NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F093397

Metagenome / Metatranscriptome Family F093397

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F093397
Family Type Metagenome / Metatranscriptome
Number of Sequences 106
Average Sequence Length 37 residues
Representative Sequence QKRWPDFTAADLDAAVKEFSRRERTRGALPDAIAG
Number of Associated Samples 96
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 97.17 %
% of genes from short scaffolds (< 2000 bps) 85.85 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.396 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(19.811 % of family members)
Environment Ontology (ENVO) Unclassified
(33.962 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.774 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 28.57%    β-sheet: 0.00%    Coil/Unstructured: 71.43%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF08281Sigma70_r4_2 22.64
PF04542Sigma70_r2 20.75
PF00293NUDIX 4.72
PF13620CarboxypepD_reg 3.77
PF01255Prenyltransf 2.83
PF11611DUF4352 1.89
PF13601HTH_34 0.94
PF00557Peptidase_M24 0.94
PF10099RskA 0.94
PF01975SurE 0.94
PF12840HTH_20 0.94
PF12704MacB_PCD 0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 20.75
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 20.75
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 20.75
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 20.75
COG0020Undecaprenyl pyrophosphate synthaseLipid transport and metabolism [I] 2.83
COG0496Broad specificity polyphosphatase and 5'/3'-nucleotidase SurEReplication, recombination and repair [L] 0.94


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.40 %
UnclassifiedrootN/A6.60 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_100631120All Organisms → cellular organisms → Bacteria3284Open in IMG/M
3300001154|JGI12636J13339_1022440All Organisms → cellular organisms → Bacteria → Acidobacteria879Open in IMG/M
3300004080|Ga0062385_10355483All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae860Open in IMG/M
3300004153|Ga0063455_100010381All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2124Open in IMG/M
3300005531|Ga0070738_10428278Not Available515Open in IMG/M
3300005537|Ga0070730_10336152All Organisms → cellular organisms → Bacteria985Open in IMG/M
3300005541|Ga0070733_10018471All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4344Open in IMG/M
3300005575|Ga0066702_10996180All Organisms → cellular organisms → Bacteria → Acidobacteria501Open in IMG/M
3300005598|Ga0066706_11026915All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300005712|Ga0070764_10772657All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300005764|Ga0066903_100669362All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1820Open in IMG/M
3300005921|Ga0070766_10439753All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300006881|Ga0068865_100348915All Organisms → cellular organisms → Bacteria1198Open in IMG/M
3300006903|Ga0075426_11087673All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300006914|Ga0075436_100290668All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1170Open in IMG/M
3300006954|Ga0079219_12398408All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300007258|Ga0099793_10070339All Organisms → cellular organisms → Bacteria → Acidobacteria1580Open in IMG/M
3300009038|Ga0099829_10326015All Organisms → cellular organisms → Bacteria1262Open in IMG/M
3300009088|Ga0099830_10146165All Organisms → cellular organisms → Bacteria → Acidobacteria1814Open in IMG/M
3300009089|Ga0099828_10414279All Organisms → cellular organisms → Bacteria → Acidobacteria1215Open in IMG/M
3300009520|Ga0116214_1360617All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium563Open in IMG/M
3300009548|Ga0116107_1001247All Organisms → cellular organisms → Bacteria15784Open in IMG/M
3300009792|Ga0126374_11023042Not Available650Open in IMG/M
3300010046|Ga0126384_12452932All Organisms → cellular organisms → Bacteria → Acidobacteria505Open in IMG/M
3300010048|Ga0126373_10108734All Organisms → cellular organisms → Bacteria2576Open in IMG/M
3300010048|Ga0126373_12414255Not Available585Open in IMG/M
3300010343|Ga0074044_10949358All Organisms → cellular organisms → Bacteria → Acidobacteria563Open in IMG/M
3300010358|Ga0126370_10661451All Organisms → cellular organisms → Bacteria → Acidobacteria912Open in IMG/M
3300010359|Ga0126376_10971501All Organisms → cellular organisms → Bacteria → Acidobacteria847Open in IMG/M
3300010360|Ga0126372_10320587All Organisms → cellular organisms → Bacteria → Acidobacteria1374Open in IMG/M
3300010361|Ga0126378_10836157All Organisms → cellular organisms → Bacteria → Acidobacteria1029Open in IMG/M
3300010361|Ga0126378_12139664All Organisms → cellular organisms → Bacteria → Acidobacteria638Open in IMG/M
3300010362|Ga0126377_13284781All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300010398|Ga0126383_10422559All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1375Open in IMG/M
3300012189|Ga0137388_10168700All Organisms → cellular organisms → Bacteria1953Open in IMG/M
3300012202|Ga0137363_10000372All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia24932Open in IMG/M
3300012202|Ga0137363_11372320All Organisms → cellular organisms → Bacteria → Acidobacteria596Open in IMG/M
3300012202|Ga0137363_11727122All Organisms → cellular organisms → Bacteria → Acidobacteria518Open in IMG/M
3300012211|Ga0137377_11476761All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300012359|Ga0137385_10959504All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium706Open in IMG/M
3300012359|Ga0137385_11041768All Organisms → cellular organisms → Bacteria → Acidobacteria674Open in IMG/M
3300012359|Ga0137385_11490458All Organisms → cellular organisms → Bacteria → Acidobacteria540Open in IMG/M
3300012361|Ga0137360_11281551All Organisms → cellular organisms → Bacteria → Acidobacteria633Open in IMG/M
3300012362|Ga0137361_10102139All Organisms → cellular organisms → Bacteria2496Open in IMG/M
3300012362|Ga0137361_11671008Not Available557Open in IMG/M
3300012582|Ga0137358_10915375All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium574Open in IMG/M
3300012925|Ga0137419_11206642All Organisms → cellular organisms → Bacteria → Acidobacteria633Open in IMG/M
3300012948|Ga0126375_11252440All Organisms → cellular organisms → Bacteria → Acidobacteria620Open in IMG/M
3300013308|Ga0157375_12726606All Organisms → cellular organisms → Bacteria → Acidobacteria591Open in IMG/M
3300015051|Ga0137414_1175365All Organisms → cellular organisms → Bacteria2318Open in IMG/M
3300015054|Ga0137420_1467096All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3576Open in IMG/M
3300017940|Ga0187853_10069044All Organisms → cellular organisms → Bacteria1779Open in IMG/M
3300017961|Ga0187778_10125633All Organisms → cellular organisms → Bacteria → Acidobacteria1607Open in IMG/M
3300017999|Ga0187767_10193303All Organisms → cellular organisms → Bacteria → Acidobacteria638Open in IMG/M
3300018431|Ga0066655_10380930All Organisms → cellular organisms → Bacteria → Acidobacteria929Open in IMG/M
3300019890|Ga0193728_1023313All Organisms → cellular organisms → Bacteria3094Open in IMG/M
3300020062|Ga0193724_1015802All Organisms → cellular organisms → Bacteria1602Open in IMG/M
3300020580|Ga0210403_10582722All Organisms → cellular organisms → Bacteria → Acidobacteria905Open in IMG/M
3300020582|Ga0210395_10658915All Organisms → cellular organisms → Bacteria → Acidobacteria784Open in IMG/M
3300021088|Ga0210404_10119282All Organisms → cellular organisms → Bacteria → Acidobacteria1353Open in IMG/M
3300021088|Ga0210404_10819154All Organisms → cellular organisms → Bacteria → Acidobacteria532Open in IMG/M
3300021180|Ga0210396_10114151All Organisms → cellular organisms → Bacteria2439Open in IMG/M
3300021401|Ga0210393_10025400All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4617Open in IMG/M
3300021433|Ga0210391_10233689All Organisms → cellular organisms → Bacteria → Acidobacteria1444Open in IMG/M
3300021476|Ga0187846_10426937All Organisms → cellular organisms → Bacteria → Acidobacteria544Open in IMG/M
3300021478|Ga0210402_10237450All Organisms → cellular organisms → Bacteria1681Open in IMG/M
3300021478|Ga0210402_10894272All Organisms → cellular organisms → Bacteria → Acidobacteria814Open in IMG/M
3300021479|Ga0210410_10012958All Organisms → cellular organisms → Bacteria7184Open in IMG/M
3300021559|Ga0210409_11663978All Organisms → cellular organisms → Bacteria → Acidobacteria514Open in IMG/M
3300025905|Ga0207685_10067094All Organisms → cellular organisms → Bacteria1442Open in IMG/M
3300025929|Ga0207664_11033258All Organisms → cellular organisms → Bacteria → Acidobacteria736Open in IMG/M
3300026319|Ga0209647_1100944All Organisms → cellular organisms → Bacteria → Acidobacteria1376Open in IMG/M
3300026335|Ga0209804_1213412All Organisms → cellular organisms → Bacteria → Acidobacteria783Open in IMG/M
3300026376|Ga0257167_1015237All Organisms → cellular organisms → Bacteria → Acidobacteria1066Open in IMG/M
3300026551|Ga0209648_10142610All Organisms → cellular organisms → Bacteria → Acidobacteria1903Open in IMG/M
3300027039|Ga0207855_1021135All Organisms → cellular organisms → Bacteria → Acidobacteria887Open in IMG/M
3300027173|Ga0208097_1010528All Organisms → cellular organisms → Bacteria → Acidobacteria1004Open in IMG/M
3300027590|Ga0209116_1093651All Organisms → cellular organisms → Bacteria → Acidobacteria659Open in IMG/M
3300027619|Ga0209330_1153621Not Available518Open in IMG/M
3300027671|Ga0209588_1139022All Organisms → cellular organisms → Bacteria → Acidobacteria773Open in IMG/M
3300027857|Ga0209166_10555943All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium586Open in IMG/M
3300027862|Ga0209701_10058821All Organisms → cellular organisms → Bacteria → Acidobacteria2451Open in IMG/M
3300027884|Ga0209275_10134256All Organisms → cellular organisms → Bacteria → Acidobacteria1299Open in IMG/M
3300027889|Ga0209380_10328746Not Available898Open in IMG/M
3300027910|Ga0209583_10319176All Organisms → cellular organisms → Bacteria → Acidobacteria712Open in IMG/M
3300028047|Ga0209526_10525871All Organisms → cellular organisms → Bacteria → Acidobacteria767Open in IMG/M
3300029636|Ga0222749_10216541All Organisms → cellular organisms → Bacteria → Acidobacteria963Open in IMG/M
3300030935|Ga0075401_11745998All Organisms → cellular organisms → Bacteria → Acidobacteria634Open in IMG/M
3300031122|Ga0170822_13480378Not Available530Open in IMG/M
3300031446|Ga0170820_16514102All Organisms → cellular organisms → Bacteria → Acidobacteria778Open in IMG/M
3300031544|Ga0318534_10487491All Organisms → cellular organisms → Bacteria → Acidobacteria705Open in IMG/M
3300031573|Ga0310915_10121558All Organisms → cellular organisms → Bacteria1783Open in IMG/M
3300031718|Ga0307474_10933186All Organisms → cellular organisms → Bacteria → Acidobacteria687Open in IMG/M
3300031719|Ga0306917_10472300All Organisms → cellular organisms → Bacteria → Acidobacteria983Open in IMG/M
3300031744|Ga0306918_10907423All Organisms → cellular organisms → Bacteria → Acidobacteria686Open in IMG/M
3300031763|Ga0318537_10342739All Organisms → cellular organisms → Bacteria → Acidobacteria552Open in IMG/M
3300031820|Ga0307473_10346303All Organisms → cellular organisms → Bacteria → Acidobacteria954Open in IMG/M
3300031896|Ga0318551_10410394All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300031910|Ga0306923_10796112All Organisms → cellular organisms → Bacteria → Acidobacteria1044Open in IMG/M
3300031947|Ga0310909_10004220All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae9161Open in IMG/M
3300031962|Ga0307479_11326577All Organisms → cellular organisms → Bacteria → Acidobacteria680Open in IMG/M
3300031962|Ga0307479_11593814All Organisms → cellular organisms → Bacteria → Acidobacteria608Open in IMG/M
3300032163|Ga0315281_10683744All Organisms → cellular organisms → Bacteria → Acidobacteria1070Open in IMG/M
3300032174|Ga0307470_11066319All Organisms → cellular organisms → Bacteria → Acidobacteria647Open in IMG/M
3300032205|Ga0307472_100901481All Organisms → cellular organisms → Bacteria → Acidobacteria819Open in IMG/M
3300033480|Ga0316620_11394091All Organisms → cellular organisms → Bacteria → Acidobacteria691Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil19.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil17.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil11.32%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.66%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.72%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.77%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.77%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.89%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.89%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.89%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.89%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.94%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.94%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.94%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.94%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.94%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.94%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.94%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.94%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.94%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.94%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001154Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300005531Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009548Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300015051Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020062Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026319Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026376Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-BEnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027039Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 (SPAdes)EnvironmentalOpen in IMG/M
3300027173Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 (SPAdes)EnvironmentalOpen in IMG/M
3300027590Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027619Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030935Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10063112043300000364SoilFAEFVFLEKRWPDFTPADLRDAVMEFEQRERTRGALPSEC*
JGI12636J13339_102244013300001154Forest SoilLQKRWPEFTAADLDAAVKEFSRRERTRGALPDAIAG*
Ga0062385_1035548323300004080Bog Forest SoilFVFLAKRWPDFTAADLQAAVEEFGRRDRTRGALPDAVAG*
Ga0063455_10001038113300004153SoilEFVFIPKRWPDFTPNDLESALQEFNARERTRGALPEADAIAG*
Ga0070738_1042827823300005531Surface SoilVFLQKRWPDFTVADLEAAIAEYYRRERTRGALPAEAVS*
Ga0070730_1033615213300005537Surface SoilRWPDFTVDDLRSALKDFASRERTRGALPISDVDAIAG*
Ga0070733_1001847173300005541Surface SoilFLEKRWPDFTPSDLRDAIVEFERRDRTRGGLPRDCAWE*
Ga0066702_1099618013300005575SoilKAWPDFTVADLEAALEEFAHRERTRGALPDALAG*
Ga0066706_1102691523300005598SoilFIEKRWPDFDAADLEAAVQEFWRRERTHGALPTAALG*
Ga0070764_1077265723300005712SoilEFVFLPKRWPDFNVADLESAVQEFGRRERTRGALPDAIAG*
Ga0066903_10066936243300005764Tropical Forest SoilKRWPDFTVADLEAAVQEFGTRERTRGALPDAIAG*
Ga0070766_1043975323300005921SoilFLSKRWPDFTVPDLEAAVHEFSHRERTRGALPDAIAG*
Ga0068865_10034891533300006881Miscanthus RhizosphereKRWPDFTVADLRSALEEFSRRERTRGSLPQDMAAQNF*
Ga0075426_1108767323300006903Populus RhizosphereMPKRWPDFTVSDLRAALKEFSLRERTRGGLPQDRAEMNF*
Ga0075436_10029066833300006914Populus RhizosphereFLEKRWPDFTVADLRAAVEEFSRRERTRGSLPQDVVAQRI*
Ga0079219_1239840823300006954Agricultural SoilVFARNAWPHFTVADLEAALQEFAHRELTRGALPDALAG*
Ga0099793_1007033943300007258Vadose Zone SoilEKRWPDFTAADLEAAVKEFGRRGRTRGALLDAIAS*
Ga0099829_1032601513300009038Vadose Zone SoilKRWPDFTAADLDAAVKEFSRRERTRGGLPDAIAG*
Ga0099830_1014616513300009088Vadose Zone SoilKRWPDFTAADLAAAVKEFGMRERTRGALPDGLPDAIAG*
Ga0099828_1041427913300009089Vadose Zone SoilQKRWPDFTAADLEAAVEEFARRERTRGGLPDAIAG*
Ga0116214_136061723300009520Peatlands SoilFLPKRWPDFTVSDLETALHDFATRERTRGALPEADAIAG*
Ga0116107_1001247153300009548PeatlandPKRWPDFMPVDLRNSVQEFERRERTRGGLPRECTI*
Ga0126374_1102304223300009792Tropical Forest SoilVFVRKTWPDFTVPDLEAALEEFVHRERTRGALPDALAG*
Ga0126384_1245293223300010046Tropical Forest SoilVFLPKRWPDFTVGDLQKAIDEFHRRERTRGGLPAELAG*
Ga0126373_1010873463300010048Tropical Forest SoilLAKRWPDFTPKDLRDVLLEFERRDRTQGGLPREASF*
Ga0126373_1241425513300010048Tropical Forest SoilRWPDFTVSDLRAALAEFSQRERTRGALPSEFVAESI*
Ga0074044_1094935823300010343Bog Forest SoilPKRWPDFRPVDLRNAVQEFERRERTRGGLPRECTI*
Ga0126370_1066145133300010358Tropical Forest SoilFVRKAWPDFTVADLEATLEEFAHRERTRGALPDALAG*
Ga0126376_1097150113300010359Tropical Forest SoilKRWPDFTVSDLQSAIDEFHRRERTRGGLPAELAG*
Ga0126372_1032058733300010360Tropical Forest SoilFLQKRWPEFTAADLEAAVKEFACRERTRGALPEEEFPDAIAG*
Ga0126378_1083615713300010361Tropical Forest SoilEKRWPDFTVADLRAALEEFSRRERTRGSLPQDIAAQSF*
Ga0126378_1213966423300010361Tropical Forest SoilPKRWPDFTAKDLADILREFERRERTRGDLPRDATF*
Ga0126377_1328478123300010362Tropical Forest SoilLTKRWPDFTAADLESAVREFGNRERTRGALPDAVAG*
Ga0126383_1042255913300010398Tropical Forest SoilKRWPDFTVADLQKAIDEFGQRERTRGALPDAIAG*
Ga0137388_1016870013300012189Vadose Zone SoilKRWPDFTPADLEAAVKEFGRRERTRGALPDAIAS*
Ga0137363_1000037213300012202Vadose Zone SoilRWPDFTAADLEAAVEEFERRERTRGALPDGLPDAIAG*
Ga0137363_1137232033300012202Vadose Zone SoilFVFLQKRWPDFTAADLDAAVKEFGRRERTRGALPDAIAG*
Ga0137363_1172712213300012202Vadose Zone SoilKRWPDFTVADLESAVQEFGHRERTRGALPDAIAG*
Ga0137377_1147676113300012211Vadose Zone SoilQKRWPDFTAADLEAAVKEFSNRERTRGALPDGLPDAIAG*
Ga0137385_1095950413300012359Vadose Zone SoilDFTAADLEAAVKEFSNRERTRGALPDGLPDAIAG*
Ga0137385_1104176823300012359Vadose Zone SoilPDFTFADLRAALAEFAKRVRIRGSLPQESAAENF*
Ga0137385_1149045813300012359Vadose Zone SoilLQKRWPEFVPKDLEAAVKEFHRRERTRGGLPKEAVS*
Ga0137360_1128155113300012361Vadose Zone SoilPKRWPDFTVEDLQAALREFDHRERTRGALPDAIAG*
Ga0137361_1010213913300012362Vadose Zone SoilWPDFTVADLRAALAEFSRRERTRGALPQELAAENF*
Ga0137361_1167100823300012362Vadose Zone SoilDKRWPDFTVADLRAALAEFARRERTRGALPQELATETF*
Ga0137358_1091537513300012582Vadose Zone SoilQKRWPDFTAADLDAAVKEFSRRERTRGALPDAIAG*
Ga0137419_1120664213300012925Vadose Zone SoilQKRWPDFTAADLEAAVKEFGTRERTRGSLPDAIAG*
Ga0126375_1125244023300012948Tropical Forest SoilAKRWPDFSVADLRAALEQSRKRERTRGSLPRDLAPPQA*
Ga0157375_1272660613300013308Miscanthus RhizosphereWPDFTVADLRAAVEEFSRRERTRGSLPQDVAVQSS*
Ga0137414_117536523300015051Vadose Zone SoilVFLEKRWPDFTVGDLRAALEEFSLRERTRGGLPSEMAFENF*
Ga0137420_146709643300015054Vadose Zone SoilMRLRRICFHAKRWPDFTVEDLQAAVLEFDHRERTRGALPDAIAG*
Ga0187853_1006904453300017940PeatlandLPKRWPDFMPVDLRNSVQEFERRERTRGGLPRECTI
Ga0187778_1012563313300017961Tropical PeatlandLQKRWPDFTVSDLQNAVLEFGRRERTRGALPRAAAG
Ga0187767_1019330323300017999Tropical PeatlandRWPDFTVADLEEAVKEFGRRERTRGALPQTLPDALAG
Ga0066655_1038093013300018431Grasslands SoilHKAWPDFTVADLEAALEEFGHRERTRGALPDALPDAIAG
Ga0193728_102331343300019890SoilIGEKRWPDFTVADLRAALAEFTKRERTRGALPQELAAENF
Ga0193724_101580233300020062SoilWPDFTVADLRAALAEFAKRERTRGALPQELAAENF
Ga0210403_1058272223300020580SoilTKRWPDFTVADLRAALDEFHRRERTRGALPAELAG
Ga0210395_1065891523300020582SoilFLPKRWPDFSIADLESAVQEFGRRERTRGALPDAIAG
Ga0210404_1011928233300021088SoilFLQKRWPDFTTADLDAAVKEFSRRERTRGALPDAIAG
Ga0210404_1081915423300021088SoilPKRWPDFTAADLESAVQEFGHRERTRGALPDAIVG
Ga0210396_1011415113300021180SoilFLEKRWPDFTPADLRDAVVEFEQRERTRGALPSEC
Ga0210393_1002540013300021401SoilFLEKRWPDFTPADLRNAVVEFEQRERTRGALPSEC
Ga0210391_1023368933300021433SoilFIFLEMRWPEFTPQDLRNAMVEFVKRERTRGALPQEYAS
Ga0187846_1042693713300021476BiofilmFLQKRWPDFTVADLEPAVKEFGRRERTRGALPDAGAG
Ga0210402_1023745013300021478SoilVFLEKRWPDFTPADLRDAVMEFEQRERTRGALPSEC
Ga0210402_1089427223300021478SoilFLTKRWPDFTVADLRAALDEFHRRERTRGALPAELAG
Ga0210410_1001295853300021479SoilQKRWPDFTVDDLQAALREFDNRERTRGALPDAIAG
Ga0210409_1166397813300021559SoilLQKRWPDFTASDLEAAVNEFSRRERTRGALPDAIAG
Ga0207685_1006709433300025905Corn, Switchgrass And Miscanthus RhizosphereRWPDFTVSDLRAALAEFSRRERTRGALPERLAAENF
Ga0207664_1103325813300025929Agricultural SoilLHKRWPDFTVEDLQTALNEFDCRERTRGALPGSEIDAIGG
Ga0209647_110094413300026319Grasslands SoilEKRWPEFTVADLRAALQEFSRRERTRGALPGELAAESF
Ga0209804_121341213300026335SoilQKRWPDFTAADLDAAVKEFSRRERTRGALPDAIAG
Ga0257167_101523723300026376SoilFLQKRWPDFTAADLDAAVKEFSRRERTRGALPDAIAG
Ga0209648_1014261033300026551Grasslands SoilQKRWPDFTAADLEAAVREFSNRERTRGALRDGLPDAIAG
Ga0207855_102113513300027039Tropical Forest SoilVFIEKRWPDFTPADLRNAIAEFEKRERTRGALPRECAT
Ga0208097_101052813300027173Forest SoilFVFLQKRWPEFTAADLEAAVKEFNNRERTRGALPDGLPDAIAG
Ga0209116_109365123300027590Forest SoilSKRWPDFTADDLQAAVHEFNHRERTRGALPDAIAG
Ga0209330_115362113300027619Forest SoilWPDFSVDDLRSALREFASRERTRGALPAGEVDAIAG
Ga0209588_113902213300027671Vadose Zone SoilLQKRWPDFTAADLEAAVEEFARRERTRGGLPDAIAG
Ga0209166_1055594313300027857Surface SoilIFLEKRWPDFTVADLRAALQEFARRERTRGGLPNELAAESF
Ga0209701_1005882153300027862Vadose Zone SoilKRWPDFTAADLAAAVKEFGMRERTRGALPDGLPDAIAG
Ga0209275_1013425633300027884SoilFLFMPKRWPDFSVDDLRSALREFASRERTRGALPAGEVDAIAG
Ga0209380_1032874623300027889SoilFVFLQKRWPDFTAADLEAAVKEFGQRERTRGALPDAIAG
Ga0209583_1031917613300027910WatershedsFVFLQKRWPEFTAADLEAAVKEFGNRERTRGALPDGLPDAIAG
Ga0209526_1052587113300028047Forest SoilFIFTPKRWPDFAVEDLEAALREFNNRERTRGALPDAIAG
Ga0222749_1021654123300029636SoilEFVFLAKRWPDFTPGDLEAAVNEFGKRERTRGALPDAIAG
Ga0075401_1174599823300030935SoilDKRWPDFTVADLRAALAEFAKRERTRGALPQELASEAF
Ga0170822_1348037813300031122Forest SoilLIFLEKRWPDFTVADLRAALQEFSRRERTRGGLPQELAAESF
Ga0170820_1651410213300031446Forest SoilKRWPDFTVADLRAALAEYSRRERTRGALPQEVASEAF
Ga0318534_1048749123300031544SoilEKRWPDFTPADLRSAVEEFWRRERTQGGLPRECAS
Ga0310915_1012155843300031573SoilEKRWPDFTTADLQNAIAEFEKRERTRGGLPRESMA
Ga0307474_1093318623300031718Hardwood Forest SoilLDKRWPDFTVADLRAALAEFARRERTRGALPQEMASEAF
Ga0306917_1047230013300031719SoilFLEKRWPDFTAADFESAIAEFEKRERTRGGLPRESLA
Ga0306918_1090742313300031744SoilWPDFTVTDLQAALEEFSRRERTRGSLPQHLAAQGF
Ga0318537_1034273913300031763SoilLEKRWPDFTVGDLEAALEEFSRRERTRGSLPQDIAAQSF
Ga0307473_1034630313300031820Hardwood Forest SoilFLDKRWPDFTVADLRAALAEFARRERTRGALPQELATETF
Ga0318551_1041039423300031896SoilEKRWPDFTVADLRNALAEFEKRERTRGGLPRESMT
Ga0306923_1079611233300031910SoilEKRWPDFTAADLRDAIAEFHTRERTRGSLPKECLI
Ga0310909_1000422013300031947SoilPRLEKRWPDFTVADLRNALAEFEKRERTRGGLPRESMT
Ga0307479_1132657723300031962Hardwood Forest SoilFTEKRWPDFTVDDLQAALREFDQRERTRGGLPDAIAG
Ga0307479_1159381413300031962Hardwood Forest SoilDKRWPDFTVADLRAALAEFARRERTRGALPQEQATETF
Ga0315281_1068374433300032163SedimentFLDKRWPDFTPADLASAVAEFTRRERTYGALPGEHRESPAGF
Ga0307470_1106631923300032174Hardwood Forest SoilWPDFTVADLRAAVEEFSRRERTRGSLPQDVVAQKV
Ga0307472_10090148113300032205Hardwood Forest SoilFLEKRWPDFTVADLRAAVEEFSRRERTRGSLPQDVVAQRI
Ga0316620_1139409113300033480SoilFLPKRWPDFTPADLDGAVQEFGRRERTRGALPDAIAG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.