| Basic Information | |
|---|---|
| Family ID | F093373 |
| Family Type | Metagenome |
| Number of Sequences | 106 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MKTSVINQIKTLLGMEVKLETMKLMDGITIFEADAFE |
| Number of Associated Samples | 76 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.11 % |
| % of genes from short scaffolds (< 2000 bps) | 91.51 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (46.226 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (16.981 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.566 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (42.453 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.92% β-sheet: 9.23% Coil/Unstructured: 73.85% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF14550 | Peptidase_S78_2 | 18.87 |
| PF13884 | Peptidase_S74 | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 53.77 % |
| Unclassified | root | N/A | 46.23 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005582|Ga0049080_10008472 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR1-KM17-C101 | 3571 | Open in IMG/M |
| 3300005582|Ga0049080_10316706 | Not Available | 501 | Open in IMG/M |
| 3300006920|Ga0070748_1270475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300007538|Ga0099851_1184773 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 764 | Open in IMG/M |
| 3300007538|Ga0099851_1360647 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
| 3300007647|Ga0102855_1190610 | Not Available | 547 | Open in IMG/M |
| 3300007708|Ga0102859_1117688 | Not Available | 770 | Open in IMG/M |
| 3300008107|Ga0114340_1220551 | All Organisms → Viruses → Predicted Viral | 1103 | Open in IMG/M |
| 3300008110|Ga0114343_1181571 | Not Available | 632 | Open in IMG/M |
| 3300008266|Ga0114363_1209579 | Not Available | 589 | Open in IMG/M |
| 3300009082|Ga0105099_10005626 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6682 | Open in IMG/M |
| 3300009085|Ga0105103_10825313 | Not Available | 539 | Open in IMG/M |
| 3300009085|Ga0105103_10939421 | Not Available | 509 | Open in IMG/M |
| 3300009158|Ga0114977_10148159 | All Organisms → Viruses → Predicted Viral | 1399 | Open in IMG/M |
| 3300009165|Ga0105102_10827433 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300009169|Ga0105097_10077155 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1811 | Open in IMG/M |
| 3300009169|Ga0105097_10143697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1312 | Open in IMG/M |
| 3300009169|Ga0105097_10391802 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 772 | Open in IMG/M |
| 3300009169|Ga0105097_10825441 | Not Available | 529 | Open in IMG/M |
| 3300009184|Ga0114976_10307942 | All Organisms → Viruses | 846 | Open in IMG/M |
| 3300012013|Ga0153805_1083596 | Not Available | 541 | Open in IMG/M |
| 3300012663|Ga0157203_1042110 | Not Available | 625 | Open in IMG/M |
| 3300012663|Ga0157203_1051833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
| 3300012663|Ga0157203_1053247 | Not Available | 547 | Open in IMG/M |
| 3300013004|Ga0164293_10707628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
| 3300013372|Ga0177922_10627758 | Not Available | 572 | Open in IMG/M |
| 3300013372|Ga0177922_10949601 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 559 | Open in IMG/M |
| 3300017766|Ga0181343_1081193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR1-KM17-C101 | 930 | Open in IMG/M |
| 3300017774|Ga0181358_1038925 | All Organisms → cellular organisms → Bacteria | 1833 | Open in IMG/M |
| 3300017778|Ga0181349_1108251 | All Organisms → Viruses → Predicted Viral | 1035 | Open in IMG/M |
| 3300017778|Ga0181349_1220242 | Not Available | 647 | Open in IMG/M |
| 3300017780|Ga0181346_1258134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
| 3300017780|Ga0181346_1260722 | Not Available | 602 | Open in IMG/M |
| 3300017780|Ga0181346_1277848 | Not Available | 575 | Open in IMG/M |
| 3300020169|Ga0206127_1076805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1516 | Open in IMG/M |
| 3300020533|Ga0208364_1020172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 943 | Open in IMG/M |
| 3300021600|Ga0194059_1042157 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR1-KM17-C101 | 1518 | Open in IMG/M |
| 3300021962|Ga0222713_10113156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR1-KM17-C101 | 1924 | Open in IMG/M |
| 3300021963|Ga0222712_10370476 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 878 | Open in IMG/M |
| 3300021963|Ga0222712_10577653 | Not Available | 652 | Open in IMG/M |
| 3300024343|Ga0244777_10499437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 747 | Open in IMG/M |
| 3300025889|Ga0208644_1069794 | Not Available | 1845 | Open in IMG/M |
| 3300027193|Ga0208800_1030750 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 720 | Open in IMG/M |
| 3300027203|Ga0208925_108574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 744 | Open in IMG/M |
| 3300027621|Ga0208951_1150206 | Not Available | 608 | Open in IMG/M |
| 3300027693|Ga0209704_1087247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 880 | Open in IMG/M |
| 3300027721|Ga0209492_1002781 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5509 | Open in IMG/M |
| 3300027721|Ga0209492_1227282 | Not Available | 636 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1052666 | All Organisms → Viruses → Predicted Viral | 2323 | Open in IMG/M |
| 3300027732|Ga0209442_1245086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
| 3300027785|Ga0209246_10001740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 8515 | Open in IMG/M |
| 3300027785|Ga0209246_10039364 | Not Available | 1809 | Open in IMG/M |
| 3300027785|Ga0209246_10095847 | Not Available | 1161 | Open in IMG/M |
| 3300027785|Ga0209246_10350392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
| 3300027798|Ga0209353_10406611 | Not Available | 558 | Open in IMG/M |
| 3300027805|Ga0209229_10105340 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1271 | Open in IMG/M |
| 3300027808|Ga0209354_10276103 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
| 3300027808|Ga0209354_10324005 | Not Available | 610 | Open in IMG/M |
| 3300027816|Ga0209990_10343565 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
| 3300027892|Ga0209550_10462037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 771 | Open in IMG/M |
| 3300031566|Ga0307378_10908348 | Not Available | 728 | Open in IMG/M |
| 3300031566|Ga0307378_11416631 | Not Available | 534 | Open in IMG/M |
| 3300031578|Ga0307376_10242739 | All Organisms → Viruses → Predicted Viral | 1217 | Open in IMG/M |
| 3300031673|Ga0307377_10577598 | Not Available | 807 | Open in IMG/M |
| 3300031707|Ga0315291_11469853 | Not Available | 538 | Open in IMG/M |
| 3300031746|Ga0315293_11023859 | Not Available | 586 | Open in IMG/M |
| 3300031746|Ga0315293_11140372 | Not Available | 545 | Open in IMG/M |
| 3300031758|Ga0315907_10267122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1414 | Open in IMG/M |
| 3300031758|Ga0315907_10456124 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR1-KM17-C101 | 1020 | Open in IMG/M |
| 3300031772|Ga0315288_10976014 | Not Available | 757 | Open in IMG/M |
| 3300031772|Ga0315288_11420291 | Not Available | 579 | Open in IMG/M |
| 3300031787|Ga0315900_11030721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
| 3300031834|Ga0315290_11650408 | Not Available | 516 | Open in IMG/M |
| 3300031857|Ga0315909_11011093 | Not Available | 501 | Open in IMG/M |
| 3300031873|Ga0315297_11712899 | All Organisms → Viruses | 503 | Open in IMG/M |
| 3300031952|Ga0315294_11105379 | Not Available | 651 | Open in IMG/M |
| 3300031952|Ga0315294_11374131 | Not Available | 560 | Open in IMG/M |
| 3300031952|Ga0315294_11421779 | Not Available | 547 | Open in IMG/M |
| 3300031952|Ga0315294_11425243 | Not Available | 546 | Open in IMG/M |
| 3300031952|Ga0315294_11559734 | Not Available | 513 | Open in IMG/M |
| 3300031963|Ga0315901_10978841 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
| 3300031999|Ga0315274_11556820 | All Organisms → Viruses | 624 | Open in IMG/M |
| 3300032046|Ga0315289_11198326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
| 3300032053|Ga0315284_12242405 | Not Available | 542 | Open in IMG/M |
| 3300032093|Ga0315902_10030800 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6447 | Open in IMG/M |
| 3300032116|Ga0315903_10298945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1361 | Open in IMG/M |
| 3300032118|Ga0315277_11684945 | Not Available | 532 | Open in IMG/M |
| 3300032118|Ga0315277_11776000 | Not Available | 513 | Open in IMG/M |
| 3300032397|Ga0315287_12307686 | All Organisms → Viruses | 584 | Open in IMG/M |
| 3300034012|Ga0334986_0457375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
| 3300034018|Ga0334985_0121830 | All Organisms → Viruses → Predicted Viral | 1814 | Open in IMG/M |
| 3300034018|Ga0334985_0362297 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 883 | Open in IMG/M |
| 3300034022|Ga0335005_0296496 | All Organisms → Viruses | 963 | Open in IMG/M |
| 3300034050|Ga0335023_0499165 | Not Available | 630 | Open in IMG/M |
| 3300034051|Ga0335024_0461534 | Not Available | 625 | Open in IMG/M |
| 3300034061|Ga0334987_0233954 | Not Available | 1265 | Open in IMG/M |
| 3300034066|Ga0335019_0847736 | Not Available | 512 | Open in IMG/M |
| 3300034095|Ga0335022_0270263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 979 | Open in IMG/M |
| 3300034101|Ga0335027_0513547 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 748 | Open in IMG/M |
| 3300034101|Ga0335027_0627265 | Not Available | 650 | Open in IMG/M |
| 3300034101|Ga0335027_0880922 | Not Available | 510 | Open in IMG/M |
| 3300034105|Ga0335035_0050110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2753 | Open in IMG/M |
| 3300034120|Ga0335056_0489857 | Not Available | 649 | Open in IMG/M |
| 3300034168|Ga0335061_0011717 | All Organisms → Viruses | 4554 | Open in IMG/M |
| 3300034284|Ga0335013_0342909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 937 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 16.98% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 16.98% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 16.04% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 10.38% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 6.60% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.72% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 3.77% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.83% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 2.83% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.83% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.89% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.89% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.94% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.94% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.94% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.94% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.94% |
| Lake Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Lake Water | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005936 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKS | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300020169 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1 | Environmental | Open in IMG/M |
| 3300020533 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021600 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L626-11m | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
| 3300027203 | Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034050 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095 | Environmental | Open in IMG/M |
| 3300034051 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13May2013-rr0097 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0049080_100084721 | 3300005582 | Freshwater Lentic | MKTSVINQIKTLLGMEVKLETMKLMDGITIFEADAF |
| Ga0049080_103167062 | 3300005582 | Freshwater Lentic | MKTSVINQIKTLLGMEVKLETMKLMDGITIFEADA |
| Ga0075124_102925063 | 3300005936 | Lake Water | MKEKSIINQVKTLLGMEVSLETMTLENGTVLEAEAFEAGNE |
| Ga0070748_12704753 | 3300006920 | Aqueous | MNVINEIKTLLGMEVKLAQMKLVDGVTVIEAEVFE |
| Ga0099851_11847733 | 3300007538 | Aqueous | MSNVINQIKTLLGMEVKLAQMALENGTIIEAEVFEA |
| Ga0099851_13606473 | 3300007538 | Aqueous | MSVINEIKTLLGMEVKLAQMKLMDGMTVIEADSFQL |
| Ga0102855_11906102 | 3300007647 | Estuarine | MKNSTINKIKSLLGMEVKLEQMMLIDGTTVLEADAFEMDN |
| Ga0102859_11176884 | 3300007708 | Estuarine | MKTSVINQIKTLLGMEVKLETMKLMDGITIFEADAFEMDK |
| Ga0114340_12205512 | 3300008107 | Freshwater, Plankton | MKNSLINQIKTLLGMEVKLETMKLSDGVTVLEAEMFENKK* |
| Ga0114343_11815711 | 3300008110 | Freshwater, Plankton | MKNSLINQIKTLLGMEVKLETMKLSDGVTVLEAEMFEAGN |
| Ga0114363_12095791 | 3300008266 | Freshwater, Plankton | MKNSLINQIKTLLGMEVKLETMKLSDGVTVLEAEM |
| Ga0105099_100056261 | 3300009082 | Freshwater Sediment | MNVINEIKTLLGMEVKLAQMKLKDGVTIIEAEAFEM |
| Ga0105103_108253131 | 3300009085 | Freshwater Sediment | MKNSLINQIKTLLGMEVKLEQMKLMDGVTVLEADM |
| Ga0105103_109394212 | 3300009085 | Freshwater Sediment | MKNSLINQIKTLLGMEVKLEQMKLMDGVSILEAESFEAG |
| Ga0114977_101481591 | 3300009158 | Freshwater Lake | MKTSVINQIKTLLGMEVKLETMKLADGITIFEADA |
| Ga0105102_108274332 | 3300009165 | Freshwater Sediment | MNVLNEIKTLLGMEVNLAQMKLKDGVTVIEAEMFEA |
| Ga0105097_100771555 | 3300009169 | Freshwater Sediment | MNVINEIKTLLGMEVKLAQMKLEDGVTVIEAEAFE |
| Ga0105097_101436971 | 3300009169 | Freshwater Sediment | MNVINEIKTLLGMEVKLAQMKLKDGVTVIEADAFETDNA |
| Ga0105097_103918023 | 3300009169 | Freshwater Sediment | MNVINEIKTLLGMEVKLAQMKLKDGVTVIEADAFEM |
| Ga0105097_108254412 | 3300009169 | Freshwater Sediment | MKNSLINQIKTLLGMEVKLEQMKLMDGVSIIEAESFEAGSE |
| Ga0114976_103079421 | 3300009184 | Freshwater Lake | MKTSVINQIKTLLGMEVKLETMKLADGITIFEADAFEM |
| Ga0153805_10835961 | 3300012013 | Surface Ice | MKTSVINQIKTLLGMEVKLETMKLMDGITIFEADAFEMDKE |
| Ga0157203_10421101 | 3300012663 | Freshwater | MKNSTVNKIKALLGMEVSLEQMKLMDGITILEADAF |
| Ga0157203_10518332 | 3300012663 | Freshwater | MKNSTVNKIKALLGMEVKLEQMKLMDGITILEADAFEMDNE |
| Ga0157203_10532472 | 3300012663 | Freshwater | MKNSTVNKIKSLLGMEVKLEQMMLMDGITILEADAFEMDNE |
| Ga0164293_107076281 | 3300013004 | Freshwater | MKNSLINQIKTLLGMEVKLEQMKLVDGVTVLEADSFEAGNE |
| Ga0177922_106277582 | 3300013372 | Freshwater | MKNSLINQIKTLLGMEVKLEQMKLMDGVTVLEADMFEAGNE |
| Ga0177922_109496013 | 3300013372 | Freshwater | MKTNVLTQIKQLLGMEVKLEMMKLADGMTMIEADSFEPEMAV |
| Ga0181343_10811934 | 3300017766 | Freshwater Lake | MKNSLINQIKTLLGMEVKLETIKLSDGVTVLEAEMFEAG |
| Ga0181358_10389254 | 3300017774 | Freshwater Lake | MNVINEIKTLLGMEVKLAQMKLKDGVTVLEADAFETDNA |
| Ga0181349_11082511 | 3300017778 | Freshwater Lake | MKTSVINQIKTLLGMEVKLETMKLMDGITIFEADTFETDKEVFI |
| Ga0181349_12202423 | 3300017778 | Freshwater Lake | MKTSVINQIKTLLGMEVKLETMKLMDGITIFEADAFETV |
| Ga0181346_12581342 | 3300017780 | Freshwater Lake | MNVVNQIKELLGMDVKLAQMKLMDGVTVIEAETFE |
| Ga0181346_12607222 | 3300017780 | Freshwater Lake | MKTSVINQIKTLLGMEVKLETMKLMDGITIFEADTFETD |
| Ga0181346_12778481 | 3300017780 | Freshwater Lake | MKTSVINQIKTLLGMEVKLETMKLMDGITIFEADAFEMDN |
| Ga0206127_10768051 | 3300020169 | Seawater | MNKIDQIKTLLGMEVKLETMKLVNGTEIEAEVFEA |
| Ga0208364_10201724 | 3300020533 | Freshwater | MKNSLINQIKTLLGMEVKLEQMKLMDGVTVLEADMFEAG |
| Ga0194059_10421571 | 3300021600 | Anoxic Zone Freshwater | MKTSVINQIKTLLGMEVKLMQMKMADGVTIVEADKFEMDNEVFVVT |
| Ga0222713_101131561 | 3300021962 | Estuarine Water | MKNSTINKIKALLGMEVSLEMMKLADGQTVLEADAFEM |
| Ga0222712_103704764 | 3300021963 | Estuarine Water | MNVINEIKTLLGMEVKLAQMKLKDGVTILEADAFEVD |
| Ga0222712_105776531 | 3300021963 | Estuarine Water | MKNSTINKIKALLGMEVSLEMMKLADGVTILEADAFEMD |
| Ga0244777_104994371 | 3300024343 | Estuarine | MKNSTINKIKSLLGMEVKLEQMMLIDGTTVLEADAFEMDNEVFIV |
| Ga0208644_10697941 | 3300025889 | Aqueous | MKDKSVINQIKTLLGLEVKLEQMTLENGTVIEADS |
| Ga0208800_10307503 | 3300027193 | Estuarine | MNVINEIKTLLGMEVKLAQMKLEDGVTVIEAEVFEAEA |
| Ga0208925_1085741 | 3300027203 | Estuarine | MKNSTINKIKSLLGMEVKLEQMMLIDGTTVLEADAFEMDNEVFI |
| Ga0208951_11502063 | 3300027621 | Freshwater Lentic | MKTSVINQIKTLLGMDVKLEQRKMADGVTLIEADAF |
| Ga0209704_10872471 | 3300027693 | Freshwater Sediment | MSNVINQIKTLLGMEVKLAQMALENGTIIEAEVFEAGASVF |
| Ga0209492_10027811 | 3300027721 | Freshwater Sediment | MNVINEIKTLLGMEVKLAQMKLKDGVTVIEADAFE |
| Ga0209492_12272823 | 3300027721 | Freshwater Sediment | MKNSLINQIKTLLGMEVKLEQMKLMDGVTVLEADMFEA |
| (restricted) Ga0247836_10526661 | 3300027728 | Freshwater | MKNSLINQIKTLLGMEVKLEQMKLADGVTVFEADTFEPEMEIVIVTEDE |
| Ga0209442_12450861 | 3300027732 | Freshwater Lake | MNVINEIKTLLGMEVKLAQMKLKDGVTVIEADAFEMDNNV |
| Ga0209246_1000174011 | 3300027785 | Freshwater Lake | MNVINEIKTLLGMEVKLAQMKLKDGVTVIEADAFEMDN |
| Ga0209246_100393644 | 3300027785 | Freshwater Lake | MKTSVINQIKTLLGMEVKLETMKLMDGITIFEADTFE |
| Ga0209246_100958475 | 3300027785 | Freshwater Lake | MKTSVINQIKTLLGMEVKLETMKLMDGITIFEADTF |
| Ga0209246_103503922 | 3300027785 | Freshwater Lake | MKTSVINQIKTLLGMDVKLEQRKMADGVTLIEADAFEMDNEVFVIT |
| Ga0209353_104066112 | 3300027798 | Freshwater Lake | MKTSVINQIKTLLGMEVKLETMKLMDGITIFEADTFETDKEVF |
| Ga0209229_101053404 | 3300027805 | Freshwater And Sediment | MSNVINQIKTLLGMEVKLAQMALENGTIIEAEVFE |
| Ga0209354_102761031 | 3300027808 | Freshwater Lake | MNIINQIKTLLNMEVKLEQLRLADGMTVLEADSFEPEMEVF |
| Ga0209354_103240052 | 3300027808 | Freshwater Lake | MKTSVINQIKTLLGMEVKLETIKLIDGITIFEADTFETDKEVFIV |
| Ga0209990_103435653 | 3300027816 | Freshwater Lake | MLNMKKNVINQIKELLGMEVKLATMKLSDGVTILEAEMFE |
| Ga0209550_104620373 | 3300027892 | Freshwater Lake | MNVINEIKTLLGMEVKLAQMKLKDGVTVLEADAFETDNAV |
| Ga0307378_109083483 | 3300031566 | Soil | MKTSVINQIKTLLGMDVKLEQRKMADGVTLIEADA |
| Ga0307378_114166311 | 3300031566 | Soil | MKTSVINQIKTLLGMEVKLETIKLIDGITIFEADTFETEKEIFI |
| Ga0307376_102427395 | 3300031578 | Soil | MKTSVINQIKTLLGMEVKLETIKLIDGITIFEADSFEAEKE |
| Ga0307377_105775981 | 3300031673 | Soil | MKTSVINQIKTLLGMEVKLETIKLIDGITIFEADTFETDKEVF |
| Ga0315291_114698531 | 3300031707 | Sediment | MKTSVINQIKTLLGMEVKLETMKLMDGITIFEADAFETD |
| Ga0315293_110238591 | 3300031746 | Sediment | MKTSVINQIKTLLGMEVKLETMKLMDGITIFEADAFETDKE |
| Ga0315293_111403722 | 3300031746 | Sediment | MKTSVINQIKTLLGMEVKLETMKLMDGITIFEADAFET |
| Ga0315907_102671221 | 3300031758 | Freshwater | MKNSLINQIKTLLGMEVNLEQMKLADGVTVLEADMFE |
| Ga0315907_104561241 | 3300031758 | Freshwater | MKNSLINQIKTLLGMEVKLETMKLSDGVTVLEAEMFEAG |
| Ga0315288_109760141 | 3300031772 | Sediment | MKTSVINQIKTLLGMEVKLETMKLMDGITIFEADTFET |
| Ga0315288_114202911 | 3300031772 | Sediment | MKTSVINQIKTLLGMEVKLETIKLMDGITIFEADTFET |
| Ga0315900_110307212 | 3300031787 | Freshwater | MKNSLINQIKTLLGMEVKLEQMKLMDGVTVLEADSFEAG |
| Ga0315290_116504082 | 3300031834 | Sediment | MKTSVINQIKTLLGMEVKLETMKLMDGITIFEAEA |
| Ga0315909_110110932 | 3300031857 | Freshwater | MKNSLINQIKTLLGMEVKLETMKLSDGVTVLEAEMF |
| Ga0315297_117128991 | 3300031873 | Sediment | MKTSVINQIKNLLGMEVKLEQRKMADGVTLIEADAFEIENEVFVITE |
| Ga0315294_111053791 | 3300031952 | Sediment | MKTSVINQIKTLLGMEVKLETMKLMDGITIFEADT |
| Ga0315294_113741311 | 3300031952 | Sediment | MKTSVINQIKTLLGMEVKLETMKLMDGITIFEADAFETDKEV |
| Ga0315294_114217792 | 3300031952 | Sediment | MKTSVINQIKTLLGMDVKLEQRKMADGVTLIEADT |
| Ga0315294_114252431 | 3300031952 | Sediment | MKTSVINQIKTLLGMEVKLETMKLMDGITIFEADTFETDK |
| Ga0315294_115597341 | 3300031952 | Sediment | MKTSVINQIKTLLGMEVKLETMKLMDGITIFEADTFETDKE |
| Ga0315901_109788411 | 3300031963 | Freshwater | MKNSLINQIKTLLGMEVKLEQMKLMDGVTVLEADMFEAGNEIFVVTED |
| Ga0315274_115568202 | 3300031999 | Sediment | MKTSVINQIKTLLGMDVKLEQRKMADGVTLIEADAFEM |
| Ga0315289_111983261 | 3300032046 | Sediment | MKTSVINQIKTLLGMDVKLEQRKMADGVTLIEADAFEMDNEVFVI |
| Ga0315284_122424051 | 3300032053 | Sediment | MKTSVINQIKTLLGMEVKLETMKLMDGITIFEADAFEM |
| Ga0315902_100308007 | 3300032093 | Freshwater | MKTNVLTQIKQLLGMEVKLEMMKLADGMTMIEADSF |
| Ga0315903_102989451 | 3300032116 | Freshwater | MKNSLINQIKTLLGMEVKLETMKLSDGVTVLEADMFEAG |
| Ga0315277_116849451 | 3300032118 | Sediment | MKTSVINQIKTLLGMEVKLETMKLMDGITIFEADAFE |
| Ga0315277_117760002 | 3300032118 | Sediment | MKTSVINQIKTLLGMEVKLETIKLIDGITIFEADAFET |
| Ga0315287_123076861 | 3300032397 | Sediment | MKTSVINQIKNLLGMEVKLEQRKMADGVTLIEADAFEIENEVF |
| Ga0334986_0457375_517_636 | 3300034012 | Freshwater | MKNSLINQIKTLLGMEVKLEQMKLMDGVTVLEADMFEAGN |
| Ga0334985_0121830_1682_1813 | 3300034018 | Freshwater | MKNSLINQIKTLLGMEVKLEQMKLMDGVSILEAESFEAGSEVFI |
| Ga0334985_0362297_763_882 | 3300034018 | Freshwater | MNVVNQIKELLGMEVKLAQMKLMDGVTVIEAEAFEPEMAV |
| Ga0335005_0296496_3_119 | 3300034022 | Freshwater | MKTSVINQIKTLLGMEVKLETMKLMDGITIFEADAFEMD |
| Ga0335023_0499165_3_122 | 3300034050 | Freshwater | MKNSLINQIKTLLGMEVKLEQMMLADGVTVLEADSFEPEM |
| Ga0335024_0461534_510_623 | 3300034051 | Freshwater | MSNVINQIKTLLGMEVKLAQMALENGTIIEAEMFEAGA |
| Ga0334987_0233954_1131_1265 | 3300034061 | Freshwater | MLNMKKNVINQIKELLGMEVKLATMKLSDGMTILEAEVFEAGAEV |
| Ga0335019_0847736_1_108 | 3300034066 | Freshwater | MKNSLINQIKTLLGMEVKLEQMKLMDGVTVLEADMF |
| Ga0335022_0270263_2_109 | 3300034095 | Freshwater | MNVREAINTIKTYLNMEVKLAKMMLVDGVTVLEANE |
| Ga0335027_0513547_2_133 | 3300034101 | Freshwater | MKNSLINQIKTLLGMEVKLEQMKLMDGVTVLEADMFEAGNEIFV |
| Ga0335027_0627265_1_108 | 3300034101 | Freshwater | MKNSLINQIKTLLGMEVKLEQMKLMDGVTVLEADSF |
| Ga0335027_0880922_2_112 | 3300034101 | Freshwater | MKNSLINQIKTLLGMEVKLETMKLSDGVTVLEAEMFE |
| Ga0335035_0050110_2_106 | 3300034105 | Freshwater | MNIINQIKTLLNMEVKLEQMKLADGMTVLEADSFA |
| Ga0335056_0489857_512_649 | 3300034120 | Freshwater | MKNSLINQIKTLLGMEVKLEQMKLMDGVTVLEADMFEAGNEIFVVT |
| Ga0335061_0011717_4448_4552 | 3300034168 | Freshwater | MNIINQIKTLLNMEVKLEQMKLADGMTVLEADSFE |
| Ga0335013_0342909_1_135 | 3300034284 | Freshwater | MKNSLINQIKTLLGMEVKLEQMKLMDGVTVLEADMFEAGNEIFVV |
| ⦗Top⦘ |