| Basic Information | |
|---|---|
| Family ID | F093364 |
| Family Type | Metagenome |
| Number of Sequences | 106 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MSTKENAIGRRSLLSTGAAAAGLGLLADLEAYPQNVNRNSIPSDLK |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.57 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (89.623 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa (13.207 % of family members) |
| Environment Ontology (ENVO) | Unclassified (18.868 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.453 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 39.19% β-sheet: 0.00% Coil/Unstructured: 60.81% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF07676 | PD40 | 4.72 |
| PF00144 | Beta-lactamase | 2.83 |
| PF12543 | DUF3738 | 2.83 |
| PF01850 | PIN | 1.89 |
| PF13378 | MR_MLE_C | 1.89 |
| PF02129 | Peptidase_S15 | 0.94 |
| PF07366 | SnoaL | 0.94 |
| PF13414 | TPR_11 | 0.94 |
| PF13692 | Glyco_trans_1_4 | 0.94 |
| PF01381 | HTH_3 | 0.94 |
| PF13384 | HTH_23 | 0.94 |
| PF01261 | AP_endonuc_2 | 0.94 |
| PF09876 | DUF2103 | 0.94 |
| PF00069 | Pkinase | 0.94 |
| PF02518 | HATPase_c | 0.94 |
| PF13442 | Cytochrome_CBB3 | 0.94 |
| PF05724 | TPMT | 0.94 |
| PF06283 | ThuA | 0.94 |
| PF08450 | SGL | 0.94 |
| PF13515 | FUSC_2 | 0.94 |
| PF13714 | PEP_mutase | 0.94 |
| PF13701 | DDE_Tnp_1_4 | 0.94 |
| PF13620 | CarboxypepD_reg | 0.94 |
| PF14870 | PSII_BNR | 0.94 |
| PF00027 | cNMP_binding | 0.94 |
| PF15919 | HicB_lk_antitox | 0.94 |
| PF01738 | DLH | 0.94 |
| PF01569 | PAP2 | 0.94 |
| PF05635 | 23S_rRNA_IVP | 0.94 |
| PF13561 | adh_short_C2 | 0.94 |
| PF01152 | Bac_globin | 0.94 |
| PF09957 | VapB_antitoxin | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.77 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 2.83 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 2.83 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 2.83 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.94 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.94 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.94 |
| COG4813 | Trehalose utilization protein | Carbohydrate transport and metabolism [G] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.62 % |
| Unclassified | root | N/A | 10.38 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004092|Ga0062389_101016600 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300005327|Ga0070658_10875589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 781 | Open in IMG/M |
| 3300005344|Ga0070661_100547420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 59-55 | 931 | Open in IMG/M |
| 3300005435|Ga0070714_100420135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1266 | Open in IMG/M |
| 3300005535|Ga0070684_100645043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 986 | Open in IMG/M |
| 3300005764|Ga0066903_100884271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1614 | Open in IMG/M |
| 3300005764|Ga0066903_103966302 | Not Available | 794 | Open in IMG/M |
| 3300005921|Ga0070766_11174375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300006028|Ga0070717_11278300 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 667 | Open in IMG/M |
| 3300006052|Ga0075029_100001913 | All Organisms → cellular organisms → Bacteria | 11842 | Open in IMG/M |
| 3300006052|Ga0075029_100026000 | All Organisms → cellular organisms → Bacteria | 3301 | Open in IMG/M |
| 3300006162|Ga0075030_100919585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300006954|Ga0079219_10940511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
| 3300009093|Ga0105240_10502920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1347 | Open in IMG/M |
| 3300009177|Ga0105248_11866758 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300009521|Ga0116222_1085293 | All Organisms → cellular organisms → Bacteria | 1361 | Open in IMG/M |
| 3300009700|Ga0116217_10006542 | All Organisms → cellular organisms → Bacteria | 10096 | Open in IMG/M |
| 3300010048|Ga0126373_10495539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1263 | Open in IMG/M |
| 3300010358|Ga0126370_10841245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 822 | Open in IMG/M |
| 3300010373|Ga0134128_10789130 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300010379|Ga0136449_101508244 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300010398|Ga0126383_11965786 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300010398|Ga0126383_12439813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300012354|Ga0137366_11223606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300012924|Ga0137413_10313763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1100 | Open in IMG/M |
| 3300012958|Ga0164299_11006882 | Not Available | 614 | Open in IMG/M |
| 3300012971|Ga0126369_12848310 | Not Available | 566 | Open in IMG/M |
| 3300012988|Ga0164306_11083078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300013105|Ga0157369_10233893 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1921 | Open in IMG/M |
| 3300014152|Ga0181533_1179775 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 835 | Open in IMG/M |
| 3300014199|Ga0181535_10319655 | Not Available | 922 | Open in IMG/M |
| 3300014489|Ga0182018_10293363 | Not Available | 886 | Open in IMG/M |
| 3300014489|Ga0182018_10611093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300014492|Ga0182013_10005472 | All Organisms → cellular organisms → Bacteria | 14755 | Open in IMG/M |
| 3300014496|Ga0182011_10871511 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300014501|Ga0182024_10763347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella rosea | 1184 | Open in IMG/M |
| 3300014502|Ga0182021_11188992 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300014638|Ga0181536_10208399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 967 | Open in IMG/M |
| 3300014839|Ga0182027_11368645 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300015371|Ga0132258_13590783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1061 | Open in IMG/M |
| 3300015373|Ga0132257_100995026 | Not Available | 1055 | Open in IMG/M |
| 3300016387|Ga0182040_11796724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300017940|Ga0187853_10142381 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1153 | Open in IMG/M |
| 3300017996|Ga0187891_1201730 | Not Available | 679 | Open in IMG/M |
| 3300018019|Ga0187874_10250708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
| 3300018026|Ga0187857_10269050 | Not Available | 782 | Open in IMG/M |
| 3300018033|Ga0187867_10816465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300018037|Ga0187883_10559951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300018060|Ga0187765_10749836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300019082|Ga0187852_1109207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1209 | Open in IMG/M |
| 3300019082|Ga0187852_1179006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 884 | Open in IMG/M |
| 3300020579|Ga0210407_10656502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
| 3300021401|Ga0210393_10188766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1664 | Open in IMG/M |
| 3300021403|Ga0210397_10782871 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300021405|Ga0210387_11387948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300025898|Ga0207692_10690958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300025909|Ga0207705_10684320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 797 | Open in IMG/M |
| 3300025913|Ga0207695_11344522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300025921|Ga0207652_11890282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300025928|Ga0207700_11962515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300025929|Ga0207664_10172322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1853 | Open in IMG/M |
| 3300027911|Ga0209698_10777257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300028747|Ga0302219_10258258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300028775|Ga0302231_10526084 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300028798|Ga0302222_10155100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 902 | Open in IMG/M |
| 3300029910|Ga0311369_10495087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1040 | Open in IMG/M |
| 3300029910|Ga0311369_11165353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300029913|Ga0311362_10438369 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
| 3300029922|Ga0311363_10961448 | Not Available | 756 | Open in IMG/M |
| 3300029951|Ga0311371_11802952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300030007|Ga0311338_10102610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3551 | Open in IMG/M |
| 3300030057|Ga0302176_10377703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300030399|Ga0311353_10351628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis | 1337 | Open in IMG/M |
| 3300030737|Ga0302310_10311249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 883 | Open in IMG/M |
| 3300031028|Ga0302180_10255744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 918 | Open in IMG/M |
| 3300031231|Ga0170824_109706523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300031234|Ga0302325_11764456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 778 | Open in IMG/M |
| 3300031525|Ga0302326_10132906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4336 | Open in IMG/M |
| 3300031525|Ga0302326_10896943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 1261 | Open in IMG/M |
| 3300031708|Ga0310686_118715225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa ligni | 1407 | Open in IMG/M |
| 3300031708|Ga0310686_119151302 | All Organisms → cellular organisms → Bacteria | 3150 | Open in IMG/M |
| 3300031902|Ga0302322_102771005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300031912|Ga0306921_11677584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 688 | Open in IMG/M |
| 3300031938|Ga0308175_100135276 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2339 | Open in IMG/M |
| 3300031938|Ga0308175_102960251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300031939|Ga0308174_10336521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1200 | Open in IMG/M |
| 3300031954|Ga0306926_12967293 | Not Available | 508 | Open in IMG/M |
| 3300031962|Ga0307479_12063974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300031996|Ga0308176_12643293 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300032076|Ga0306924_11569885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300032076|Ga0306924_11647886 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300032160|Ga0311301_10855907 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300032160|Ga0311301_11678863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
| 3300032261|Ga0306920_103240210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300032829|Ga0335070_11139995 | Not Available | 717 | Open in IMG/M |
| 3300032895|Ga0335074_11153561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300032897|Ga0335071_10167618 | All Organisms → cellular organisms → Bacteria | 2148 | Open in IMG/M |
| 3300033004|Ga0335084_10940824 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300033405|Ga0326727_10288268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1635 | Open in IMG/M |
| 3300033493|Ga0316631_10181855 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300033513|Ga0316628_104361655 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300033755|Ga0371489_0002268 | All Organisms → cellular organisms → Bacteria | 26038 | Open in IMG/M |
| 3300033824|Ga0334840_064950 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1058 | Open in IMG/M |
| 3300033824|Ga0334840_142175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300034163|Ga0370515_0051013 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1823 | Open in IMG/M |
| 3300034163|Ga0370515_0398293 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 13.21% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 7.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.66% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.66% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.72% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.72% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.77% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.83% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 2.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.83% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.89% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.89% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.89% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.89% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.89% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.89% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.89% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.94% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.94% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.94% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.94% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.94% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033493 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D3_A | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| 3300033824 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S2 5-9 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062389_1010166001 | 3300004092 | Bog Forest Soil | MPTDENAIGRRTLLGTGAAVAGLGLLADLEAYPQNVNRNS |
| Ga0070658_108755891 | 3300005327 | Corn Rhizosphere | MSTRENAIRRRSFLSMGATAAGLGLLSDLEAYPQNVNRNS |
| Ga0070661_1005474201 | 3300005344 | Corn Rhizosphere | MSANKNAIGRRSFLRTGAAAAGLGLLADLEAYPQNVNRNSSPSDLKI |
| Ga0070714_1004201351 | 3300005435 | Agricultural Soil | MSTNENAFGRRSLLRKGAAAAGLSLLADLEAYPQNVNRNS |
| Ga0070684_1006450431 | 3300005535 | Corn Rhizosphere | MSRNENGIGRRSLLKTGAAALGLGLLADLEAYPQNVNRNSNPS |
| Ga0066903_1008842711 | 3300005764 | Tropical Forest Soil | MATKDNEIGRRLLLGTGAAAAGLGLLADLEAYPQNVNRSSSPSDLKITDMRIAV |
| Ga0066903_1039663021 | 3300005764 | Tropical Forest Soil | MSTKENEIGRRSLLSKGAAAAGLGLLADLEAYPQNVN |
| Ga0070766_111743752 | 3300005921 | Soil | MSKEENAIGRRALLGTGAAVAGLGLLADLDAYPQNVNRNSIPSDLKV |
| Ga0070717_112783001 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSTNHLGRRSFLKMGGVAASLGILDDLEAYPQNVNRNSKPSDLK |
| Ga0075029_1000019131 | 3300006052 | Watersheds | MASKQSLFGRRSFLKKGGMAAGLGLLADLEAYPQNVNRNS |
| Ga0075029_1000260005 | 3300006052 | Watersheds | MSKEENAIGRRALLGTGAAVAGLGLLADLEAYPQNVNRNSIP |
| Ga0075030_1009195851 | 3300006162 | Watersheds | MSTKENAIGRRSLLSMGAAAAGLGLLADLEAYPQNVNRNSIPSDLKITDMR |
| Ga0079219_109405112 | 3300006954 | Agricultural Soil | MSSKNLFGRRSFLKKGGMAAGLGLLADLEAYPQNVNRNSKP |
| Ga0105240_105029201 | 3300009093 | Corn Rhizosphere | MFTKGNTIGRRSFLGMGAAAALGLWADLEAYPQNVNRNSSPSDLKITDM |
| Ga0105248_118667582 | 3300009177 | Switchgrass Rhizosphere | MSSNESFFGRRSFLKKGGMAAGIGLFADLEAYPQNVNRNS |
| Ga0116222_10852933 | 3300009521 | Peatlands Soil | MSTKENAIGRRLLLGTGAAAAGLGLLADLEAYPQNVNRNSIPSDLKVTDMRIA |
| Ga0116217_100065421 | 3300009700 | Peatlands Soil | MSIEENAIGRRSLLRRGATAAGLGLLADLEAYPQNVNRNSLPSDLKVTDMRIAV |
| Ga0126373_104955391 | 3300010048 | Tropical Forest Soil | MSKEENAIGRRAFLSTGAAVAGLGLLADLEAYPQNVNRNSLPSDLKITD |
| Ga0126370_108412452 | 3300010358 | Tropical Forest Soil | MSTKENEIGRRSLLSKGAAAAGLGLLADLEAYPQNVNRNS |
| Ga0134128_107891301 | 3300010373 | Terrestrial Soil | MSRNENGIGRRSLLKTGAAALGLGLLADLEAYPQNVNRNSSPSDLK |
| Ga0136449_1015082443 | 3300010379 | Peatlands Soil | MTSKNNLFGRRSFLKTGGMAAGLGLLTDLEAYPQNVNRNSKPSDLKIT |
| Ga0126383_119657861 | 3300010398 | Tropical Forest Soil | MSKEENAIGRRTLLGTGAAVAGLGLLADLEAYPQNVNRNSIPSDLKVTDMRIA |
| Ga0126383_124398131 | 3300010398 | Tropical Forest Soil | MSTKENAIGRRALLGTGAAAAGLGLLADLDAYPQNVNRNSIPSDLKVTDMR |
| Ga0137366_112236061 | 3300012354 | Vadose Zone Soil | MSSKNNLVGRRSFLKTGGMAAGLGLFTDLEAYPQNVNRNSKPSDLK |
| Ga0137413_103137631 | 3300012924 | Vadose Zone Soil | MSTKIGRRSFLSMGAAAAGLGLFADLEAYPQNVNRNSIAS |
| Ga0164299_110068822 | 3300012958 | Soil | MSTDENAIGRRLLLGTGAAAAGLGLLAELEAYPQNVNR |
| Ga0126369_128483101 | 3300012971 | Tropical Forest Soil | MSKEENAIGRRALLGTGAAVAGLGLLADLEAYPQNVN |
| Ga0164306_110830782 | 3300012988 | Soil | MSRNENGIGRRSLLKRGAAALGLGLLADLEAYPQNVNRKSSPSDLKIT |
| Ga0157369_102338931 | 3300013105 | Corn Rhizosphere | MSKDENAIGRRTLLGTGAAVAGLGLLADLEAYPQNVNRSSIPSDLKITDMRIAV |
| Ga0181533_11797751 | 3300014152 | Bog | MSTKENAIGRRSLLSTGAAAAGLGLLADLDAYPQNVNRNSIPSDLKVT |
| Ga0181535_103196552 | 3300014199 | Bog | MSTNENAIGRRALLGTGAAVAGLGLLADLEAYPQNV |
| Ga0182018_102933632 | 3300014489 | Palsa | MSTKGSTIGRRKFLGMGAAAAGLGLWADLEAYPQNVN |
| Ga0182018_106110931 | 3300014489 | Palsa | MSTKIGRRSFLSMGAAAAGIGLLADLEAYPQNVNRNSIPSDLKITDMRI |
| Ga0182013_1000547212 | 3300014492 | Bog | MSTKENAIGRRALLGTGAAVAGLGLLADLEAYPQNV |
| Ga0182011_108715111 | 3300014496 | Fen | MSKEENAFGRRSLLMAGATAAGLGLLADVEAYPQNVNRNSLPSDLKVTD |
| Ga0182024_107633472 | 3300014501 | Permafrost | MSTKNAVGRRSFLKMGAAAAGLGLWADLEAYPQNV |
| Ga0182021_111889921 | 3300014502 | Fen | MSIEENAIGRRSLLRSGATAAGLGLLADLEAYPQNVNRN |
| Ga0181536_102083992 | 3300014638 | Bog | MFTKENAIGRRSLLSTGAAAAGLGLLADLEAYPQNVNRNSIPSDLKVTDMR |
| Ga0182027_113686451 | 3300014839 | Fen | MSTNENAIGRRSLLSTGAAAAGLGLLADLEAYPQNVNRNSIPSDLKVTDMR |
| Ga0132258_135907831 | 3300015371 | Arabidopsis Rhizosphere | MSTDENAIGRRLLLGTGAAAAGLGLLAELEAYPQNVNRSSSPSDLKIT |
| Ga0132257_1009950261 | 3300015373 | Arabidopsis Rhizosphere | MSTNENAIGRRLLLGTGAAAAGLGLLAELEAYPQNVNRN |
| Ga0182040_117967242 | 3300016387 | Soil | MSKEENAIGRRALLSTGAAVAGLGLSADLEAYPQNVNRNSIPSDLKITDMR |
| Ga0187853_101423811 | 3300017940 | Peatland | MFTKENAIGRRSLLSTGAAAAGLGLLADLEAYPQN |
| Ga0187891_12017302 | 3300017996 | Peatland | MSSKEDLLGRRSFLTKGGMVAGAGLLADLEAYPQNVNRNSQPSDLKITDM |
| Ga0187874_102507081 | 3300018019 | Peatland | MSTKENTIGRRSLLTTGAAAAGLGLLADLEAYPQNVNR |
| Ga0187857_102690501 | 3300018026 | Peatland | MSIDENAIGRRSLLRRGATAAGLGLLADLEAYPQN |
| Ga0187867_108164652 | 3300018033 | Peatland | MATNENTIGRRSLLTTGAAAAGLGLLADLEAYPQNVNRNSIPSDLRV |
| Ga0187883_105599512 | 3300018037 | Peatland | MSTKENAIGRRALLGTGAAVAGLGLLADLEAYPQDVNRNSIPSDLKV |
| Ga0187765_107498361 | 3300018060 | Tropical Peatland | MSKEENAIGRRTLLGTGAAVAGLGLLADLEAYPQNVNRNSIPSDLK |
| Ga0187852_11092072 | 3300019082 | Peatland | MSSKEDLLGRRSFLKTGGMAAGVGILGELEAYPQNVNRNSQP |
| Ga0187852_11790063 | 3300019082 | Peatland | MFTKENAIGRRSLLSTGAAAAGLGLLADLEAYPQNVNRNSIPSDL |
| Ga0210407_106565021 | 3300020579 | Soil | MSTKENAIGRRSLLSTGAAVAGLGLLTDLEAYPQDVNRNSIPSDLKIT |
| Ga0210393_101887663 | 3300021401 | Soil | MSIKIGRRSFLGMGAAAAGLGLWADLEAYPQNVNRNSIA |
| Ga0210397_107828711 | 3300021403 | Soil | MSTKENAIGRRSLLSTGAAAAGLGLLADLEAYPQNVNR |
| Ga0210387_113879481 | 3300021405 | Soil | MSTKENAIGRRSLLSTGAAAAGLGLLADLEAYPQDVNRNSIPSDLKV |
| Ga0207692_106909582 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSKNNLFGRRSFLKTGGMAAGLGLFTDLEAYPQNVNRNSKPSDLKI |
| Ga0207705_106843201 | 3300025909 | Corn Rhizosphere | MSTRENAIRRRSFLSMGATAAGLGLLSDLEAYPQNVNRNSIPSDL |
| Ga0207695_113445221 | 3300025913 | Corn Rhizosphere | MFTKGNTIGRRSFLGMGAAAALGLWADLEAYPQNVNRNSIASDLKITDV |
| Ga0207652_118902822 | 3300025921 | Corn Rhizosphere | MSKSENAIGRRSLLRMGAAAPGLGLLADLEAYPQNVNRNSSPSDLKIT |
| Ga0207700_119625151 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTNENAFGRRSLLRKGAAAAGLSLLADLEAYPQNVNRNSSPSDLKI |
| Ga0207664_101723221 | 3300025929 | Agricultural Soil | MSTNENAFGRRSLLRKGAAAAGLSLLADLEAYPQNVNRN |
| Ga0209698_107772573 | 3300027911 | Watersheds | MSTKENAIGRRSLLSMGAAAAGLGLLADLEAYPQNVNRNSIPSD |
| Ga0302219_102582581 | 3300028747 | Palsa | MSTKENAIGRRSLLSTGAAAAGLGLLADLEAYPQNVNTNSRPSD |
| Ga0302231_105260842 | 3300028775 | Palsa | MSKKIGRRKFLGMGASAAGFGLLADLEAYPQNVNRNSIPSDLKITD |
| Ga0302222_101551002 | 3300028798 | Palsa | MSKKIGRRKFLGMGAAAAGFGLLADLEAYPQNVNRNSIPSDL |
| Ga0311369_104950872 | 3300029910 | Palsa | MSTKIGRRSFLSLGAAAAGLGLFADLEAYPQNVNRNS |
| Ga0311369_111653531 | 3300029910 | Palsa | MSRKIGRRSFLGMGAGVAGLGLLADLEAYPQNVNRNSIASDLKITD |
| Ga0311362_104383691 | 3300029913 | Bog | MSTKENAIGRRSLLSSGAAAAGLGLLADLEAYPQDVNRNSIPSDLKVTDMRIA |
| Ga0311363_109614482 | 3300029922 | Fen | MSTKENAIGRRSLLSTGAAAAGLGLLADLDAYPQNTNTNSRPSDLRVT |
| Ga0311371_118029521 | 3300029951 | Palsa | MSTKIGRRSFLSLGAATAGLGLFADLEAYPQNVNRNSIASD |
| Ga0311338_101026105 | 3300030007 | Palsa | MSTKIGRRKFLGMGAAAAGLGLWADLEAYPQSVNRNSIPSDLKITDMRIAVLR |
| Ga0302176_103777032 | 3300030057 | Palsa | MSTKIGRRSFLSMGAAAAGLGLLADLDAYPQNVNRNSIPSD |
| Ga0311353_103516283 | 3300030399 | Palsa | MSKKIGRRKFLGMGAAAAGFGLLADLEAYPQNVNRNSIPSDLKI |
| Ga0302310_103112492 | 3300030737 | Palsa | MSKKIGRRKFLGMGAAAAGFGLLADLEAYPQNVNRNSIPSDLK |
| Ga0302180_102557443 | 3300031028 | Palsa | MSTKENAIGRRSLLSTGAAAAGLGLLADLEAYPQNVNTNSRPSDLKI |
| Ga0170824_1097065231 | 3300031231 | Forest Soil | MSTKKNVIGRRKFLGMGAAAAGFGLFADLEAYPQNVKRNSI |
| Ga0302325_117644563 | 3300031234 | Palsa | MSKKGTIGRRKFLGMGAAAAGLGLWGDLEAYPQNVNRNSIASDLKITD |
| Ga0302326_101329061 | 3300031525 | Palsa | MSTQGNKIGRRSFLKMGAATAGLGLWADLEAYPQNVNRNSI |
| Ga0302326_108969431 | 3300031525 | Palsa | MSTKIGRRKFLGMGAAAAGLGLWADLEAYPQNVNRNSIASDLKI |
| Ga0310686_1187152251 | 3300031708 | Soil | MSKKIGRRSFLGMGAAVAGLGLWADLEAYPQNVNRNSI |
| Ga0310686_1191513023 | 3300031708 | Soil | MSTKNAIGRRKFLGMGAAAAGLGFLADLEAYPQNVNR |
| Ga0302322_1027710052 | 3300031902 | Fen | MSIDENAIGRRSLLRKGATAAGLGLLADLEAYPQNVNRNSL |
| Ga0306921_116775842 | 3300031912 | Soil | MSTKENAIGRRSLLSTGAAAAGLGLLADLEAYPQNVNRNSMPSDLKITD |
| Ga0308175_1001352761 | 3300031938 | Soil | MFRDENGIGRRSLLKTGAAAVGLGLWADLEAYPQNVNRNSSPSDLKITD |
| Ga0308175_1029602512 | 3300031938 | Soil | MSRNENGIGRRSLLKTGAAALGLGLLADLEAYPQNVNRNSSPSDLKITD |
| Ga0308174_103365211 | 3300031939 | Soil | MSTNENAIGRRALLGTGAAVAGLGLLADIEAYPQNVNRNSKPSDL |
| Ga0306926_129672931 | 3300031954 | Soil | MSTKENAIGRRSLLSTGAAAAGLGLLADLEAYPQNVN |
| Ga0307479_120639741 | 3300031962 | Hardwood Forest Soil | MSTKIGRRKFLGMGAAAAGLGLLADLEAYPQNVNRNSIASDLKITDM |
| Ga0308176_126432932 | 3300031996 | Soil | MSTNENAIGRRSLLGTGAAAAGLALLADLEAYPQNVNRNSTPSDLKITDM |
| Ga0306924_115698851 | 3300032076 | Soil | MSKEENAIGRRALLSTGAAVAGLGLLADLEAYPQNVNRNSIPSDLKITDMRI |
| Ga0306924_116478861 | 3300032076 | Soil | MNGKTIGRRSFLGMGAAAAGLGLWADLEAYPQNVN |
| Ga0311301_108559071 | 3300032160 | Peatlands Soil | MSSKNNLFGRRSFLKTGGMAAGLDLFTDLEANPQNVNRN |
| Ga0311301_116788632 | 3300032160 | Peatlands Soil | MSKEENAIGRRALLGTGAAVAGLGLLADLDAYPQNVNRNSIPSDLKVTDMRIAVLR |
| Ga0306920_1032402101 | 3300032261 | Soil | MPSNNKLFGRRSFLKAGGVAAGLCLFDDMEAYLQNVNRNSIPSDLKITDMRIA |
| Ga0335070_111399952 | 3300032829 | Soil | MSTNENALGRRALLGTGAAVAGLGLLADLEAYPQNVN |
| Ga0335074_111535611 | 3300032895 | Soil | MSTNENAIGRRSLLSTGAAAAGLGLLADLEAYPQNVNRNSS |
| Ga0335071_101676181 | 3300032897 | Soil | MSKEENAIGRRALLSTGAAVAGLGLLADLDAYPQNV |
| Ga0335084_109408242 | 3300033004 | Soil | MSTKEDAIGRRTLLTTGAAVAGLGLLADLDAYPQNV |
| Ga0326727_102882684 | 3300033405 | Peat Soil | MSTKENAIGRRSLLSTGAAAAGLGLLADLEAYPQNVNRNSIPSDLKV |
| Ga0316631_101818551 | 3300033493 | Soil | MSINGRALGRRSFLKRGAAAAGLGLFADLEAYPQNVNRNS |
| Ga0316628_1043616551 | 3300033513 | Soil | MFTKEKSFGRRSFLTKGITAAGLGLFADLEAYPQNVNRNSKP |
| Ga0371489_0002268_25899_26036 | 3300033755 | Peat Soil | MSTKENAIGRRSLLSTGAAAAGLGLLADLEAYPQNVNRNSIPSDLK |
| Ga0334840_064950_2_151 | 3300033824 | Soil | MSTKENAIGRRSLLSTGAAAAGLGLLADLEAYPQNVNRNSSPSDLKVTDM |
| Ga0334840_142175_493_636 | 3300033824 | Soil | MSTKENAIGRRALLGTGAAAAGLGLLADLEAYPQNVNRNSSPSDLKVT |
| Ga0370515_0051013_3_152 | 3300034163 | Untreated Peat Soil | MSTKGRIGRRKFLGMGAAAAGLGLWADLEAYPQNVNRNSIASDLKITDMR |
| Ga0370515_0398293_420_581 | 3300034163 | Untreated Peat Soil | MSTKENAIGRRSLLSTGAAAAGLGLLADLEAYPQNVNRNSIPSDLKVTDMRIAV |
| ⦗Top⦘ |