga0055438_100901432 | 3300003995 | Natural And Restored Wetlands | LARGAYKVLYLAGYRNMLILDEGIPGWVQKRYPVQSTGGKG* |
| Ga0062593_1009701541 | 3300004114 | Soil | CPHALARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTERSEGKS* |
| Ga0062593_1032384332 | 3300004114 | Soil | LARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTVGKS* |
| Ga0066676_111062782 | 3300005186 | Soil | LARGAFKVLYQAGYRNMVILDEGIPGWARKRYPTERTAAG* |
| Ga0070676_107267411 | 3300005328 | Miscanthus Rhizosphere | LARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKSEGKS* |
| Ga0066388_1066442572 | 3300005332 | Tropical Forest Soil | LARGAYRVLYLAGYRNMMILDEGIPGWVQKHYPVDTAVGKG* |
| Ga0066388_1074680461 | 3300005332 | Tropical Forest Soil | LARAAYKILYQAGYRNMAILDEGIPGWHAKNYPTEAGAGSRGKAG |
| Ga0070705_1013502942 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | LARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTEGKS* |
| Ga0070708_1002314283 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LARGAFKLLYLAGYRNMMILDEGLPGWAEKRYPVEKTAAKS* |
| Ga0070706_1015780852 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LARGAYKVLYQAGYRNMVILDEGIPGWAKKRYPTEKTVGKS* |
| Ga0070698_1004716641 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTERTEGKS* |
| Ga0068857_1006229292 | 3300005577 | Corn Rhizosphere | LARAAYRILYQAGYRNMAILDEGIPGWHGKKYPTESSAPPRGKSG* |
| Ga0068859_1010824762 | 3300005617 | Switchgrass Rhizosphere | RGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTVGKS* |
| Ga0068859_1017645442 | 3300005617 | Switchgrass Rhizosphere | LARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTEGKG* |
| Ga0068864_1002384502 | 3300005618 | Switchgrass Rhizosphere | LARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKAEAKS* |
| Ga0066905_1013185572 | 3300005713 | Tropical Forest Soil | LARAAYKVLYQAGFRNMAILDEGIPGWARKRYPTETTGKG* |
| Ga0066903_1003571202 | 3300005764 | Tropical Forest Soil | LARAAYKVLYNAGYRNMAILDEGIPGWARKRYPTETTGKG* |
| Ga0066903_1010916381 | 3300005764 | Tropical Forest Soil | VLYLAGYRNMAILDEGIPGWADKGYPVEASSGKG* |
| Ga0066903_1032999292 | 3300005764 | Tropical Forest Soil | MARAAYKMLYLAGYRNMAILDEGIPGWASKGYPVDKS* |
| Ga0066903_1055259192 | 3300005764 | Tropical Forest Soil | LARGAYKVLYQAGYRNMAILDEGIPGWAKKRYPTEKTVGKS* |
| Ga0066903_1061346712 | 3300005764 | Tropical Forest Soil | LARGAYKLLYLAGYRNMSILDEGIPGWADKGYPVDKGKS* |
| Ga0068860_1000814904 | 3300005843 | Switchgrass Rhizosphere | AYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTVGKS* |
| Ga0081538_100100636 | 3300005981 | Tabebuia Heterophylla Rhizosphere | LARGAYKILYLAGYRNMLILDEGLPGWVDNRYPTARKP* |
| Ga0075421_1001252383 | 3300006845 | Populus Rhizosphere | LARAAYRILYQARYRNMAILDEGIPGWHAKKYPTESSAGPPGKTG* |
| Ga0075431_1002750383 | 3300006847 | Populus Rhizosphere | LARAAYRILYQARYRNMAILDEGIPGWHAKKYPTESSAGPRGKTG* |
| Ga0075433_110923761 | 3300006852 | Populus Rhizosphere | LARGAYKVLYLAGRRNMVILDEGLPGWAGKEYPLAKTQKTG* |
| Ga0075425_1031176701 | 3300006854 | Populus Rhizosphere | LARAAYKILYLAGYRNMMILDEGIPGWAEKGYPVEPSAAKS* |
| Ga0079215_105380852 | 3300006894 | Agricultural Soil | LARGAYRILYAAGYRNMFILDEGLPGWIAQGYPTEP* |
| Ga0099827_101977482 | 3300009090 | Vadose Zone Soil | VLYIAGYRNMMILDEGIPGWYAKKYPTEATTSKG* |
| Ga0111539_109837962 | 3300009094 | Populus Rhizosphere | LARAAYRILYQAGYRNMAILDEGIPGWHGKKYPTESSAPLRGKSG* |
| Ga0105247_118782152 | 3300009101 | Switchgrass Rhizosphere | LARGAYKVLYDAGYRNMVILDEGLLGWAKKRYPTEKSEGKS* |
| Ga0105243_107040162 | 3300009148 | Miscanthus Rhizosphere | LARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPMEKTEGKS* |
| Ga0105242_107901311 | 3300009176 | Miscanthus Rhizosphere | LARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEMSVGKS* |
| Ga0105249_101395591 | 3300009553 | Switchgrass Rhizosphere | GAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTVGKS* |
| Ga0105072_10847802 | 3300009818 | Groundwater Sand | LARGAYKVLYQAGYRNMVILDEGIPGWAQKRYPTAKTVAKS* |
| Ga0126384_103930723 | 3300010046 | Tropical Forest Soil | MARAAYRTLYQAGYRNMMILDEGIPGWAEKRYPTAMTAARRP* |
| Ga0126373_121114682 | 3300010048 | Tropical Forest Soil | MARAAYKVLYLAGFRNMAILDEGIPGWASKGYPVDKS* |
| Ga0126376_109861982 | 3300010359 | Tropical Forest Soil | LARGAYKILYLAGRRNMVILDEGLPGWVDKEYPLAKTG* |
| Ga0126378_112426871 | 3300010361 | Tropical Forest Soil | KILYLAGYRNMMILDEGIPGWADKGYPVEQSAAKS* |
| Ga0126377_129645962 | 3300010362 | Tropical Forest Soil | LARAAYKVLYQEGYRNMVILDEGIPGWAKKRYPTEATGKS* |
| Ga0126381_1004201872 | 3300010376 | Tropical Forest Soil | MARAAYKVLYLAGYRNMAILDEGIPGWASKGYPVDKS* |
| Ga0126381_1035816623 | 3300010376 | Tropical Forest Soil | LARAAYKVLYNAGYRNMAILDEGITGWARKRYPTETTGKG* |
| Ga0136847_112855953 | 3300010391 | Freshwater Sediment | LARGANEILYVAGYRNMLILDEGLPGWNQKKYPTAVTAVRQR* |
| Ga0136847_129695282 | 3300010391 | Freshwater Sediment | HALARGANEILYTAGYRNMLILDEGIPGWHEKKYPTAVTAVRQQ* |
| Ga0126383_127690982 | 3300010398 | Tropical Forest Soil | LARAAYKVLYQAGYRNMAILDEGIPGWARRRYPTETTGQG* |
| Ga0137446_10323742 | 3300011419 | Soil | LARGANEILYTAGYRNMLILDEGIPGWHQKRYPTAVTAVRQR* |
| Ga0137443_11513252 | 3300011433 | Soil | LARAAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTVEKS* |
| Ga0137432_11512991 | 3300011439 | Soil | PARGAYRTLYTAGFRNMLILDEGLPGRMAQGYPTKP* |
| Ga0137374_1000101718 | 3300012204 | Vadose Zone Soil | VLYLAGYRNMMILDEGIPGWYAKKYPTEATAPKG* |
| Ga0137387_105372712 | 3300012349 | Vadose Zone Soil | LARGAYKVLYQAGYRNMTILDEGIPGWVDKSYPTDKSAKG* |
| Ga0137359_114149252 | 3300012923 | Vadose Zone Soil | VLYLAGYRNMLILDEGIPGWAEKGYPLEKPAAKS* |
| Ga0075353_11526262 | 3300014321 | Natural And Restored Wetlands | VLYLAGYRNMSILDEGIPGWADKGYPLEKSVRKS* |
| Ga0157379_118923132 | 3300014968 | Switchgrass Rhizosphere | LARGASKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTEGKS* |
| Ga0180085_10044052 | 3300015259 | Soil | LARGAYKVLYLAGYRNMTILDEGLPGWDQKGYPLEKTAAKG* |
| Ga0132256_1038962302 | 3300015372 | Arabidopsis Rhizosphere | LARAAYKILYQAGYRNMAILYEGIPGWHAKQYPTDSGAGARGKPG |
| Ga0132257_1008049262 | 3300015373 | Arabidopsis Rhizosphere | LARAAYKILYLAGYRNMMILDEGIPGWTDKGYPVEQSAAKS* |
| Ga0132257_1025013452 | 3300015373 | Arabidopsis Rhizosphere | LARAAYKILYQAGYRSLAILDEGIPGWHAKKYPTESGAAARGKAG* |
| Ga0132255_1025907892 | 3300015374 | Arabidopsis Rhizosphere | YRVLYQAGYRNMVILDEGLPGWHAKNYPTEVTASRGKSG* |
| Ga0187779_101111313 | 3300017959 | Tropical Peatland | LARGAYKILYLAGYRNMSILDEGIPGWADKGYPLEEGPRKG |
| Ga0187766_100325623 | 3300018058 | Tropical Peatland | VLYLAGYRNLAILDEGMPGWADRGYPVEGSSKQAS |
| Ga0187765_100350902 | 3300018060 | Tropical Peatland | VLYLAGYRNLAILDEGMPGWADRGYPVEGSSKKAS |
| Ga0187765_103243742 | 3300018060 | Tropical Peatland | MARAAYKILYLAGYRNMQILDEGIPGWANKGYPIAEASATRG |
| Ga0184619_103965033 | 3300018061 | Groundwater Sediment | LARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEK |
| Ga0184637_100183635 | 3300018063 | Groundwater Sediment | VLARGAFKILYQAGYRNMAILDEGIPGWQAKKYPTASAAATPKTRT |
| Ga0184629_107169462 | 3300018084 | Groundwater Sediment | LARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTVGKS |
| Ga0187774_114475221 | 3300018089 | Tropical Peatland | LARGAYKVLYLVGFRNMSILDEGIPGWARRGYPVDQSARKGP |
| Ga0066667_116026932 | 3300018433 | Grasslands Soil | ARAAYRTLYQAGYRNMMILDEGIPGWTEKRYPTAVTAARRP |
| Ga0187892_1000157648 | 3300019458 | Bio-Ooze | MARAAYKILYQAGHRNMVILDEGLPDWARKRYPTEGPDRRS |
| Ga0187892_1000444219 | 3300019458 | Bio-Ooze | MARAAYKTLYQAGYRNMAILDEGIPGWVKANYPTVRGTKKS |
| Ga0193717_10843013 | 3300020060 | Soil | LARGAYKVLYDAGYRNMVILDEGIPGWAKKRYPTEKTVGKS |
| Ga0180118_13451402 | 3300020063 | Groundwater Sediment | LARGAYKVLYLAGYRNMTILDEGLPGWDQKGYPLEKTAAKG |
| Ga0206224_10050372 | 3300021051 | Deep Subsurface Sediment | LARGANEILYTAAYRNMLILDEGIPGWHQKKYPTAVTAVRQR |
| Ga0206227_10339932 | 3300021063 | Deep Subsurface Sediment | LARGANEILYTAGYRNMLILDEGIPGWHQKRYPTAVTVVRRP |
| Ga0126371_102785413 | 3300021560 | Tropical Forest Soil | MARAAYKVLYLAGFRNMAILDEGIPGWASKGYPVDKS |
| Ga0126371_118104742 | 3300021560 | Tropical Forest Soil | MARAAYKVLYLAGYRNMAILDEGIPGWASKGYPVDKS |
| Ga0209002_107292572 | 3300025289 | Soil | ASEILYAAGYRNMLILDEGMPGWDKKKYPTAVTALRKP |
| Ga0210094_10342272 | 3300025549 | Natural And Restored Wetlands | LARGAYKVLYLAGYRNMLILDEGIPGWVQKRYPVQSTGGKG |
| Ga0210108_10881251 | 3300025560 | Natural And Restored Wetlands | GANEILYVAGYRNMVILNEGIPGWHEKNYPTAVTAARRP |
| Ga0207710_103097813 | 3300025900 | Switchgrass Rhizosphere | LARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKSEGKS |
| Ga0207684_102955492 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LARGAFKLLYLAGYRNMMILDEGLPGWAEKRYPVEKTAAKS |
| Ga0207709_103431153 | 3300025935 | Miscanthus Rhizosphere | LARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPMEKTEGKS |
| Ga0207711_105297243 | 3300025941 | Switchgrass Rhizosphere | LARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTEGKG |
| Ga0207708_111840231 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | LARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTEGTS |
| Ga0207676_112828851 | 3300026095 | Switchgrass Rhizosphere | HALARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKAEAKS |
| Ga0209690_11444552 | 3300026524 | Soil | LARAAYRTLYQAGYRNMMILDEGIPGWTEKRYPTAVTAARRP |
| Ga0307305_100639811 | 3300028807 | Soil | ARGAYRILYVAGYRNMLILDEGLPGWIAQGYPTEP |
| Ga0307302_105964691 | 3300028814 | Soil | LARGAYKVLYDVGYRNMVILDEGLPGWAKKRYPTEKTEGKS |
| Ga0307497_105986912 | 3300031226 | Soil | LARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTEGKS |
| Ga0307468_1001547313 | 3300031740 | Hardwood Forest Soil | LARGAYKVLYQAGYRNMVILDEGIPGWAKKRYPTEKTVGKS |
| Ga0307468_1023800472 | 3300031740 | Hardwood Forest Soil | LARAAYKVLYQAGYRNMAILDEGIPGWHAKNYPTDSTPRGKSS |
| Ga0307473_108663313 | 3300031820 | Hardwood Forest Soil | LARGAYKVLYQAGYRNMAILDEGIPGWAKKRYPTEKTVGKS |
| Ga0214473_100369773 | 3300031949 | Soil | LARGAYKVLYRAGYRNMVILDEGIPGWVQKRYPTARTAGKS |
| Ga0214473_120781681 | 3300031949 | Soil | LARGAYKVLYQAGYRNMVILDEGIPGWAQKRYPTAR |
| Ga0306924_117978672 | 3300032076 | Soil | ELARAAYKILYLAGHRNMMILDEGIPGWADKGYPVEPSAAKS |
| Ga0307470_105058151 | 3300032174 | Hardwood Forest Soil | ACPHALARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTEGKS |
| Ga0307470_106570503 | 3300032174 | Hardwood Forest Soil | LARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKSAGKS |
| Ga0307471_1008156462 | 3300032180 | Hardwood Forest Soil | AFKLLYLAGYRNMMILDEGLPGWADKRYPVEKTAAKS |
| Ga0307471_1014835912 | 3300032180 | Hardwood Forest Soil | LARGAYQVLYQAGYRNMVILDEGIPGWVDKHYPTETSAAS |
| Ga0307471_1027997772 | 3300032180 | Hardwood Forest Soil | VQARAAFGILYQAGFRNMAILDEGIPGWDAKRYPTESTAGKRTS |
| Ga0315287_110227981 | 3300032397 | Sediment | LARGANEVLYVAGYRNMAILDEGIPGWHEKKYPTAVTAARKP |
| Ga0335085_109629342 | 3300032770 | Soil | LARGAYKVLYLAGYRNMVILDEGIPGWVQKHYPVETAVGKG |
| Ga0335084_100641924 | 3300033004 | Soil | LARGAYKVLYQAGYRNMAILDEGIPGWAKKRYPTEKTVGKG |
| Ga0335084_100824862 | 3300033004 | Soil | LARGAFKILYRAGYRNAAILDEGIPGWADKQYPVASGPG |
| Ga0364942_0280015_240_368 | 3300034165 | Sediment | LARGANEILYTAGYRNMLILDEGIPGWHQKRYPTAVTAVRRP |
| ⦗Top⦘ |