| Basic Information | |
|---|---|
| Family ID | F093417 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 44 residues |
| Representative Sequence | VQENARLRAELIRMRERESVLKKSLGILSETPESGMPRLKR |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.86 % |
| % of genes near scaffold ends (potentially truncated) | 96.23 % |
| % of genes from short scaffolds (< 2000 bps) | 97.17 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.264 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (16.038 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.962 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.736 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.78% β-sheet: 0.00% Coil/Unstructured: 65.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF13276 | HTH_21 | 59.43 |
| PF13683 | rve_3 | 33.96 |
| PF00665 | rve | 0.94 |
| PF00037 | Fer4 | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.94 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.94 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.94 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.26 % |
| Unclassified | root | N/A | 37.74 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004463|Ga0063356_100960268 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300005458|Ga0070681_10485128 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300005532|Ga0070739_10182424 | Not Available | 1085 | Open in IMG/M |
| 3300005829|Ga0074479_10206107 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300005830|Ga0074473_10533187 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300005982|Ga0075156_10100619 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
| 3300006864|Ga0066797_1076549 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium IMCC26134 | 1172 | Open in IMG/M |
| 3300006876|Ga0079217_11688963 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 509 | Open in IMG/M |
| 3300007559|Ga0102828_1041545 | Not Available | 1053 | Open in IMG/M |
| 3300007597|Ga0102919_1071011 | Not Available | 1090 | Open in IMG/M |
| 3300007661|Ga0102866_1154298 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300009163|Ga0114970_10147106 | All Organisms → cellular organisms → Bacteria | 1419 | Open in IMG/M |
| 3300009179|Ga0115028_11697691 | Not Available | 545 | Open in IMG/M |
| 3300009641|Ga0116120_1274401 | Not Available | 527 | Open in IMG/M |
| 3300009660|Ga0105854_1141111 | Not Available | 772 | Open in IMG/M |
| 3300011009|Ga0129318_10033887 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → unclassified Opitutus → Opitutus sp. ER46 | 1232 | Open in IMG/M |
| 3300011436|Ga0137458_1228146 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300012774|Ga0138283_1266794 | Not Available | 1038 | Open in IMG/M |
| 3300012907|Ga0157283_10115741 | Not Available | 742 | Open in IMG/M |
| 3300014494|Ga0182017_10858377 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300014496|Ga0182011_10229174 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
| 3300014496|Ga0182011_10719857 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300014499|Ga0182012_10353741 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300014501|Ga0182024_12891186 | Not Available | 509 | Open in IMG/M |
| 3300014502|Ga0182021_10146795 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → Opitutus terrae | 2744 | Open in IMG/M |
| 3300014502|Ga0182021_10969010 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300014654|Ga0181525_10185338 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300014654|Ga0181525_10749110 | Not Available | 550 | Open in IMG/M |
| 3300014658|Ga0181519_10934341 | Not Available | 538 | Open in IMG/M |
| 3300014839|Ga0182027_10548238 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
| 3300014839|Ga0182027_10948834 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300014839|Ga0182027_11276207 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300017935|Ga0187848_10226871 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300017941|Ga0187850_10316986 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300017946|Ga0187879_10442592 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300018034|Ga0187863_10021078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3974 | Open in IMG/M |
| 3300019785|Ga0182022_1076249 | Not Available | 720 | Open in IMG/M |
| 3300020196|Ga0194124_10492580 | Not Available | 537 | Open in IMG/M |
| 3300020205|Ga0211731_10675055 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300021519|Ga0194048_10284452 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300021961|Ga0222714_10354001 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300022549|Ga0212091_10068028 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
| 3300025498|Ga0208819_1133624 | Not Available | 505 | Open in IMG/M |
| 3300025912|Ga0207707_11608584 | Not Available | 511 | Open in IMG/M |
| 3300027609|Ga0209221_1085719 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300027756|Ga0209444_10275602 | Not Available | 575 | Open in IMG/M |
| 3300027776|Ga0209277_10105630 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
| 3300027869|Ga0209579_10152013 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300027963|Ga0209400_1146517 | Not Available | 1034 | Open in IMG/M |
| 3300028558|Ga0265326_10086163 | Not Available | 889 | Open in IMG/M |
| 3300028654|Ga0265322_10172626 | Not Available | 619 | Open in IMG/M |
| 3300028674|Ga0302161_10033926 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
| 3300028736|Ga0302214_1093984 | Not Available | 631 | Open in IMG/M |
| 3300028740|Ga0302294_10077510 | Not Available | 793 | Open in IMG/M |
| 3300028745|Ga0302267_10164919 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300028765|Ga0302198_10242579 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300028766|Ga0302269_1110290 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300028813|Ga0302157_10459217 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300028856|Ga0302295_1084121 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300028868|Ga0302163_10220244 | Not Available | 531 | Open in IMG/M |
| 3300028889|Ga0247827_10334112 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300029288|Ga0265297_10383406 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300029954|Ga0311331_11663921 | Not Available | 513 | Open in IMG/M |
| 3300029956|Ga0302150_10168114 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300029984|Ga0311332_10301240 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
| 3300029984|Ga0311332_10461641 | Not Available | 992 | Open in IMG/M |
| 3300029989|Ga0311365_10537133 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300029993|Ga0302304_10336722 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300030051|Ga0302195_10294339 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300030114|Ga0311333_10658612 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300030294|Ga0311349_11215204 | Not Available | 703 | Open in IMG/M |
| 3300030399|Ga0311353_10817024 | Not Available | 794 | Open in IMG/M |
| 3300030519|Ga0302193_10344791 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300030524|Ga0311357_10946837 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300030524|Ga0311357_11625814 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300030618|Ga0311354_11160220 | Not Available | 701 | Open in IMG/M |
| 3300030693|Ga0302313_10339067 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300030943|Ga0311366_11552473 | Not Available | 567 | Open in IMG/M |
| 3300031232|Ga0302323_100767697 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300031232|Ga0302323_103445963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 503 | Open in IMG/M |
| 3300031235|Ga0265330_10164444 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300031236|Ga0302324_102455378 | Not Available | 638 | Open in IMG/M |
| 3300031242|Ga0265329_10231484 | Not Available | 613 | Open in IMG/M |
| 3300031251|Ga0265327_10397526 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 599 | Open in IMG/M |
| 3300031344|Ga0265316_10329665 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| 3300031524|Ga0302320_10787917 | Not Available | 1055 | Open in IMG/M |
| 3300031524|Ga0302320_11895103 | Not Available | 564 | Open in IMG/M |
| 3300031525|Ga0302326_12753925 | Not Available | 609 | Open in IMG/M |
| 3300031595|Ga0265313_10161869 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300031726|Ga0302321_100571327 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
| 3300031726|Ga0302321_100996274 | Not Available | 954 | Open in IMG/M |
| 3300031726|Ga0302321_101177579 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300031837|Ga0302315_10284262 | Not Available | 956 | Open in IMG/M |
| 3300031918|Ga0311367_10937578 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300031939|Ga0308174_11178013 | Not Available | 653 | Open in IMG/M |
| 3300031951|Ga0315904_10738195 | Not Available | 821 | Open in IMG/M |
| 3300032050|Ga0315906_10332403 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
| 3300032722|Ga0316231_1395810 | Not Available | 513 | Open in IMG/M |
| 3300033004|Ga0335084_10650735 | Not Available | 1076 | Open in IMG/M |
| 3300033402|Ga0326728_10489899 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300033827|Ga0334848_078058 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300034070|Ga0334822_039857 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300034091|Ga0326724_0180014 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300034163|Ga0370515_0449534 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300034195|Ga0370501_0076195 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 16.04% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 9.43% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 8.49% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 8.49% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 6.60% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.77% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.83% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.83% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 1.89% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.89% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.89% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.89% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.89% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.89% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.89% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.89% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.89% |
| Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 1.89% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.94% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.94% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.94% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.94% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.94% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.94% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.94% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.94% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.94% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.94% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.94% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.94% |
| Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
| 3300005982 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown DNA | Engineered | Open in IMG/M |
| 3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007597 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 | Environmental | Open in IMG/M |
| 3300007661 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-3 | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
| 3300009660 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 | Environmental | Open in IMG/M |
| 3300011009 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNA | Environmental | Open in IMG/M |
| 3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
| 3300012774 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130109_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
| 3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
| 3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300019785 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022549 | Cold Creek_combined assembly | Environmental | Open in IMG/M |
| 3300025498 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027776 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Host-Associated | Open in IMG/M |
| 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Host-Associated | Open in IMG/M |
| 3300028674 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_1 | Environmental | Open in IMG/M |
| 3300028736 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_3 | Environmental | Open in IMG/M |
| 3300028740 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_3 | Environmental | Open in IMG/M |
| 3300028745 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300028765 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300028766 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028813 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028856 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_4 | Environmental | Open in IMG/M |
| 3300028868 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300029288 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 137-91 | Engineered | Open in IMG/M |
| 3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029956 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300029993 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300030051 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030519 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_3 | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030693 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Host-Associated | Open in IMG/M |
| 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Host-Associated | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Host-Associated | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031837 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032722 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18027 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033827 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 5-9 | Environmental | Open in IMG/M |
| 3300034070 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-3-M | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| 3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0063356_1009602681 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LEEATKEIARLRGELVRMQERETVLKKSLGILSETPESGMPGSKP* |
| Ga0070681_104851281 | 3300005458 | Corn Rhizosphere | GAETGVPQNLEDATKEIERLRSELVRMQERENVLKKSLGILSETPESGMPRLKR* |
| Ga0070739_101824241 | 3300005532 | Surface Soil | ADLRSELMRMRERETALKKSLGILSETPGSGMPRSRR* |
| Ga0074479_102061072 | 3300005829 | Sediment (Intertidal) | DGGPAPQTLAEAEKEIGRLRAELIRMREREIVLKKSVGILSETPESGMPRLKR* |
| Ga0074473_105331871 | 3300005830 | Sediment (Intertidal) | QQEIARLRGELVRMQEREIVLEKTLGIISETPGSGSRESKR* |
| Ga0075156_101006191 | 3300005982 | Wastewater Effluent | DAVQENARLRAELIRMRERENVLKKSLGILSETPESGMPRSRR* |
| Ga0066797_10765492 | 3300006864 | Soil | GDGGPAPQTLAEAVKENERLRAEVMRMRERENILKKSLGILSETPESGMPRSKR* |
| Ga0079217_116889631 | 3300006876 | Agricultural Soil | EIARLRGELVRMQEREMILKKSLGILSETPGSGMPKSRP* |
| Ga0102828_10415451 | 3300007559 | Estuarine | VQENARLRAELIRMRERESVLKKSLGILSETPESGMPRLKR* |
| Ga0102919_10710111 | 3300007597 | Estuarine | QTLEDAVQENARLRAELIRMRERESVLKKSLGILSETPESGMPRLKR* |
| Ga0102866_11542982 | 3300007661 | Estuarine | EDAVQENARLRAELIRMRERENVLKKSLGILSETPESGMPRLKR* |
| Ga0114970_101471063 | 3300009163 | Freshwater Lake | ARLRAELIRMRERENVLKKSLGILSETPESGMPRLKR* |
| Ga0115028_116976911 | 3300009179 | Wetland | NAWLRAEVIRMREREIVLKKSVGILSETPESGMPRLKR* |
| Ga0116120_12744012 | 3300009641 | Peatland | GGFGAKPQTLEDAQDEVVRLRAEVVRLREREIVLKKSLGILSETPASGMPRSKQ* |
| Ga0105854_11411113 | 3300009660 | Permafrost Soil | LEEAEKEISRLRGELIRMREREIVLKKSVGILSETPESGMPRLKR* |
| Ga0129318_100338873 | 3300011009 | Freshwater To Marine Saline Gradient | ARLRAELMRMRERENVLKKSLGILSETPESGMPRLKR* |
| Ga0137458_12281462 | 3300011436 | Soil | RAEVIRMRERESVLKKSLGILSEAPESGMPRSRR* |
| Ga0138283_12667941 | 3300012774 | Freshwater Lake | PPQTLEEAEQEIARLRSEVIRMREREVVLKKSLGILSETPESGMPRLKR* |
| Ga0157283_101157411 | 3300012907 | Soil | QEIGRLRAELVRMQERETVLKKSLGILSETPESGMPKSRR* |
| Ga0182017_108583772 | 3300014494 | Fen | ERLRAEVMRMREREEALKKSLGILSETPERGMPRLRR* |
| Ga0182011_102291741 | 3300014496 | Fen | RTLAEAEEEIAELRAEVIRMRDRESALKKAMGILSEAPGNGMPRSKR* |
| Ga0182011_107198572 | 3300014496 | Fen | LRAEVMRMREREDALKKSLGILSETSERGMPRLRR* |
| Ga0182012_103537412 | 3300014499 | Bog | GDSRPAPQSLAEAEREIVDLRAEVVRMRERELILKKAMGMLSEPPASGMPRLKR* |
| Ga0182024_128911861 | 3300014501 | Permafrost | ATKENQRLRAEVVRMRERETALKKVLGILSETPESGMPRSQR* |
| Ga0182021_101467955 | 3300014502 | Fen | EEATKEIERLRREVVRLQEREIILKKSLGILSETPGSGMPRSKA* |
| Ga0182021_109690101 | 3300014502 | Fen | EEATKEIERLRREVVRLQEREIILKKSLGILSETPGSGMPRSKP* |
| Ga0181525_101853382 | 3300014654 | Bog | AVKENAHLRGELIRMREREDALKKSLGILSETPERGMPRSRR* |
| Ga0181525_107491101 | 3300014654 | Bog | AEIADLRAEVVRMRERETALKKSLGILSETPASGMPRSRR* |
| Ga0181519_109343412 | 3300014658 | Bog | TLAEAEAEIADLRAEVVRMRERETALKKSLGILSETPASGMPRSRR* |
| Ga0182027_105482382 | 3300014839 | Fen | TLAEAEEEIADLRAEVIRMRDRESALKKAMGILSEAPGNGMPRSKR* |
| Ga0182027_109488341 | 3300014839 | Fen | AEKEISRLRAELIRMREREIVLKKSVGILSETSESGMPRLKR* |
| Ga0182027_112762072 | 3300014839 | Fen | LAEAEEEIADLRAEVIRMRDRESALKKAMGILSEPSGNGMPRLKR* |
| Ga0187848_102268712 | 3300017935 | Peatland | GFGAKPQTLEDAQDEVVRLRAEVVRLREREIVLKKSLGILSETPASGMPRSKQ |
| Ga0187850_103169861 | 3300017941 | Peatland | ERLRSELIRMREREEALKKSLGILSEPPERGMPRLRR |
| Ga0187879_104425922 | 3300017946 | Peatland | PGNGRPAPQTLEDAVKENAHLRGELIRMREREDALKKSLGILSETPERGMPRSRR |
| Ga0187863_100210786 | 3300018034 | Peatland | IADLRAEVVRMRERETALKKSLGILSETPASGMPRSRR |
| Ga0182022_10762491 | 3300019785 | Fen | GDRTAAPLRREVVRLQEREIILKKSLGILSETPGSGMPRSKP |
| Ga0194124_104925802 | 3300020196 | Freshwater Lake | VSGPALQTLAEAEKEIGRLRAELIRMREREIVLKKSVGILSETPESGMP |
| Ga0211731_106750552 | 3300020205 | Freshwater | EDAVQENARLRAELIRMRERENVLKKSLGILSETPESGMPRLKR |
| Ga0194048_102844522 | 3300021519 | Anoxic Zone Freshwater | EDAVQENARLRAELIRMRERESVLKKSLGILSETPESGMPRLKR |
| Ga0222714_103540011 | 3300021961 | Estuarine Water | QNLDEATREIERLRAELVRMQEREIVLKKSLGILSETPESGMPRLKR |
| Ga0212091_100680283 | 3300022549 | Groundwater | LRAELIRMREREIVLKKSVGILSETPESGMPRLKR |
| Ga0208819_11336241 | 3300025498 | Peatland | KPQTLEDAQDEVVRLRAEVVRLREREIVLKKSLGILSETPASGMPRSKQ |
| Ga0207707_116085841 | 3300025912 | Corn Rhizosphere | EIGRLRAELIRMQEREIILKKSLGILSETPESGMPRLKR |
| Ga0209221_10857192 | 3300027609 | Forest Soil | REIERLRSELIRMRDREEALKKSMGILSEPPERGMPRLRR |
| Ga0209444_102756021 | 3300027756 | Freshwater Lake | VQENARLRAELIRMRERENVLKKSLGILSETPESGMPRLKR |
| Ga0209277_101056301 | 3300027776 | Wastewater Effluent | AVQENEHLRAEVIRLRERESVLKKSLGILSETPESGMPRSRR |
| Ga0209579_101520131 | 3300027869 | Surface Soil | EIADLRSELIRMRERESALKKSLGILSETPGSGMPRSRR |
| Ga0209400_11465172 | 3300027963 | Freshwater Lake | QTLEDAVQENARLRAELIRMRERENVLKKSLGILSETPESGMPRLKR |
| Ga0265326_100861631 | 3300028558 | Rhizosphere | KEIGRLRAELIRMREREIVLKKSVGILSETSESGMPRLKR |
| Ga0265322_101726262 | 3300028654 | Rhizosphere | RTLEEAEAENRRLRAELVRMREREVILKKSVGILSETPESGMSKLQP |
| Ga0302161_100339262 | 3300028674 | Fen | AENRQLRAEVIRMRERETVLKKSLGILSETPESGMPRLKQ |
| Ga0302214_10939841 | 3300028736 | Fen | RLRAQLVRMQEREIILKKSLGILSETPESGMPRSKP |
| Ga0302294_100775102 | 3300028740 | Fen | TLEEALKENGRLRAEVMRMREREDVLKKSLGILSETPERGMPRLRR |
| Ga0302267_101649191 | 3300028745 | Bog | LEEAVKENAQLRSELVRMREREDALKKSLGILSEAPERGMPRLRR |
| Ga0302198_102425792 | 3300028765 | Bog | NERLRSELIRMREREEALKKSLGILSETPERGMPRLRR |
| Ga0302269_11102901 | 3300028766 | Bog | PGGGGPAPQTLEEAVQENHRLRSELIRMREREEALKKSLGILSETPERGMPRLRR |
| Ga0302157_104592171 | 3300028813 | Bog | NERLRSELIRMREREEALKKSLGILSEPPERGMPRLRR |
| Ga0302295_10841211 | 3300028856 | Fen | RLRAEVMRMRERENILKKSLGILSETPESGMPRLKQ |
| Ga0302163_102202441 | 3300028868 | Fen | EAEDEIAELRAEVVRMRERESVLKKSLGILSETPGSGMPKLKR |
| Ga0247827_103341121 | 3300028889 | Soil | TKEIERLRAELVRMQERENVLKKSLGILSETPGSGMPRSRQ |
| Ga0265297_103834061 | 3300029288 | Landfill Leachate | EATREIARLRGEVVRLQEREIVLKKSLGILSETPGSGMPRLPR |
| Ga0311331_116639211 | 3300029954 | Bog | IAELRAEVIRMRERESILKKAMGMLSEPPASGMPRLKR |
| Ga0302150_101681142 | 3300029956 | Bog | EAVKENERLRSELIRMREREEALKKSLGILSETPERGMPRLRR |
| Ga0311332_103012403 | 3300029984 | Fen | NRPAPRTLAEAEEEIAELRAEVIRMRDRESALKKAMGILSEAPGNGMPRSKR |
| Ga0311332_104616412 | 3300029984 | Fen | EAENLRLRLELRRMREREDVLKKSLGILSETPTSGLPKLKR |
| Ga0311365_105371331 | 3300029989 | Fen | GDGGPTPQTLEDAVKENERLRAEVIRMRERETVLKKSLGILSETPESGMPRSRR |
| Ga0302304_103367222 | 3300029993 | Palsa | PAPVTLETATKENNRLRSEIVRLRERETALKKVLGILSETPESGMPRSQR |
| Ga0302195_102943392 | 3300030051 | Bog | DAGPEPKTLEEAGREIDRLRAEVIRMREREVVLKKSLGILSETPERSMPRLKR |
| Ga0311333_106586122 | 3300030114 | Fen | LAEAEDEIAELRAEVVRMRERESVLKKSLGILSETPGSGMPKLKR |
| Ga0311349_112152041 | 3300030294 | Fen | DNRPAPRTLAEAEEEIADLRAEVIRMRDRESALKKAMGILSEAPGNGMPRSKR |
| Ga0311353_108170242 | 3300030399 | Palsa | EIGRLRAEVMRMREREVVLKKSLGILSETPESGMPRLKR |
| Ga0302193_103447911 | 3300030519 | Bog | RLRSELIRMREREEALKKSLGILSEPPERGMPSLRR |
| Ga0311357_109468372 | 3300030524 | Palsa | PQTLEEAEREIERLRSELIRMRDREDALKKSMGILSEPPERGMPRLRR |
| Ga0311357_116258141 | 3300030524 | Palsa | ETATKENSRLRSEIIRLRERETALKKVLGILSETPESGMPRSQR |
| Ga0311354_111602202 | 3300030618 | Palsa | VKENERLRSELIRMREREDALKKSLGILSEPPERGMPRL |
| Ga0302313_103390671 | 3300030693 | Palsa | APRTLAEAEDEISELRAEVIRMRERETVLKKSLGILSETPGSGMPRLKR |
| Ga0311366_115524732 | 3300030943 | Fen | VQENARLRAELVRMREREHVLKKSLGILSETPGSGMPRLQR |
| Ga0302323_1007676972 | 3300031232 | Fen | LRAEVIRMRERETVLKKSLGILSETPESGMPRSRR |
| Ga0302323_1034459631 | 3300031232 | Fen | EAENLRLRLEVRRLREREDVLKKSLGILSETPTSGFPKLKR |
| Ga0265330_101644441 | 3300031235 | Rhizosphere | ADLRAELFRMRERETALKKSLGILSETPGSGMPRSRR |
| Ga0302324_1024553781 | 3300031236 | Palsa | APQTREEAVKENERLRSELIRMREREEALKKSLGILSETPERGMPRLRR |
| Ga0265329_102314842 | 3300031242 | Rhizosphere | LAQAEEEIADLRAELFRMRERETALKKSLGILSETPGSGMPRSRR |
| Ga0265327_103975261 | 3300031251 | Rhizosphere | PTPLTLDEAVKENGRLRAELIRMREREDALKKSLGILSETPERGMPRLRR |
| Ga0265316_103296651 | 3300031344 | Rhizosphere | GGVGPEPQTLEEAQKEVVRLRAEVVRLRDREIVLKKSLGILSETPESGMPRLKR |
| Ga0302320_107879171 | 3300031524 | Bog | PGGGGPEPQTLDDAVKEIERLRSELIRMRDREEALKKSMGILSEPPERGMPRLRR |
| Ga0302320_118951031 | 3300031524 | Bog | LVEAEEEIADLRAEVIRMRERETALKKSLGILSETPASGMPRSRR |
| Ga0302326_127539251 | 3300031525 | Palsa | PAPQSLPEAEREIVELRAEVVRMRERETILKKAMGMLSEPPASGMPRLKR |
| Ga0265313_101618692 | 3300031595 | Rhizosphere | EEAEKEIGRLRAELIRMREREIVLKKSVGILSETSESGMPRLQR |
| Ga0302321_1005713273 | 3300031726 | Fen | APQTLADAVQENARLRAELVRMREREHVLKKSLGILSETPGSGMPRLQR |
| Ga0302321_1009962742 | 3300031726 | Fen | SRLRGELLRMREREIVLKKSVGILSETSESGMPRLKR |
| Ga0302321_1011775792 | 3300031726 | Fen | AEAEEEIAELRAEVIRMRDRESALKKAMGILSEAPGNGMPRSKR |
| Ga0302315_102842621 | 3300031837 | Palsa | EEAGKEIGRLRAEVIRMREREVVLKKSLGILSETPESGMPRLKR |
| Ga0311367_109375782 | 3300031918 | Fen | TFEQAEAENRQLRAEVIRMRERETVLKKSLGILSETPESGMPRLKR |
| Ga0308174_111780132 | 3300031939 | Soil | LRSELVRMQERENVLKKSLGILSETPGSGMPRSKP |
| Ga0315904_107381952 | 3300031951 | Freshwater | VPQTMEEKDEEIRQLRAEVVRMREREIVLKKSLGILFETPGSGMPRSRR |
| Ga0315906_103324032 | 3300032050 | Freshwater | MEEKDEEIRQLRAEVVRMREREIVLKKSLGILFETPGSGMPRSRR |
| Ga0316231_11833242 | 3300032722 | Freshwater | KPGGTGPEPQTLEDAMKENGQLRAEVIRLRERETVLKKSLGILSEGPESGMPRSRR |
| Ga0316231_13958102 | 3300032722 | Freshwater | ENEIADLRAELMRMRERESALKKSLGILSETPGSGMPRSRR |
| Ga0335084_106507352 | 3300033004 | Soil | KGAKTLAEVEAENLRLRLEVRRLREREDVLKKSLGILSETPTSGFPKLKR |
| Ga0326728_104898991 | 3300033402 | Peat Soil | ADMRSELMRMRERETALKKSLGILSETPGSGMPRSRR |
| Ga0334848_078058_2_139 | 3300033827 | Soil | LEEALKENGRLRAEVMRMREREDVLKKSLGILSETPERGMPRLRR |
| Ga0334822_039857_893_1033 | 3300034070 | Soil | TLAQAEEEIADLRAELFRMRERETALKKSLGILSETPGSGMPRSRR |
| Ga0326724_0180014_3_176 | 3300034091 | Peat Soil | GRSGDNRAAPRTLAEAEEEIADMRSELMRMRERETALKKSLGILSETPGSGMPRSRR |
| Ga0370515_0449534_3_137 | 3300034163 | Untreated Peat Soil | EESEEENRRLRAEVIRLREREIVLKKSLGILSETPESGMPKLKR |
| Ga0370501_0076195_3_119 | 3300034195 | Untreated Peat Soil | NGRLRAEVIRLRDREVVLKKSLGILSEPPESGMPRSKR |
| ⦗Top⦘ |