| Basic Information | |
|---|---|
| Family ID | F093385 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MKSPNYVAVLAILNAILHRVSESLPLIDQATRELGNSKIPAKARAAK |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 71.84 % |
| % of genes near scaffold ends (potentially truncated) | 30.19 % |
| % of genes from short scaffolds (< 2000 bps) | 76.42 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.226 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (15.094 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.962 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (35.849 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 76.60% β-sheet: 0.00% Coil/Unstructured: 23.40% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF02954 | HTH_8 | 35.85 |
| PF13488 | Gly-zipper_Omp | 23.58 |
| PF05494 | MlaC | 4.72 |
| PF00011 | HSP20 | 0.94 |
| PF05168 | HEPN | 0.94 |
| PF00857 | Isochorismatase | 0.94 |
| PF06463 | Mob_synth_C | 0.94 |
| PF02518 | HATPase_c | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG2854 | Periplasmic subunit MlaC of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 4.72 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.94 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.94 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.94 |
| COG1895 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.94 |
| COG2250 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.94 |
| COG2896 | GTP 3',8-cyclase (molybdenum cofactor biosynthesis protein MoaA) | Coenzyme transport and metabolism [H] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.23 % |
| Unclassified | root | N/A | 3.77 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig482589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 966 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101262270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1029867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 855 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1032325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 963 | Open in IMG/M |
| 3300000955|JGI1027J12803_100691036 | All Organisms → cellular organisms → Bacteria | 2304 | Open in IMG/M |
| 3300002899|JGIcombinedJ43975_10034731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 828 | Open in IMG/M |
| 3300003987|Ga0055471_10008886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2106 | Open in IMG/M |
| 3300004268|Ga0066398_10038977 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300005289|Ga0065704_10431150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 723 | Open in IMG/M |
| 3300005289|Ga0065704_10717337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 520 | Open in IMG/M |
| 3300005294|Ga0065705_10138527 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2213 | Open in IMG/M |
| 3300005294|Ga0065705_10142097 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2123 | Open in IMG/M |
| 3300005295|Ga0065707_10135926 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1842 | Open in IMG/M |
| 3300005295|Ga0065707_10658447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 659 | Open in IMG/M |
| 3300005332|Ga0066388_100503997 | All Organisms → cellular organisms → Bacteria | 1846 | Open in IMG/M |
| 3300005332|Ga0066388_102081370 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300005332|Ga0066388_103681681 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300005332|Ga0066388_107343270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 553 | Open in IMG/M |
| 3300005445|Ga0070708_100083430 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2897 | Open in IMG/M |
| 3300005467|Ga0070706_101610226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 592 | Open in IMG/M |
| 3300005467|Ga0070706_101758581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 564 | Open in IMG/M |
| 3300005713|Ga0066905_100194331 | All Organisms → cellular organisms → Bacteria | 1510 | Open in IMG/M |
| 3300005713|Ga0066905_100271016 | All Organisms → cellular organisms → Bacteria | 1316 | Open in IMG/M |
| 3300005713|Ga0066905_100869168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 787 | Open in IMG/M |
| 3300005713|Ga0066905_101694265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 581 | Open in IMG/M |
| 3300005764|Ga0066903_104387287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 753 | Open in IMG/M |
| 3300005764|Ga0066903_106988062 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
| 3300006049|Ga0075417_10006311 | All Organisms → cellular organisms → Bacteria | 4115 | Open in IMG/M |
| 3300006904|Ga0075424_100211238 | All Organisms → cellular organisms → Bacteria | 2062 | Open in IMG/M |
| 3300006904|Ga0075424_100391565 | All Organisms → cellular organisms → Bacteria | 1481 | Open in IMG/M |
| 3300006969|Ga0075419_11348176 | Not Available | 531 | Open in IMG/M |
| 3300009012|Ga0066710_100426335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1984 | Open in IMG/M |
| 3300009137|Ga0066709_101086176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1175 | Open in IMG/M |
| 3300009146|Ga0105091_10271958 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 821 | Open in IMG/M |
| 3300009147|Ga0114129_10360162 | All Organisms → cellular organisms → Bacteria | 1925 | Open in IMG/M |
| 3300009162|Ga0075423_10132933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2612 | Open in IMG/M |
| 3300009792|Ga0126374_10936839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 674 | Open in IMG/M |
| 3300009807|Ga0105061_1017101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 947 | Open in IMG/M |
| 3300009810|Ga0105088_1003725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2041 | Open in IMG/M |
| 3300009811|Ga0105084_1027358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 963 | Open in IMG/M |
| 3300009815|Ga0105070_1007511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1742 | Open in IMG/M |
| 3300009817|Ga0105062_1000125 | All Organisms → cellular organisms → Bacteria | 6329 | Open in IMG/M |
| 3300010043|Ga0126380_10179018 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
| 3300010043|Ga0126380_10296846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1147 | Open in IMG/M |
| 3300010043|Ga0126380_11425451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 610 | Open in IMG/M |
| 3300010046|Ga0126384_10545072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1007 | Open in IMG/M |
| 3300010047|Ga0126382_11837699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 571 | Open in IMG/M |
| 3300010359|Ga0126376_10191019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1687 | Open in IMG/M |
| 3300010360|Ga0126372_11274067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 763 | Open in IMG/M |
| 3300010360|Ga0126372_11503375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 709 | Open in IMG/M |
| 3300010362|Ga0126377_10400473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1383 | Open in IMG/M |
| 3300010362|Ga0126377_11176356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 837 | Open in IMG/M |
| 3300010362|Ga0126377_13080799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 538 | Open in IMG/M |
| 3300010398|Ga0126383_12552126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 595 | Open in IMG/M |
| 3300012208|Ga0137376_10114206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2300 | Open in IMG/M |
| 3300012211|Ga0137377_11525135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 594 | Open in IMG/M |
| 3300012350|Ga0137372_10010177 | All Organisms → cellular organisms → Bacteria | 9036 | Open in IMG/M |
| 3300012354|Ga0137366_10205783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1469 | Open in IMG/M |
| 3300012685|Ga0137397_10024646 | All Organisms → cellular organisms → Bacteria | 4258 | Open in IMG/M |
| 3300012922|Ga0137394_10013158 | All Organisms → cellular organisms → Bacteria | 6519 | Open in IMG/M |
| 3300012929|Ga0137404_11538700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 616 | Open in IMG/M |
| 3300012930|Ga0137407_11089230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 757 | Open in IMG/M |
| 3300012939|Ga0162650_100059987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300012948|Ga0126375_10028895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2715 | Open in IMG/M |
| 3300014296|Ga0075344_1052914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 736 | Open in IMG/M |
| 3300014320|Ga0075342_1074599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 856 | Open in IMG/M |
| 3300015053|Ga0137405_1208016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1693 | Open in IMG/M |
| 3300018053|Ga0184626_10161474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 952 | Open in IMG/M |
| 3300018072|Ga0184635_10025727 | All Organisms → cellular organisms → Bacteria | 2189 | Open in IMG/M |
| 3300018072|Ga0184635_10147890 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300018075|Ga0184632_10090291 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
| 3300018076|Ga0184609_10468098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 577 | Open in IMG/M |
| 3300018078|Ga0184612_10296097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 830 | Open in IMG/M |
| 3300018084|Ga0184629_10634470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300019789|Ga0137408_1419599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2473 | Open in IMG/M |
| 3300021560|Ga0126371_12862616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 585 | Open in IMG/M |
| 3300021951|Ga0222624_1596456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300025567|Ga0210076_1111758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300026053|Ga0208422_1022086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 754 | Open in IMG/M |
| 3300027056|Ga0209879_1032363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 866 | Open in IMG/M |
| 3300027163|Ga0209878_1021073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 874 | Open in IMG/M |
| 3300027209|Ga0209875_1009857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1123 | Open in IMG/M |
| 3300027277|Ga0209846_1000144 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10275 | Open in IMG/M |
| 3300027513|Ga0208685_1000732 | All Organisms → cellular organisms → Bacteria | 11248 | Open in IMG/M |
| 3300027654|Ga0209799_1000403 | All Organisms → cellular organisms → Bacteria | 7983 | Open in IMG/M |
| 3300027874|Ga0209465_10081148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1579 | Open in IMG/M |
| 3300030537|Ga0247642_1047299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300030550|Ga0247631_1150821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 557 | Open in IMG/M |
| 3300030552|Ga0247654_1150903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300030553|Ga0247645_1171655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 566 | Open in IMG/M |
| 3300030555|Ga0247618_1100756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 608 | Open in IMG/M |
| 3300030565|Ga0247635_1332081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300030570|Ga0247647_1254539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300030600|Ga0247659_1098388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 645 | Open in IMG/M |
| 3300030621|Ga0247655_10308093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300030682|Ga0247622_1174358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 532 | Open in IMG/M |
| 3300031720|Ga0307469_10629354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 963 | Open in IMG/M |
| 3300031720|Ga0307469_11332922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 682 | Open in IMG/M |
| 3300031740|Ga0307468_100009456 | All Organisms → cellular organisms → Bacteria | 3716 | Open in IMG/M |
| 3300031820|Ga0307473_10037444 | All Organisms → cellular organisms → Bacteria | 2182 | Open in IMG/M |
| 3300031854|Ga0310904_10120168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1480 | Open in IMG/M |
| 3300031908|Ga0310900_11291101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 610 | Open in IMG/M |
| 3300034147|Ga0364925_0404199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 518 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 15.09% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 12.26% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.43% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 8.49% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 6.60% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.66% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.77% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.83% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.83% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.83% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.89% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.89% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.94% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.94% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.94% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002899 | Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607) | Environmental | Open in IMG/M |
| 3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009807 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 | Environmental | Open in IMG/M |
| 3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
| 3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
| 3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300014296 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300014320 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021951 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025567 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026053 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027163 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027209 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027277 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027513 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300030537 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb7 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030550 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bb8 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030552 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db7 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030553 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb10 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030555 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab7 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030565 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb12 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030570 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb12 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030600 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb12 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030621 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db8 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030682 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Anb11 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_09002320 | 2124908045 | Soil | MKSPNYVAVLAILNAILHRVSESLPLIDQATRELGNSKIPAKARAAK |
| INPhiseqgaiiFebDRAFT_1012622703 | 3300000364 | Soil | VAVLAILNAMLRRVSESLPQIQQASRELGYSEIPTKARASK* |
| AF_2010_repII_A01DRAFT_10298672 | 3300000580 | Forest Soil | MKSPNYAAVLAILNAMLHRVSESLPLIDQATRELGSNKILAKVRAAK* |
| AF_2010_repII_A1DRAFT_100385943 | 3300000597 | Forest Soil | LNAMLHRVSESLPLIDQATRELGSNKIPAKVRAAK* |
| AF_2010_repII_A100DRAFT_10323253 | 3300000655 | Forest Soil | MKSPNYAAVLAILNAMLHRVSESLPLIDQATRELGSNKIPAKVRAAN* |
| JGI1027J12803_1006910364 | 3300000955 | Soil | MKSPNYVAVLAILNAMLRRVSESLPQIQQASRELGYSEIPTKARASK* |
| JGIcombinedJ43975_100347312 | 3300002899 | Soil | MKTPNYVAVLAILNAILHRVSESLPLIDQATRELGNSKIPAKARAAK* |
| Ga0055471_100088862 | 3300003987 | Natural And Restored Wetlands | MQSPNYIAVLAILNAMLRRVSESIPQIEKSTRELGHWAVPAKIAGK* |
| Ga0066398_100389771 | 3300004268 | Tropical Forest Soil | MKSPNYAAVLAILNAMLHRVSESLPLINQATRELGSNKIPAKARAAK* |
| Ga0065704_104311502 | 3300005289 | Switchgrass Rhizosphere | MKSPNYVAVLAILNAILHRVSESLPLIDQATRELGSSKIPAKARAAK* |
| Ga0065704_107173371 | 3300005289 | Switchgrass Rhizosphere | MKSPNYVAVLAILNAILHRVSESLSLIDQATRELGHSKIPAKARAAK* |
| Ga0065705_101385273 | 3300005294 | Switchgrass Rhizosphere | MKSPNYVAVLAILNAILHRVSESLPLIDQATRELGHSKIPAKARAAK* |
| Ga0065705_101420971 | 3300005294 | Switchgrass Rhizosphere | MKSPNYVAVLAILNAILHRVSESLPLIDQATRELGSSKIAA |
| Ga0065707_101359262 | 3300005295 | Switchgrass Rhizosphere | MKSPNYVAVLAILNAILHRVSESLPLIDQATRELGSSKIAAKARAAK* |
| Ga0065707_106584471 | 3300005295 | Switchgrass Rhizosphere | NYVAVLAILNAILHRVSESLPLIDQATRELGQSKIPAKARAAK* |
| Ga0066388_1005039974 | 3300005332 | Tropical Forest Soil | MKSPNYAAVLAILNAMLHRVSESLPLIDQATRELGSNRITAKARAAK* |
| Ga0066388_1020813703 | 3300005332 | Tropical Forest Soil | NEPKGGKMKSPNYAAVLAILNAMLHRVSESLPLIDQATRELGSSKIPAKARAAK* |
| Ga0066388_1036816813 | 3300005332 | Tropical Forest Soil | GGKMKSPNYAAVLAILNAMLHRVSESLPLIDQATRELGSSKVLAKARAAK* |
| Ga0066388_1073432702 | 3300005332 | Tropical Forest Soil | MKSPKYAAVLAILNAMLHRVSESLPLIDQATRELGSSKIPAKARAAK* |
| Ga0070708_1000834303 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MKSPNYVAVLAILNAMLRRVSESLPQIQQASRELGYSEIPTKARAGK* |
| Ga0070706_1016102262 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKSPNYVAVLAILNAMLRRVSESLPQIQQASRELGYSEIPTKAR |
| Ga0070706_1017585812 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | PKGGKMKSPNYVAVLAILNAILHRVSESLPLIDQATRELGNSKVPAKARAAK* |
| Ga0066905_1001943312 | 3300005713 | Tropical Forest Soil | MKSPNYAAVLAILNAMLHRVSESLPLIDEATRELGGSKIQVKARAAK* |
| Ga0066905_1002710162 | 3300005713 | Tropical Forest Soil | MKSPNYAAVLAILNAMLHRVSESLPLIDQATRELGSSELQAKARASK* |
| Ga0066905_1008691681 | 3300005713 | Tropical Forest Soil | MKSPNFVAVLAILNAILHRVSESLPLIDQATRELGSNKIPAKARAAK* |
| Ga0066905_1016942652 | 3300005713 | Tropical Forest Soil | MKSPNYAAVLAILNAMLHRVSESLPLIDEATRELGSSKIQVKARAA |
| Ga0066903_1043872872 | 3300005764 | Tropical Forest Soil | MKSPNYAVVLAILNAMLHRVSESLPLIDQATRELGSSKVSAKARAAK* |
| Ga0066903_1069880622 | 3300005764 | Tropical Forest Soil | MKSPNYAAVLAILNAMLHRVSESLPLIDQATRELGSNKIPAKVRAAK* |
| Ga0075417_100063113 | 3300006049 | Populus Rhizosphere | MKSPNYVAVLAILNAILHRVSESLPLIDQATRELGNSKIPAKARAAK* |
| Ga0075424_1002112382 | 3300006904 | Populus Rhizosphere | MKSPNYVAVLAILNAILHRVSESMTVIDQATRELGNSKIPAKARAAK* |
| Ga0075424_1003915654 | 3300006904 | Populus Rhizosphere | KGGKMKSPNYVAVLAILNAILHRVSESLPLIDQATRELGNSKIPAKARAAK* |
| Ga0075419_113481761 | 3300006969 | Populus Rhizosphere | MKSPNYVAVLAILNAILHRVSESMTVIDQATRELGNSKISAKARAAK* |
| Ga0066710_1004263352 | 3300009012 | Grasslands Soil | MKSPNYVAVLAILCAMLRRVSESLPLIDQATRELGNSKIPAKAHAAK |
| Ga0066709_1010861762 | 3300009137 | Grasslands Soil | MKSPNYVAVLAILNAILHRVSESLPLIDQATRELGNSKMPAKAHAGK* |
| Ga0105091_102719582 | 3300009146 | Freshwater Sediment | MKSPNYVAVLAILNAILHRVSESLPLIDQATRELEGNKIPAKARAAK* |
| Ga0114129_103601621 | 3300009147 | Populus Rhizosphere | MKSPNYVAVLAILNAILHRVSESMTVIDQATRELGNSKIPVKARAAK* |
| Ga0075423_101329333 | 3300009162 | Populus Rhizosphere | MKSPNYVAVLAILNAILHRVSESMTVIDQATRQLGNSKISAKARAAK* |
| Ga0105340_11420163 | 3300009610 | Soil | AILNAILQRVSESLPLIDQATRELGHSKIPAKARAAK* |
| Ga0126374_109368391 | 3300009792 | Tropical Forest Soil | MKSPNYAAVLAILNAMLHRVSESLPLINQATRELGSNKIPAKVRAAN* |
| Ga0105061_10171012 | 3300009807 | Groundwater Sand | MKSPNYVAVLAILNAILHRVSESLPLIDQATRELGNSKIPAKAHPAK* |
| Ga0105088_10037252 | 3300009810 | Groundwater Sand | MKSPNYVAVLAILNAILHRVSESLPLIDQATRELGNSKIPAKAHAAK* |
| Ga0105084_10273582 | 3300009811 | Groundwater Sand | MKMKSPNYVAVLAILNAILHRVSESLPLIDQATRELGNSKIPAKAHPAK* |
| Ga0105070_10075113 | 3300009815 | Groundwater Sand | MKMKSPNYVAVLAILNAILHRVSESLPLIDQATRELGNSKIPAKAHAAK* |
| Ga0105062_10001257 | 3300009817 | Groundwater Sand | GGKMKSPNYVAVLAILNAILHRVSESLPLIDQATRELGNSKIPAKAHPAK* |
| Ga0126380_101790181 | 3300010043 | Tropical Forest Soil | MKSPNYAAVLAILNAMLHRVSESLPLIDQATRELGSNKIPAKARAAK* |
| Ga0126380_102968462 | 3300010043 | Tropical Forest Soil | MKSPNYAAVLAILNAMLHRVSESLPLIDQATRELGSSKIQVKARAAK* |
| Ga0126380_114254511 | 3300010043 | Tropical Forest Soil | MKSPNYAAVLAILNAMLHRVSESLPLIDEATRELGNNKIPAKAHAAK* |
| Ga0126384_105450722 | 3300010046 | Tropical Forest Soil | MGNEPKGGKMKSPNYAAVLAILNAMLHRVSESLPLIDQATRELGSSELKAKARASK* |
| Ga0126382_118376992 | 3300010047 | Tropical Forest Soil | MKSPNYAAVLAILNAMLHRVSESLPLIDQATRELGSSKVLAKARAAK* |
| Ga0126376_101910192 | 3300010359 | Tropical Forest Soil | MKSPNYAVVLAILNAMLHRVSESLPLIDQATRELGSNKILAKVRAAK* |
| Ga0126372_112589491 | 3300010360 | Tropical Forest Soil | NAMLHRVSESLPLIDQATRELGSNKIPAKARAAK* |
| Ga0126372_112740672 | 3300010360 | Tropical Forest Soil | MKSPNYAVVLAILNAMLHRVSESLPLIDQATRELGSNRITAKARAAK* |
| Ga0126372_115033751 | 3300010360 | Tropical Forest Soil | MKSPNYAAVLAILNAMLHRVSESLPLIDQATRELGSNKILAKVR |
| Ga0126377_104004732 | 3300010362 | Tropical Forest Soil | MKSPNYAAVLAILNAMLHRVSESLPLIDQATRELGNSELQAKARASK* |
| Ga0126377_111763561 | 3300010362 | Tropical Forest Soil | GGKMKSTNYPAVLAIPNGMLHRGSESLPLIDEATRELGGSKIQVKARAAK* |
| Ga0126377_130807992 | 3300010362 | Tropical Forest Soil | MKSPNYAAVLAILNAMLHRVSESLPLIDQATRELGSNKIPAKAHAVK* |
| Ga0126383_125521262 | 3300010398 | Tropical Forest Soil | MKSPNYAVVLAILNEMLHRVSESLPLIDQATREIGSSKVSAKARAAK* |
| Ga0137376_101142062 | 3300012208 | Vadose Zone Soil | MKSPNYVAVLAILSAMLRRVSESLPLIDQATRELGNTKIPAKVHAGK* |
| Ga0137377_115251352 | 3300012211 | Vadose Zone Soil | LAILNAILHRVSESLPLIDQATRELGNSKIPAKAHAAK* |
| Ga0137372_100101772 | 3300012350 | Vadose Zone Soil | MKSPNYVAVLAILNAILHRVSQSLPLIDQATRELGNSKVPAKARAAK* |
| Ga0137366_102057834 | 3300012354 | Vadose Zone Soil | MKSPNYVAVLAILNAILHRVSESLPLIDQATRELGNSKVPAKARAAK* |
| Ga0137397_100246463 | 3300012685 | Vadose Zone Soil | MKSPNYVAVLAILNAILHRVSESMTLIDQATRELGNSKIPAKARAAK* |
| Ga0137394_100131586 | 3300012922 | Vadose Zone Soil | MKSPNYVAVLAILNAILHRVSESLPLIDQATRELGKSKIPAKAHAAK* |
| Ga0137404_115387002 | 3300012929 | Vadose Zone Soil | MKSPNYVAVLAILNAILHRVSESMTLIDQATRELGNSKIPAKA |
| Ga0137407_110892302 | 3300012930 | Vadose Zone Soil | MKAAPNYVAVLAILNAILHRVSESLPLIDQATRELGHSKIPAKARAAK* |
| Ga0162650_1000599871 | 3300012939 | Soil | NYVAVLAILNAILRRVYESLPLIDQATRELGNSKIPAKAHAGK* |
| Ga0126375_100288952 | 3300012948 | Tropical Forest Soil | MKSPNYAAVLAILNAMLHRVSESLPLIDEATRELGVSKIQVKARAAK* |
| Ga0075344_10529141 | 3300014296 | Natural And Restored Wetlands | ETMQSPNYIAVLAILNAMLRRVSESIPQIEKSTRELGHWAVPAKIAGK* |
| Ga0075342_10745992 | 3300014320 | Natural And Restored Wetlands | MQSPNYITVLAILNAMLRRVSESIPQIEKSTRELGHWAVPAKIAGK* |
| Ga0137405_12080163 | 3300015053 | Vadose Zone Soil | MKSPDYVAVLAILNAILHRVSESLPLIDQATRELGNSKIPAKAHAAK* |
| Ga0184626_101614743 | 3300018053 | Groundwater Sediment | MKAPNYVAVLAILNAILHRVSESLPLIDQATRELGHSKIPAKARAAK |
| Ga0184635_100257274 | 3300018072 | Groundwater Sediment | MKSPNYVAVLAILNAILHRVSESLPLIDQATRELGHSKIPAKARAAK |
| Ga0184635_101478903 | 3300018072 | Groundwater Sediment | EEKMKAPNYVAVLAILNAILHRVSELLPLIDQATRELGHSKIPAKARAAK |
| Ga0184632_100902911 | 3300018075 | Groundwater Sediment | MKAPNYVAVLAILNAILHRVSELLPLIDQATRELGHSKIPAKARAAK |
| Ga0184609_104680982 | 3300018076 | Groundwater Sediment | MKAPNYVAVLAILNAILHRVSESLPLIDQATRELGYSKIPAKARAAK |
| Ga0184612_102960973 | 3300018078 | Groundwater Sediment | QWAIRPREEKMKAPNYVAVLAILNAILHRVSESLPLIDQATRELGHSKIPAKARAAK |
| Ga0184629_106344702 | 3300018084 | Groundwater Sediment | MDDTPKGGKMKAPNYVAVLAIVNAILHRVSESLPLIDQATRELGYSKIPAKARAAK |
| Ga0137408_14195993 | 3300019789 | Vadose Zone Soil | MKSPNYVAVLAILNAILHRVSESMTLIDQATRELGNSKIPAKARAAK |
| Ga0126371_128626161 | 3300021560 | Tropical Forest Soil | MKSPNYAAVLAILNAMLHRVSESLPLIDQATRELGSNKIPAKARAAK |
| Ga0222624_15964561 | 3300021951 | Groundwater Sediment | REEKMKAPNYVAVLAILNAILHRVSESLPLIDQATRELGHSKIPAKARAAK |
| Ga0210076_11117582 | 3300025567 | Natural And Restored Wetlands | MQSPNYIAVLAILNAMLRRVSESIPQIEKSTRELGHWAVPAKIAGK |
| Ga0208422_10220861 | 3300026053 | Natural And Restored Wetlands | MQSPNYIAVLAILNAMLRRVSESIPQIEKSTRELGHWAIPAKIAGK |
| Ga0209879_10323633 | 3300027056 | Groundwater Sand | MKMKSPNYVAVLAILNAILHRVSESLPLIDQATRELGNSKIPAKAHPAK |
| Ga0209878_10210732 | 3300027163 | Groundwater Sand | MKMKSPNYVAVLAILNAILHRVSESLPLIDQATRELGNSKIPAKAHAAK |
| Ga0209875_10098572 | 3300027209 | Groundwater Sand | MKSPNYVAVLAILNAILHRVSESLPLIDQATRELGNSKIPAKAHPAK |
| Ga0209846_10001443 | 3300027277 | Groundwater Sand | MKSPNYVAVLAILNAILHRVSESLPLIDQATRELGNSKIPAKAHAAK |
| Ga0208685_10007325 | 3300027513 | Soil | MKSPDYIAVLAILNAMLRRVSDLLPQIEKSTRELGHWAIPAKLPASKKSY |
| Ga0209799_10004033 | 3300027654 | Tropical Forest Soil | MKSPNYAAVLAILNAMLHRVSESLPLIDQATRELGSNKILAKVRAAK |
| Ga0209465_100811482 | 3300027874 | Tropical Forest Soil | MKSPNYAAVLAILNAMLHRVSESLPLIDQATRELGSSELQAKARASK |
| Ga0247642_10472992 | 3300030537 | Soil | GGKMESPNYVAVLAILNAILHRVSESLPLIDQATRELGSNKIPAKARAAK |
| Ga0247631_11508211 | 3300030550 | Soil | VLAILNAILHRVSKSLPLIDQATRELEGNKIAVKARAAK |
| Ga0247654_11509031 | 3300030552 | Soil | SPNYVAVLAILNAILHRVSESLPLIDQATRELEGNKIAVKARAAK |
| Ga0247645_11716551 | 3300030553 | Soil | PKGGKMKSPNYVAVLAILNAILHRVSESLPLIDQATRELEGNKIAVKARAAK |
| Ga0247618_11007562 | 3300030555 | Soil | MKSPNYVAVLAILNAILHRVSESLPLIDQATRELVGNKIAVKARAAK |
| Ga0247635_13320812 | 3300030565 | Soil | GKMKSPNYVAVLAILNAILHRVSESLPLIDQATRELEGNKIAVKARAAK |
| Ga0247647_12545391 | 3300030570 | Soil | MKSPNYVAVLAILNAILHRVSESLPLIDQATRELEGNKIAAKARAAK |
| Ga0247659_10983883 | 3300030600 | Soil | GKMKSPNYVAVLAILNAILHRVSESLPLIDQATRELEGNKIAAKARAAK |
| Ga0247655_103080931 | 3300030621 | Soil | QGGKMKSPNYVAVLAILNAILHRVSESLPLIDQATRELEGNKIAVKARAAK |
| Ga0247622_11743581 | 3300030682 | Soil | PKGGKMKSPNYVAVLAILNAILHRVSESLPLIDQATRELVGNKIAVKARAAK |
| Ga0307469_106293543 | 3300031720 | Hardwood Forest Soil | MKSPNYVAVLAILNAILHRVSESLPLIDQATRELGSSKIPAKARAAK |
| Ga0307469_113329221 | 3300031720 | Hardwood Forest Soil | NSLPTGAIRPKGEKMKSPNYVAVLAILNAILHRVSESMTVIDQATRELGNSKIPAKARAA |
| Ga0307468_1000094562 | 3300031740 | Hardwood Forest Soil | MKSPNYVAVLAILNAILHRVSESMTVIDQATRELGNSKISAKARAAK |
| Ga0307473_100374442 | 3300031820 | Hardwood Forest Soil | MKSPNYVAVLAILNAILHRVSESMTVIDQATRELGNSKIPAKARAAK |
| Ga0310904_101201684 | 3300031854 | Soil | MKSANYVAVLAILNAMLHRVSESLPVIDEATRELGNSRIPAKARAAK |
| Ga0310900_112911011 | 3300031908 | Soil | MKSANYVAVLAILNAMLHRVSESMTVIDQATRELGNSKIPAKARAAK |
| Ga0364925_0404199_322_516 | 3300034147 | Sediment | ALLNLTSNWAIRPREEKMKSPNYVAVLAILNAILHRVSESLPLIDQATRELGHSKIPAKARAAK |
| ⦗Top⦘ |