Basic Information | |
---|---|
Family ID | F093397 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 106 |
Average Sequence Length | 37 residues |
Representative Sequence | QKRWPDFTAADLDAAVKEFSRRERTRGALPDAIAG |
Number of Associated Samples | 96 |
Number of Associated Scaffolds | 106 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 97.17 % |
% of genes from short scaffolds (< 2000 bps) | 85.85 % |
Associated GOLD sequencing projects | 92 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.42 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (93.396 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (19.811 % of family members) |
Environment Ontology (ENVO) | Unclassified (33.962 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.774 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.57% β-sheet: 0.00% Coil/Unstructured: 71.43% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 106 Family Scaffolds |
---|---|---|
PF08281 | Sigma70_r4_2 | 22.64 |
PF04542 | Sigma70_r2 | 20.75 |
PF00293 | NUDIX | 4.72 |
PF13620 | CarboxypepD_reg | 3.77 |
PF01255 | Prenyltransf | 2.83 |
PF11611 | DUF4352 | 1.89 |
PF13601 | HTH_34 | 0.94 |
PF00557 | Peptidase_M24 | 0.94 |
PF10099 | RskA | 0.94 |
PF01975 | SurE | 0.94 |
PF12840 | HTH_20 | 0.94 |
PF12704 | MacB_PCD | 0.94 |
COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
---|---|---|---|
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 20.75 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 20.75 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 20.75 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 20.75 |
COG0020 | Undecaprenyl pyrophosphate synthase | Lipid transport and metabolism [I] | 2.83 |
COG0496 | Broad specificity polyphosphatase and 5'/3'-nucleotidase SurE | Replication, recombination and repair [L] | 0.94 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 93.40 % |
Unclassified | root | N/A | 6.60 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_100631120 | All Organisms → cellular organisms → Bacteria | 3284 | Open in IMG/M |
3300001154|JGI12636J13339_1022440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 879 | Open in IMG/M |
3300004080|Ga0062385_10355483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 860 | Open in IMG/M |
3300004153|Ga0063455_100010381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2124 | Open in IMG/M |
3300005531|Ga0070738_10428278 | Not Available | 515 | Open in IMG/M |
3300005537|Ga0070730_10336152 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
3300005541|Ga0070733_10018471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4344 | Open in IMG/M |
3300005575|Ga0066702_10996180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
3300005598|Ga0066706_11026915 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300005712|Ga0070764_10772657 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300005764|Ga0066903_100669362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1820 | Open in IMG/M |
3300005921|Ga0070766_10439753 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
3300006881|Ga0068865_100348915 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
3300006903|Ga0075426_11087673 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300006914|Ga0075436_100290668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1170 | Open in IMG/M |
3300006954|Ga0079219_12398408 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300007258|Ga0099793_10070339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1580 | Open in IMG/M |
3300009038|Ga0099829_10326015 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
3300009088|Ga0099830_10146165 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1814 | Open in IMG/M |
3300009089|Ga0099828_10414279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1215 | Open in IMG/M |
3300009520|Ga0116214_1360617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
3300009548|Ga0116107_1001247 | All Organisms → cellular organisms → Bacteria | 15784 | Open in IMG/M |
3300009792|Ga0126374_11023042 | Not Available | 650 | Open in IMG/M |
3300010046|Ga0126384_12452932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
3300010048|Ga0126373_10108734 | All Organisms → cellular organisms → Bacteria | 2576 | Open in IMG/M |
3300010048|Ga0126373_12414255 | Not Available | 585 | Open in IMG/M |
3300010343|Ga0074044_10949358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
3300010358|Ga0126370_10661451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 912 | Open in IMG/M |
3300010359|Ga0126376_10971501 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
3300010360|Ga0126372_10320587 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1374 | Open in IMG/M |
3300010361|Ga0126378_10836157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1029 | Open in IMG/M |
3300010361|Ga0126378_12139664 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
3300010362|Ga0126377_13284781 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
3300010398|Ga0126383_10422559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1375 | Open in IMG/M |
3300012189|Ga0137388_10168700 | All Organisms → cellular organisms → Bacteria | 1953 | Open in IMG/M |
3300012202|Ga0137363_10000372 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 24932 | Open in IMG/M |
3300012202|Ga0137363_11372320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
3300012202|Ga0137363_11727122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
3300012211|Ga0137377_11476761 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300012359|Ga0137385_10959504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
3300012359|Ga0137385_11041768 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
3300012359|Ga0137385_11490458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
3300012361|Ga0137360_11281551 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
3300012362|Ga0137361_10102139 | All Organisms → cellular organisms → Bacteria | 2496 | Open in IMG/M |
3300012362|Ga0137361_11671008 | Not Available | 557 | Open in IMG/M |
3300012582|Ga0137358_10915375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
3300012925|Ga0137419_11206642 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
3300012948|Ga0126375_11252440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
3300013308|Ga0157375_12726606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
3300015051|Ga0137414_1175365 | All Organisms → cellular organisms → Bacteria | 2318 | Open in IMG/M |
3300015054|Ga0137420_1467096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3576 | Open in IMG/M |
3300017940|Ga0187853_10069044 | All Organisms → cellular organisms → Bacteria | 1779 | Open in IMG/M |
3300017961|Ga0187778_10125633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1607 | Open in IMG/M |
3300017999|Ga0187767_10193303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
3300018431|Ga0066655_10380930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 929 | Open in IMG/M |
3300019890|Ga0193728_1023313 | All Organisms → cellular organisms → Bacteria | 3094 | Open in IMG/M |
3300020062|Ga0193724_1015802 | All Organisms → cellular organisms → Bacteria | 1602 | Open in IMG/M |
3300020580|Ga0210403_10582722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 905 | Open in IMG/M |
3300020582|Ga0210395_10658915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
3300021088|Ga0210404_10119282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1353 | Open in IMG/M |
3300021088|Ga0210404_10819154 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
3300021180|Ga0210396_10114151 | All Organisms → cellular organisms → Bacteria | 2439 | Open in IMG/M |
3300021401|Ga0210393_10025400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4617 | Open in IMG/M |
3300021433|Ga0210391_10233689 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1444 | Open in IMG/M |
3300021476|Ga0187846_10426937 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
3300021478|Ga0210402_10237450 | All Organisms → cellular organisms → Bacteria | 1681 | Open in IMG/M |
3300021478|Ga0210402_10894272 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
3300021479|Ga0210410_10012958 | All Organisms → cellular organisms → Bacteria | 7184 | Open in IMG/M |
3300021559|Ga0210409_11663978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
3300025905|Ga0207685_10067094 | All Organisms → cellular organisms → Bacteria | 1442 | Open in IMG/M |
3300025929|Ga0207664_11033258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
3300026319|Ga0209647_1100944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1376 | Open in IMG/M |
3300026335|Ga0209804_1213412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
3300026376|Ga0257167_1015237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1066 | Open in IMG/M |
3300026551|Ga0209648_10142610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1903 | Open in IMG/M |
3300027039|Ga0207855_1021135 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 887 | Open in IMG/M |
3300027173|Ga0208097_1010528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1004 | Open in IMG/M |
3300027590|Ga0209116_1093651 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
3300027619|Ga0209330_1153621 | Not Available | 518 | Open in IMG/M |
3300027671|Ga0209588_1139022 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
3300027857|Ga0209166_10555943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
3300027862|Ga0209701_10058821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2451 | Open in IMG/M |
3300027884|Ga0209275_10134256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1299 | Open in IMG/M |
3300027889|Ga0209380_10328746 | Not Available | 898 | Open in IMG/M |
3300027910|Ga0209583_10319176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
3300028047|Ga0209526_10525871 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
3300029636|Ga0222749_10216541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 963 | Open in IMG/M |
3300030935|Ga0075401_11745998 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
3300031122|Ga0170822_13480378 | Not Available | 530 | Open in IMG/M |
3300031446|Ga0170820_16514102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
3300031544|Ga0318534_10487491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
3300031573|Ga0310915_10121558 | All Organisms → cellular organisms → Bacteria | 1783 | Open in IMG/M |
3300031718|Ga0307474_10933186 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
3300031719|Ga0306917_10472300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 983 | Open in IMG/M |
3300031744|Ga0306918_10907423 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
3300031763|Ga0318537_10342739 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
3300031820|Ga0307473_10346303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 954 | Open in IMG/M |
3300031896|Ga0318551_10410394 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300031910|Ga0306923_10796112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1044 | Open in IMG/M |
3300031947|Ga0310909_10004220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9161 | Open in IMG/M |
3300031962|Ga0307479_11326577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
3300031962|Ga0307479_11593814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
3300032163|Ga0315281_10683744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1070 | Open in IMG/M |
3300032174|Ga0307470_11066319 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
3300032205|Ga0307472_100901481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 819 | Open in IMG/M |
3300033480|Ga0316620_11394091 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.92% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.32% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.66% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.72% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.77% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.77% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.89% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.89% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.89% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.89% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.89% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.94% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.94% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.94% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.94% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.94% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.94% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.94% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.94% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.94% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.94% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.94% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.94% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.94% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.94% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.94% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026376 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-B | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027039 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 (SPAdes) | Environmental | Open in IMG/M |
3300027173 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 (SPAdes) | Environmental | Open in IMG/M |
3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030935 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1006311204 | 3300000364 | Soil | FAEFVFLEKRWPDFTPADLRDAVMEFEQRERTRGALPSEC* |
JGI12636J13339_10224401 | 3300001154 | Forest Soil | LQKRWPEFTAADLDAAVKEFSRRERTRGALPDAIAG* |
Ga0062385_103554832 | 3300004080 | Bog Forest Soil | FVFLAKRWPDFTAADLQAAVEEFGRRDRTRGALPDAVAG* |
Ga0063455_1000103811 | 3300004153 | Soil | EFVFIPKRWPDFTPNDLESALQEFNARERTRGALPEADAIAG* |
Ga0070738_104282782 | 3300005531 | Surface Soil | VFLQKRWPDFTVADLEAAIAEYYRRERTRGALPAEAVS* |
Ga0070730_103361521 | 3300005537 | Surface Soil | RWPDFTVDDLRSALKDFASRERTRGALPISDVDAIAG* |
Ga0070733_100184717 | 3300005541 | Surface Soil | FLEKRWPDFTPSDLRDAIVEFERRDRTRGGLPRDCAWE* |
Ga0066702_109961801 | 3300005575 | Soil | KAWPDFTVADLEAALEEFAHRERTRGALPDALAG* |
Ga0066706_110269152 | 3300005598 | Soil | FIEKRWPDFDAADLEAAVQEFWRRERTHGALPTAALG* |
Ga0070764_107726572 | 3300005712 | Soil | EFVFLPKRWPDFNVADLESAVQEFGRRERTRGALPDAIAG* |
Ga0066903_1006693624 | 3300005764 | Tropical Forest Soil | KRWPDFTVADLEAAVQEFGTRERTRGALPDAIAG* |
Ga0070766_104397532 | 3300005921 | Soil | FLSKRWPDFTVPDLEAAVHEFSHRERTRGALPDAIAG* |
Ga0068865_1003489153 | 3300006881 | Miscanthus Rhizosphere | KRWPDFTVADLRSALEEFSRRERTRGSLPQDMAAQNF* |
Ga0075426_110876732 | 3300006903 | Populus Rhizosphere | MPKRWPDFTVSDLRAALKEFSLRERTRGGLPQDRAEMNF* |
Ga0075436_1002906683 | 3300006914 | Populus Rhizosphere | FLEKRWPDFTVADLRAAVEEFSRRERTRGSLPQDVVAQRI* |
Ga0079219_123984082 | 3300006954 | Agricultural Soil | VFARNAWPHFTVADLEAALQEFAHRELTRGALPDALAG* |
Ga0099793_100703394 | 3300007258 | Vadose Zone Soil | EKRWPDFTAADLEAAVKEFGRRGRTRGALLDAIAS* |
Ga0099829_103260151 | 3300009038 | Vadose Zone Soil | KRWPDFTAADLDAAVKEFSRRERTRGGLPDAIAG* |
Ga0099830_101461651 | 3300009088 | Vadose Zone Soil | KRWPDFTAADLAAAVKEFGMRERTRGALPDGLPDAIAG* |
Ga0099828_104142791 | 3300009089 | Vadose Zone Soil | QKRWPDFTAADLEAAVEEFARRERTRGGLPDAIAG* |
Ga0116214_13606172 | 3300009520 | Peatlands Soil | FLPKRWPDFTVSDLETALHDFATRERTRGALPEADAIAG* |
Ga0116107_100124715 | 3300009548 | Peatland | PKRWPDFMPVDLRNSVQEFERRERTRGGLPRECTI* |
Ga0126374_110230422 | 3300009792 | Tropical Forest Soil | VFVRKTWPDFTVPDLEAALEEFVHRERTRGALPDALAG* |
Ga0126384_124529322 | 3300010046 | Tropical Forest Soil | VFLPKRWPDFTVGDLQKAIDEFHRRERTRGGLPAELAG* |
Ga0126373_101087346 | 3300010048 | Tropical Forest Soil | LAKRWPDFTPKDLRDVLLEFERRDRTQGGLPREASF* |
Ga0126373_124142551 | 3300010048 | Tropical Forest Soil | RWPDFTVSDLRAALAEFSQRERTRGALPSEFVAESI* |
Ga0074044_109493582 | 3300010343 | Bog Forest Soil | PKRWPDFRPVDLRNAVQEFERRERTRGGLPRECTI* |
Ga0126370_106614513 | 3300010358 | Tropical Forest Soil | FVRKAWPDFTVADLEATLEEFAHRERTRGALPDALAG* |
Ga0126376_109715011 | 3300010359 | Tropical Forest Soil | KRWPDFTVSDLQSAIDEFHRRERTRGGLPAELAG* |
Ga0126372_103205873 | 3300010360 | Tropical Forest Soil | FLQKRWPEFTAADLEAAVKEFACRERTRGALPEEEFPDAIAG* |
Ga0126378_108361571 | 3300010361 | Tropical Forest Soil | EKRWPDFTVADLRAALEEFSRRERTRGSLPQDIAAQSF* |
Ga0126378_121396642 | 3300010361 | Tropical Forest Soil | PKRWPDFTAKDLADILREFERRERTRGDLPRDATF* |
Ga0126377_132847812 | 3300010362 | Tropical Forest Soil | LTKRWPDFTAADLESAVREFGNRERTRGALPDAVAG* |
Ga0126383_104225591 | 3300010398 | Tropical Forest Soil | KRWPDFTVADLQKAIDEFGQRERTRGALPDAIAG* |
Ga0137388_101687001 | 3300012189 | Vadose Zone Soil | KRWPDFTPADLEAAVKEFGRRERTRGALPDAIAS* |
Ga0137363_100003721 | 3300012202 | Vadose Zone Soil | RWPDFTAADLEAAVEEFERRERTRGALPDGLPDAIAG* |
Ga0137363_113723203 | 3300012202 | Vadose Zone Soil | FVFLQKRWPDFTAADLDAAVKEFGRRERTRGALPDAIAG* |
Ga0137363_117271221 | 3300012202 | Vadose Zone Soil | KRWPDFTVADLESAVQEFGHRERTRGALPDAIAG* |
Ga0137377_114767611 | 3300012211 | Vadose Zone Soil | QKRWPDFTAADLEAAVKEFSNRERTRGALPDGLPDAIAG* |
Ga0137385_109595041 | 3300012359 | Vadose Zone Soil | DFTAADLEAAVKEFSNRERTRGALPDGLPDAIAG* |
Ga0137385_110417682 | 3300012359 | Vadose Zone Soil | PDFTFADLRAALAEFAKRVRIRGSLPQESAAENF* |
Ga0137385_114904581 | 3300012359 | Vadose Zone Soil | LQKRWPEFVPKDLEAAVKEFHRRERTRGGLPKEAVS* |
Ga0137360_112815511 | 3300012361 | Vadose Zone Soil | PKRWPDFTVEDLQAALREFDHRERTRGALPDAIAG* |
Ga0137361_101021391 | 3300012362 | Vadose Zone Soil | WPDFTVADLRAALAEFSRRERTRGALPQELAAENF* |
Ga0137361_116710082 | 3300012362 | Vadose Zone Soil | DKRWPDFTVADLRAALAEFARRERTRGALPQELATETF* |
Ga0137358_109153751 | 3300012582 | Vadose Zone Soil | QKRWPDFTAADLDAAVKEFSRRERTRGALPDAIAG* |
Ga0137419_112066421 | 3300012925 | Vadose Zone Soil | QKRWPDFTAADLEAAVKEFGTRERTRGSLPDAIAG* |
Ga0126375_112524402 | 3300012948 | Tropical Forest Soil | AKRWPDFSVADLRAALEQSRKRERTRGSLPRDLAPPQA* |
Ga0157375_127266061 | 3300013308 | Miscanthus Rhizosphere | WPDFTVADLRAAVEEFSRRERTRGSLPQDVAVQSS* |
Ga0137414_11753652 | 3300015051 | Vadose Zone Soil | VFLEKRWPDFTVGDLRAALEEFSLRERTRGGLPSEMAFENF* |
Ga0137420_14670964 | 3300015054 | Vadose Zone Soil | MRLRRICFHAKRWPDFTVEDLQAAVLEFDHRERTRGALPDAIAG* |
Ga0187853_100690445 | 3300017940 | Peatland | LPKRWPDFMPVDLRNSVQEFERRERTRGGLPRECTI |
Ga0187778_101256331 | 3300017961 | Tropical Peatland | LQKRWPDFTVSDLQNAVLEFGRRERTRGALPRAAAG |
Ga0187767_101933032 | 3300017999 | Tropical Peatland | RWPDFTVADLEEAVKEFGRRERTRGALPQTLPDALAG |
Ga0066655_103809301 | 3300018431 | Grasslands Soil | HKAWPDFTVADLEAALEEFGHRERTRGALPDALPDAIAG |
Ga0193728_10233134 | 3300019890 | Soil | IGEKRWPDFTVADLRAALAEFTKRERTRGALPQELAAENF |
Ga0193724_10158023 | 3300020062 | Soil | WPDFTVADLRAALAEFAKRERTRGALPQELAAENF |
Ga0210403_105827222 | 3300020580 | Soil | TKRWPDFTVADLRAALDEFHRRERTRGALPAELAG |
Ga0210395_106589152 | 3300020582 | Soil | FLPKRWPDFSIADLESAVQEFGRRERTRGALPDAIAG |
Ga0210404_101192823 | 3300021088 | Soil | FLQKRWPDFTTADLDAAVKEFSRRERTRGALPDAIAG |
Ga0210404_108191542 | 3300021088 | Soil | PKRWPDFTAADLESAVQEFGHRERTRGALPDAIVG |
Ga0210396_101141511 | 3300021180 | Soil | FLEKRWPDFTPADLRDAVVEFEQRERTRGALPSEC |
Ga0210393_100254001 | 3300021401 | Soil | FLEKRWPDFTPADLRNAVVEFEQRERTRGALPSEC |
Ga0210391_102336893 | 3300021433 | Soil | FIFLEMRWPEFTPQDLRNAMVEFVKRERTRGALPQEYAS |
Ga0187846_104269371 | 3300021476 | Biofilm | FLQKRWPDFTVADLEPAVKEFGRRERTRGALPDAGAG |
Ga0210402_102374501 | 3300021478 | Soil | VFLEKRWPDFTPADLRDAVMEFEQRERTRGALPSEC |
Ga0210402_108942722 | 3300021478 | Soil | FLTKRWPDFTVADLRAALDEFHRRERTRGALPAELAG |
Ga0210410_100129585 | 3300021479 | Soil | QKRWPDFTVDDLQAALREFDNRERTRGALPDAIAG |
Ga0210409_116639781 | 3300021559 | Soil | LQKRWPDFTASDLEAAVNEFSRRERTRGALPDAIAG |
Ga0207685_100670943 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | RWPDFTVSDLRAALAEFSRRERTRGALPERLAAENF |
Ga0207664_110332581 | 3300025929 | Agricultural Soil | LHKRWPDFTVEDLQTALNEFDCRERTRGALPGSEIDAIGG |
Ga0209647_11009441 | 3300026319 | Grasslands Soil | EKRWPEFTVADLRAALQEFSRRERTRGALPGELAAESF |
Ga0209804_12134121 | 3300026335 | Soil | QKRWPDFTAADLDAAVKEFSRRERTRGALPDAIAG |
Ga0257167_10152372 | 3300026376 | Soil | FLQKRWPDFTAADLDAAVKEFSRRERTRGALPDAIAG |
Ga0209648_101426103 | 3300026551 | Grasslands Soil | QKRWPDFTAADLEAAVREFSNRERTRGALRDGLPDAIAG |
Ga0207855_10211351 | 3300027039 | Tropical Forest Soil | VFIEKRWPDFTPADLRNAIAEFEKRERTRGALPRECAT |
Ga0208097_10105281 | 3300027173 | Forest Soil | FVFLQKRWPEFTAADLEAAVKEFNNRERTRGALPDGLPDAIAG |
Ga0209116_10936512 | 3300027590 | Forest Soil | SKRWPDFTADDLQAAVHEFNHRERTRGALPDAIAG |
Ga0209330_11536211 | 3300027619 | Forest Soil | WPDFSVDDLRSALREFASRERTRGALPAGEVDAIAG |
Ga0209588_11390221 | 3300027671 | Vadose Zone Soil | LQKRWPDFTAADLEAAVEEFARRERTRGGLPDAIAG |
Ga0209166_105559431 | 3300027857 | Surface Soil | IFLEKRWPDFTVADLRAALQEFARRERTRGGLPNELAAESF |
Ga0209701_100588215 | 3300027862 | Vadose Zone Soil | KRWPDFTAADLAAAVKEFGMRERTRGALPDGLPDAIAG |
Ga0209275_101342563 | 3300027884 | Soil | FLFMPKRWPDFSVDDLRSALREFASRERTRGALPAGEVDAIAG |
Ga0209380_103287462 | 3300027889 | Soil | FVFLQKRWPDFTAADLEAAVKEFGQRERTRGALPDAIAG |
Ga0209583_103191761 | 3300027910 | Watersheds | FVFLQKRWPEFTAADLEAAVKEFGNRERTRGALPDGLPDAIAG |
Ga0209526_105258711 | 3300028047 | Forest Soil | FIFTPKRWPDFAVEDLEAALREFNNRERTRGALPDAIAG |
Ga0222749_102165412 | 3300029636 | Soil | EFVFLAKRWPDFTPGDLEAAVNEFGKRERTRGALPDAIAG |
Ga0075401_117459982 | 3300030935 | Soil | DKRWPDFTVADLRAALAEFAKRERTRGALPQELASEAF |
Ga0170822_134803781 | 3300031122 | Forest Soil | LIFLEKRWPDFTVADLRAALQEFSRRERTRGGLPQELAAESF |
Ga0170820_165141021 | 3300031446 | Forest Soil | KRWPDFTVADLRAALAEYSRRERTRGALPQEVASEAF |
Ga0318534_104874912 | 3300031544 | Soil | EKRWPDFTPADLRSAVEEFWRRERTQGGLPRECAS |
Ga0310915_101215584 | 3300031573 | Soil | EKRWPDFTTADLQNAIAEFEKRERTRGGLPRESMA |
Ga0307474_109331862 | 3300031718 | Hardwood Forest Soil | LDKRWPDFTVADLRAALAEFARRERTRGALPQEMASEAF |
Ga0306917_104723001 | 3300031719 | Soil | FLEKRWPDFTAADFESAIAEFEKRERTRGGLPRESLA |
Ga0306918_109074231 | 3300031744 | Soil | WPDFTVTDLQAALEEFSRRERTRGSLPQHLAAQGF |
Ga0318537_103427391 | 3300031763 | Soil | LEKRWPDFTVGDLEAALEEFSRRERTRGSLPQDIAAQSF |
Ga0307473_103463031 | 3300031820 | Hardwood Forest Soil | FLDKRWPDFTVADLRAALAEFARRERTRGALPQELATETF |
Ga0318551_104103942 | 3300031896 | Soil | EKRWPDFTVADLRNALAEFEKRERTRGGLPRESMT |
Ga0306923_107961123 | 3300031910 | Soil | EKRWPDFTAADLRDAIAEFHTRERTRGSLPKECLI |
Ga0310909_100042201 | 3300031947 | Soil | PRLEKRWPDFTVADLRNALAEFEKRERTRGGLPRESMT |
Ga0307479_113265772 | 3300031962 | Hardwood Forest Soil | FTEKRWPDFTVDDLQAALREFDQRERTRGGLPDAIAG |
Ga0307479_115938141 | 3300031962 | Hardwood Forest Soil | DKRWPDFTVADLRAALAEFARRERTRGALPQEQATETF |
Ga0315281_106837443 | 3300032163 | Sediment | FLDKRWPDFTPADLASAVAEFTRRERTYGALPGEHRESPAGF |
Ga0307470_110663192 | 3300032174 | Hardwood Forest Soil | WPDFTVADLRAAVEEFSRRERTRGSLPQDVVAQKV |
Ga0307472_1009014811 | 3300032205 | Hardwood Forest Soil | FLEKRWPDFTVADLRAAVEEFSRRERTRGSLPQDVVAQRI |
Ga0316620_113940911 | 3300033480 | Soil | FLPKRWPDFTPADLDGAVQEFGRRERTRGALPDAIAG |
⦗Top⦘ |