| Basic Information | |
|---|---|
| Family ID | F093293 |
| Family Type | Metagenome |
| Number of Sequences | 106 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MKKLLNFKNIAIAALIIYVLLQWFNPGGVMPGGRTIRIEG |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Archaea |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.06 % |
| % of genes from short scaffolds (< 2000 bps) | 90.57 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Archaea (69.811 % of family members) |
| NCBI Taxonomy ID | 2157 |
| Taxonomy | All Organisms → cellular organisms → Archaea |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (20.755 % of family members) |
| Environment Ontology (ENVO) | Unclassified (60.377 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (61.321 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.47% β-sheet: 5.88% Coil/Unstructured: 67.65% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF00149 | Metallophos | 0.94 |
| PF14905 | OMP_b-brl_3 | 0.94 |
| PF01467 | CTP_transf_like | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.34 % |
| Unclassified | root | N/A | 5.66 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002384|B570J29636_1010655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
| 3300002408|B570J29032_109885980 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1987 | Open in IMG/M |
| 3300002835|B570J40625_101552248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
| 3300003411|JGI25911J50253_10150453 | Not Available | 668 | Open in IMG/M |
| 3300004096|Ga0066177_10482320 | Not Available | 547 | Open in IMG/M |
| 3300005662|Ga0078894_10629244 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 953 | Open in IMG/M |
| 3300005662|Ga0078894_10659092 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 927 | Open in IMG/M |
| 3300007545|Ga0102873_1099335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 881 | Open in IMG/M |
| 3300007547|Ga0102875_1174484 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 670 | Open in IMG/M |
| 3300007549|Ga0102879_1098017 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 913 | Open in IMG/M |
| 3300007603|Ga0102921_1188320 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 743 | Open in IMG/M |
| 3300007624|Ga0102878_1227782 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 530 | Open in IMG/M |
| 3300007974|Ga0105747_1190290 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 674 | Open in IMG/M |
| 3300007974|Ga0105747_1276913 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
| 3300007992|Ga0105748_10192573 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 845 | Open in IMG/M |
| 3300008107|Ga0114340_1120036 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1849 | Open in IMG/M |
| 3300008108|Ga0114341_10069632 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 2220 | Open in IMG/M |
| 3300008110|Ga0114343_1005444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6757 | Open in IMG/M |
| 3300008110|Ga0114343_1024863 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 2583 | Open in IMG/M |
| 3300008111|Ga0114344_1172402 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 717 | Open in IMG/M |
| 3300008113|Ga0114346_1025684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3126 | Open in IMG/M |
| 3300008113|Ga0114346_1276873 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 599 | Open in IMG/M |
| 3300008116|Ga0114350_1039570 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 1795 | Open in IMG/M |
| 3300008117|Ga0114351_1076759 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 3222 | Open in IMG/M |
| 3300009050|Ga0102909_1110834 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 664 | Open in IMG/M |
| 3300009068|Ga0114973_10296874 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 862 | Open in IMG/M |
| 3300009068|Ga0114973_10296875 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 862 | Open in IMG/M |
| 3300009079|Ga0102814_10409710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
| 3300009152|Ga0114980_10261776 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1008 | Open in IMG/M |
| 3300009159|Ga0114978_10327758 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 931 | Open in IMG/M |
| 3300009159|Ga0114978_10567700 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 659 | Open in IMG/M |
| 3300009161|Ga0114966_10349045 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 880 | Open in IMG/M |
| 3300009163|Ga0114970_10245538 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1036 | Open in IMG/M |
| 3300010160|Ga0114967_10656132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
| 3300013005|Ga0164292_10843508 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 577 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10080216 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 2413 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10295488 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 970 | Open in IMG/M |
| 3300017774|Ga0181358_1196216 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 663 | Open in IMG/M |
| 3300017777|Ga0181357_1129940 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 940 | Open in IMG/M |
| 3300017778|Ga0181349_1080102 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1244 | Open in IMG/M |
| 3300017778|Ga0181349_1165896 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 784 | Open in IMG/M |
| 3300017780|Ga0181346_1257710 | Not Available | 607 | Open in IMG/M |
| 3300020074|Ga0194113_10301187 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1217 | Open in IMG/M |
| 3300020141|Ga0211732_1013167 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1341 | Open in IMG/M |
| 3300020172|Ga0211729_10184112 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 644 | Open in IMG/M |
| 3300020172|Ga0211729_11274149 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 680 | Open in IMG/M |
| 3300020527|Ga0208232_1050872 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 523 | Open in IMG/M |
| 3300020550|Ga0208600_1005703 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1998 | Open in IMG/M |
| 3300020562|Ga0208597_1029253 | All Organisms → Viruses → Predicted Viral | 1176 | Open in IMG/M |
| 3300020571|Ga0208723_1046161 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 609 | Open in IMG/M |
| 3300021091|Ga0194133_10555306 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
| 3300021963|Ga0222712_10339011 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 931 | Open in IMG/M |
| 3300024502|Ga0255181_1074946 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 550 | Open in IMG/M |
| 3300024507|Ga0255176_1003869 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 3299 | Open in IMG/M |
| 3300024515|Ga0255183_1023240 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1499 | Open in IMG/M |
| 3300027123|Ga0255090_1061652 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 546 | Open in IMG/M |
| 3300027134|Ga0255069_1045196 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 510 | Open in IMG/M |
| 3300027145|Ga0255114_1062757 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 648 | Open in IMG/M |
| 3300027216|Ga0208677_1047895 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300027221|Ga0208557_1065784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
| 3300027281|Ga0208440_1107720 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 551 | Open in IMG/M |
| 3300027286|Ga0255129_1039351 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 768 | Open in IMG/M |
| 3300027290|Ga0255136_1040705 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 686 | Open in IMG/M |
| 3300027292|Ga0255134_1039204 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 779 | Open in IMG/M |
| 3300027292|Ga0255134_1047927 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 690 | Open in IMG/M |
| 3300027368|Ga0255133_1085729 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 614 | Open in IMG/M |
| 3300027396|Ga0255146_1003825 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 3170 | Open in IMG/M |
| 3300027608|Ga0208974_1143183 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 611 | Open in IMG/M |
| 3300027631|Ga0208133_1094455 | Not Available | 700 | Open in IMG/M |
| 3300027659|Ga0208975_1187764 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 558 | Open in IMG/M |
| 3300027688|Ga0209553_1142069 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 825 | Open in IMG/M |
| 3300027759|Ga0209296_1202145 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 851 | Open in IMG/M |
| 3300027782|Ga0209500_10189923 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 935 | Open in IMG/M |
| 3300027785|Ga0209246_10224267 | Not Available | 731 | Open in IMG/M |
| 3300027798|Ga0209353_10100717 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1304 | Open in IMG/M |
| 3300027804|Ga0209358_10213397 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 991 | Open in IMG/M |
| 3300027804|Ga0209358_10305007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 781 | Open in IMG/M |
| 3300027892|Ga0209550_10511802 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 719 | Open in IMG/M |
| 3300027969|Ga0209191_1136719 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1011 | Open in IMG/M |
| 3300027974|Ga0209299_1048231 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1779 | Open in IMG/M |
| 3300031758|Ga0315907_10011423 | Not Available | 8749 | Open in IMG/M |
| 3300031857|Ga0315909_10643461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 699 | Open in IMG/M |
| 3300031951|Ga0315904_10731402 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 826 | Open in IMG/M |
| 3300031963|Ga0315901_10437963 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1037 | Open in IMG/M |
| 3300031963|Ga0315901_10816717 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 674 | Open in IMG/M |
| 3300032050|Ga0315906_11213162 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
| 3300032116|Ga0315903_10719824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 743 | Open in IMG/M |
| 3300033993|Ga0334994_0517198 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 551 | Open in IMG/M |
| 3300033995|Ga0335003_0135874 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1237 | Open in IMG/M |
| 3300033995|Ga0335003_0176322 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1043 | Open in IMG/M |
| 3300034013|Ga0334991_0015978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4542 | Open in IMG/M |
| 3300034018|Ga0334985_0358519 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 889 | Open in IMG/M |
| 3300034066|Ga0335019_0260959 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1100 | Open in IMG/M |
| 3300034066|Ga0335019_0462201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
| 3300034102|Ga0335029_0570784 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 641 | Open in IMG/M |
| 3300034104|Ga0335031_0578778 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
| 3300034105|Ga0335035_0603774 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
| 3300034106|Ga0335036_0306814 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1052 | Open in IMG/M |
| 3300034108|Ga0335050_0362849 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 664 | Open in IMG/M |
| 3300034111|Ga0335063_0216431 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1067 | Open in IMG/M |
| 3300034116|Ga0335068_0324409 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 759 | Open in IMG/M |
| 3300034120|Ga0335056_0283398 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 924 | Open in IMG/M |
| 3300034121|Ga0335058_0736424 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 541 | Open in IMG/M |
| 3300034200|Ga0335065_0132248 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1674 | Open in IMG/M |
| 3300034200|Ga0335065_0324957 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 964 | Open in IMG/M |
| 3300034279|Ga0335052_0191740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1182 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 20.75% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 14.15% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 11.32% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 11.32% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 9.43% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 8.49% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 6.60% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 5.66% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.83% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 2.83% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.89% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.89% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.94% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.94% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002384 | Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
| 3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
| 3300007549 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 | Environmental | Open in IMG/M |
| 3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
| 3300007624 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02 | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300009050 | Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020550 | Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020562 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020571 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300024502 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8d | Environmental | Open in IMG/M |
| 3300024507 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d | Environmental | Open in IMG/M |
| 3300024515 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8d | Environmental | Open in IMG/M |
| 3300027123 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8d | Environmental | Open in IMG/M |
| 3300027134 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300027145 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8h | Environmental | Open in IMG/M |
| 3300027216 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027221 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027281 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027286 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8d | Environmental | Open in IMG/M |
| 3300027290 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8d | Environmental | Open in IMG/M |
| 3300027292 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepC_8d | Environmental | Open in IMG/M |
| 3300027368 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepB_8d | Environmental | Open in IMG/M |
| 3300027396 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8h | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29636_10106551 | 3300002384 | Freshwater | MKKLLNFKNIAIAALIIYVLLQWFNPGGVMPGGRTITIDGKKYEVIK |
| B570J29032_1098859803 | 3300002408 | Freshwater | MKKFLNFKNIAIVVLIIYCLLQWFNPIGIMPGGRTIRIEGKSYEVIKHEIDT |
| B570J40625_1015522481 | 3300002835 | Freshwater | MKKQLTFKNIAIAALIIYILLQWFNPGGVMPGGRTIRIDG |
| JGI25911J50253_101504531 | 3300003411 | Freshwater Lake | MKKLLNFRNIAIAALVIYILLQWFNPGGVMPGGRTIRIEGKKYEVIKHDIDTVDIVKTKIVTKKG |
| Ga0066177_104823201 | 3300004096 | Freshwater Lake | MKKLLNFRNIAIAALVIYILLQWFNPGGVMPGGRTIRIEGKKYEVIKHDIDTVD |
| Ga0078894_106292441 | 3300005662 | Freshwater Lake | MKKFVNFKNIAIVALVIWILLQWFNPGGVMPGGRTIRIDGKK |
| Ga0078894_106590922 | 3300005662 | Freshwater Lake | MKKFVNFKNIAIVALVIWILLQWFNPGGIMPGGRTIRIDGKKYE |
| Ga0102873_10993351 | 3300007545 | Estuarine | MKNLLNFKNIAIAALIIYILLQWFNPGGVMPGGRTIRIDG |
| Ga0102875_11744841 | 3300007547 | Estuarine | MKNLLNFKNIVIAALIIFVLLEWFNPGGVMPGKKVFIAGK |
| Ga0102879_10980171 | 3300007549 | Estuarine | MKNLLNFKNIAIAVLIIFVLLEWFNPGGVMPGKKVFI |
| Ga0102921_11883201 | 3300007603 | Estuarine | MKKLLNFRNIAIAALVIYILLQWFNPGGVMPGGRTIRIEGKKYEIIKHDIDTVDI |
| Ga0102878_12277821 | 3300007624 | Estuarine | MKKFVNFKNIAIAALVIYILLQWFNPGGVMPGGRT |
| Ga0105747_11902901 | 3300007974 | Estuary Water | MKKLLNFKNIAIAALIIFVLLQWFNPGGILPGKKVFIAGKAYEVIKHEID |
| Ga0105747_12769132 | 3300007974 | Estuary Water | MKKFLNIKNIAIAVLIAIVLLEWFNPGGVMPGKKVIIAG |
| Ga0105748_101925732 | 3300007992 | Estuary Water | LIFKNIVIAALIIFVLLEWFNPGGVMPGKKVFIAGKA |
| Ga0114340_11200364 | 3300008107 | Freshwater, Plankton | MKKLLNFKNIAIAALIIYVLLQWFNPGGVMPGGRT |
| Ga0114341_100696321 | 3300008108 | Freshwater, Plankton | MKKYVNFKNIAIVALVIWILLQWFNPGGVMPGGRTIRIDGKKYEVI |
| Ga0114343_10054445 | 3300008110 | Freshwater, Plankton | MKKLLNLKNIAIAVLIAIILLEYFNPGGKMPGRTVRIEG |
| Ga0114343_10248631 | 3300008110 | Freshwater, Plankton | MKKLLNIKNIAIAVLVVIVLLEIWNPGGIMPGKTIR |
| Ga0114344_11724021 | 3300008111 | Freshwater, Plankton | MKKYVNFKNIAIVALVIWILLQWFNPGGVMPGGRTI |
| Ga0114346_10256843 | 3300008113 | Freshwater, Plankton | MKKLLNLKNIAIAVLVVIVLLEYFNPGGKMPGRTVRID |
| Ga0114346_12768731 | 3300008113 | Freshwater, Plankton | MKKFVNFKNIAIAALVIYILLQWFNPGGVMPGGRTIRI |
| Ga0114350_10395703 | 3300008116 | Freshwater, Plankton | MKKLLNLKNIAIAVLVVIVLLEYFNPGGVMPGKTIRIDGKKYE |
| Ga0114351_10767594 | 3300008117 | Freshwater, Plankton | MKKLLNFKNIAIAALIIYVLLQWFNPGGVMPGGRTRK* |
| Ga0102909_11108341 | 3300009050 | Estuarine | MKKLLNFRNIAIAALVIYILLQWFNPGGVMPGGRTIRIEGKKY |
| Ga0114973_102968742 | 3300009068 | Freshwater Lake | MKNLLNFKNIAIAALIIFVLLEWFNPGGVMPGKKVFIAGKAYEV |
| Ga0114973_102968752 | 3300009068 | Freshwater Lake | MKKLLNFKNIAIAALIIFVLLEWFNPGGVMPGKKVFIAGKAYEV |
| Ga0102814_104097102 | 3300009079 | Estuarine | MKKLLNLKNIAIAVLIAIILLEWFNPGGVMPGKKVFIAGKAYEVIKHDI |
| Ga0114980_102617762 | 3300009152 | Freshwater Lake | MKNLLNFKNIAIAVLVIFLLLELWNPGGVMPGKTIRIEGKKYEVIKHDIDTIDIVKTKIV |
| Ga0114978_103277583 | 3300009159 | Freshwater Lake | MKKLLNFKNIVIAALIIFVLLEWFNPGGVMPGKKVFIAGKAYEVIKHDIDTID |
| Ga0114978_105677001 | 3300009159 | Freshwater Lake | MKKLLNFKNIAIAALIIFVLLEWFNPGGVMPGKKVFIAGKAYEVIKHEI |
| Ga0114966_103490452 | 3300009161 | Freshwater Lake | MKKLLNFKNIAIAALIIFVLLEWFNPGGVMPGKKVFIA |
| Ga0114970_102455383 | 3300009163 | Freshwater Lake | MKKFLNIKNIAIAVLVAVVLLEWFNPGGVMPGKKVLIAGKS |
| Ga0114967_106561322 | 3300010160 | Freshwater Lake | MKNLKNITIIVLIALALLQFFNPGGVLPGGKTIRIEGKKYEVIKHEIDT |
| Ga0164292_108435081 | 3300013005 | Freshwater | MKKFVNFKNIAIAALIIYILLQWFNPGGVMPGGRTIRIDGKKYEVLKHTI |
| (restricted) Ga0172376_100802163 | 3300014720 | Freshwater | MKKFVNFKNIAIAALIIYILLQWFNPGGVMPGGRTIRIEGKK |
| (restricted) Ga0172376_102954882 | 3300014720 | Freshwater | MKKYVNFKNIAIAALIIYILLQWFNPGGVMPGGRTIRIEGKK |
| Ga0181358_11962162 | 3300017774 | Freshwater Lake | MKKLLNFRNIAIAALVIYILLQWFNPGGVMPGGRTIRIEGKKYEIIKHDIDTVDIVKT |
| Ga0181357_11299402 | 3300017777 | Freshwater Lake | MTKLLNFRNIAIAALVIYILLQWFNPGGVMPGGRTIRIEGKKYEI |
| Ga0181349_10801021 | 3300017778 | Freshwater Lake | MKKLLNFRNIAIAALVIYILLQWFNPGGVMPGGRTIRIEGKKYEVIKHDIDTVDIVKTKIVTK |
| Ga0181349_11658962 | 3300017778 | Freshwater Lake | MKKSLNFRNIAIAALVIYILLQWFNPGGVMPGGRTIRIEG |
| Ga0181346_12577101 | 3300017780 | Freshwater Lake | MKKLLNFKNIVIAALIIFVLLEWLNPGGVMPGKKVFIAGKA |
| Ga0194113_103011872 | 3300020074 | Freshwater Lake | MKKYVNFKNIAIAALVLFIILQWINPGGVMPGGKTIRIEG |
| Ga0211732_10131671 | 3300020141 | Freshwater | MKNLLNFRNIAIVALVIYILLQWFNPGGVMPGGRTI |
| Ga0211729_101841122 | 3300020172 | Freshwater | MKKLLNFKNIVIAALIIFVLLEWFNPGGVMPGKKVFIAGKAYEVIKHEIDTVD |
| Ga0211729_112741492 | 3300020172 | Freshwater | MKKLVNFKNIAIAALIVYILLQWFNPGGVMPGGRTIRIEGKKYE |
| Ga0208232_10508721 | 3300020527 | Freshwater | MKKFVNFKNIAIAALIIYILLQWFNPGGVMPGGRTIRIDG |
| Ga0208600_10057031 | 3300020550 | Freshwater | MKKFLNFKNIAIVVLIIYCLLQWFNPIGIMPGGRTI |
| Ga0208597_10292532 | 3300020562 | Freshwater | MKKLLNFKNIAIAVLIIFVLLEWFNPGGVMPGKKVFIAGKAYEVIKHDI |
| Ga0208723_10461611 | 3300020571 | Freshwater | MKKFVNFKNIAIAALVIYILLQWFNPGGVMPGGRTIRIEGKKYEV |
| Ga0194133_105553062 | 3300021091 | Freshwater Lake | MKKYLNFRNIAIAVLVIWVLLQWFNPGGVMPGGRIVEI |
| Ga0222712_103390112 | 3300021963 | Estuarine Water | MKKHLNFKNIAILALIVYVLLQWFNPGGVMPGGRTIRIDG |
| Ga0255181_10749462 | 3300024502 | Freshwater | MKKYVNFKNIAIVALVIWILLQWFNPGGVMPGGRTIRI |
| Ga0255176_10038694 | 3300024507 | Freshwater | MKKYVNFKNIAIVALVIWILLQWFNPGGVMPGGRTIRIDGKKYEVIKHT |
| Ga0255183_10232401 | 3300024515 | Freshwater | MKKYVNFKNIAIVALVIWILLQWFNPGGVMPGGRTIRIDGK |
| Ga0255090_10616522 | 3300027123 | Freshwater | MKKLLNFRNIAIAALVIYILLQWFNPGGVMPGGRTIRID |
| Ga0255069_10451961 | 3300027134 | Freshwater | MKKLLNFRNIAIAALVIYILLQWFNPGGVMPGGRTIRIE |
| Ga0255114_10627571 | 3300027145 | Freshwater | MKKLLNFKNIAIVALIIFVLLQWFNPGGILPGKKVFIAG |
| Ga0208677_10478953 | 3300027216 | Estuarine | MKNLLNFKNIAIAALIIYILLQWFNPGGVMPGGRTIRIEGKKYEIIKHDIDTVDIV |
| Ga0208557_10657841 | 3300027221 | Estuarine | MKNLLNFKNIAIAALIIYILLQWFNPGGVMPGGRTIR |
| Ga0208440_11077201 | 3300027281 | Estuarine | MKNLLNFKNIVIAALIIFVLLEWFNPGGVMPGKKV |
| Ga0255129_10393511 | 3300027286 | Freshwater | MKKLLNFRNIAIAALVIYILLQWFNPGGVMPGGRTIRIEGKKYEIIKHDIDT |
| Ga0255136_10407052 | 3300027290 | Freshwater | MKKLLNFKNIAIVALIIFVLLQWFNPGGILPGKKVFIAGKAYEVIKHEIDT |
| Ga0255134_10392041 | 3300027292 | Freshwater | MKKFVNFKNIAIAALVIYILLQWFNPGGVMPGGRTIRIEGKKYEVI |
| Ga0255134_10479272 | 3300027292 | Freshwater | MKKLLNFRNIAIAALVIYILLQWFNPGGVMPGGRTIRIEGKKYEII |
| Ga0255133_10857292 | 3300027368 | Freshwater | MKKLLNFKNIAIVALIIFVLLQWFNPGGILPGKKVFIAGKAY |
| Ga0255146_10038251 | 3300027396 | Freshwater | MKNLLNFKNIAIAALIIYCLLQWFNPGGVMPGGRTIRIDGKKYEV |
| Ga0208974_11431832 | 3300027608 | Freshwater Lentic | MKNLLNFKNIAIAALIIFVLLQWFNPGGILPGKKVFIAGKAYEVI |
| Ga0208133_10944552 | 3300027631 | Estuarine | MKKLLNFKNIAIAALIIFVLLQWFNPGGVMPGKKVFIAGKAYEVIK |
| Ga0208975_11877642 | 3300027659 | Freshwater Lentic | MKKLLNFRNIAIAALVIYILLQWFNPGGVMPGGRTIRIEGKKYEIIKHDI |
| Ga0209553_11420692 | 3300027688 | Freshwater Lake | MKKLLNFRNIAIAALVIYILLQWFNPGGVMPGGRTIRIEGKKYEIIKHD |
| Ga0209296_12021453 | 3300027759 | Freshwater Lake | MKNLLNFKNIVIAALIIFVLLEWLNPGGVMPGKKVFVNGK |
| Ga0209500_101899231 | 3300027782 | Freshwater Lake | MKNLLNFKNIVIAALIIFVLLEWFNPGGVMPGKKVFIAGKAYEVIKHDIDTID |
| Ga0209246_102242671 | 3300027785 | Freshwater Lake | MKKLLNFRNIAIAALVIYILLQWFNPGGVMPGGRTIRIEGKKYEVIKHDIDTVDIVKTKI |
| Ga0209353_101007172 | 3300027798 | Freshwater Lake | MKKLLNFRNIAIAALVIYILLQWFNPGGVMPGGRTIRIEGK |
| Ga0209358_102133971 | 3300027804 | Freshwater Lake | MKKLLNFKNIVIAALIIFVLLEWFNPGGVMPGKKVFIA |
| Ga0209358_103050071 | 3300027804 | Freshwater Lake | MKKLLNLKNIAIAVLVVIVLLEYFNPGGVMPGKTI |
| Ga0209550_105118022 | 3300027892 | Freshwater Lake | MKNLLNFRNIAIVALVIYILLQWFNPGGVMPGGRTIRIE |
| Ga0209191_11367192 | 3300027969 | Freshwater Lake | MKKLLNFRNIAIAALVIYIFLQWFNPGGVMPGGRTIRIEGKK |
| Ga0209299_10482313 | 3300027974 | Freshwater Lake | MKNLLNFKNIVIAALIIFVLLEWLNPGGVMPGKKVFVNGKAYEVIKHDIDTIDIVKT |
| Ga0315907_1001142311 | 3300031758 | Freshwater | MKKLLNFKNIAIAALIIYVLLQWFNPGGVMPGGRTI |
| Ga0315909_106434612 | 3300031857 | Freshwater | MKKYLNLKNIAIAALIIYILLQWFNPGGVMPGGRTIRIAGKKY |
| Ga0315904_107314021 | 3300031951 | Freshwater | MKKLLNIKNIAIAVLVVIVLLEIWNPGGIMPGKTIRIEGKKYEVIK |
| Ga0315901_104379631 | 3300031963 | Freshwater | MKKLVNFKNIAIAALIVYILLQWFNPGGVMPGGRTIRIEGKKYEVIKHEI |
| Ga0315901_108167171 | 3300031963 | Freshwater | MKKYVNFKNIAIVALVIWILLQWFNPGGVMPGGRTIRIDNKKYEV |
| Ga0315906_112131621 | 3300032050 | Freshwater | MKKYLNLKNIAIAALIIYILLQWFNPGGVMPGGRTIRIDGKKYE |
| Ga0315903_107198241 | 3300032116 | Freshwater | MKKYLTFKNIAITALIIYILLQWFNPGGVMPGGRTIR |
| Ga0334994_0517198_404_550 | 3300033993 | Freshwater | MKNLLNFKNIAIAVLIIFVLLEWFNPGGVMPGKKVFIAGKAYEVIKHEI |
| Ga0335003_0135874_1_111 | 3300033995 | Freshwater | MKKLLNFKNIAIAVLIIFVLLEWFNPGGVMPGKKVFI |
| Ga0335003_0176322_1_141 | 3300033995 | Freshwater | MKKLLNFKNIAIAVLIIFVLLEWFNPGGVMPGKKVFIAGKAYEVIKH |
| Ga0334991_0015978_3_134 | 3300034013 | Freshwater | MKKLLNLKNIAIVALIIFILLEWFNPGGVMPGKKVYIEGKAYEV |
| Ga0334985_0358519_767_889 | 3300034018 | Freshwater | MKKLLNFKNIAIAVLIIFVLLEWFNPGGVMPGKKVFIAGKA |
| Ga0335019_0260959_950_1099 | 3300034066 | Freshwater | MKKFVNFKNIAIAALVIYVLLQWFNPGGVMPGGRTIRIEGKKYEVIKHEI |
| Ga0335019_0462201_650_763 | 3300034066 | Freshwater | MKKLLNFKNIAIAALIIFILLQWFNPGDILPGKKVYIE |
| Ga0335029_0570784_525_641 | 3300034102 | Freshwater | MKKLLNFKNIAIAALIIYVLLQWFNPGGVMPGGRTIRID |
| Ga0335031_0578778_1_144 | 3300034104 | Freshwater | MKKLLNLKNIAIAVLVVIVLLEYFNPGGKMPGRKIIIEGKAYEVIKHD |
| Ga0335035_0603774_471_578 | 3300034105 | Freshwater | MKKFLNLKNIAIAVLVVIVLLEYFNPGGKMPGRTVR |
| Ga0335036_0306814_2_115 | 3300034106 | Freshwater | MKKLLNLKNIAIAVLVVIVLLEYFNPGGVMPGKTIRID |
| Ga0335050_0362849_1_135 | 3300034108 | Freshwater | MKKLLNFKNIAIAVLIIFVLLEWFNPGGVMPGKKVFIAGKAYEVI |
| Ga0335063_0216431_3_179 | 3300034111 | Freshwater | MKKLLNFKNIAIAALIIFVLLQWFNPGDILPGKKVFIAGKAYEVIKHEIDTDIINAAIA |
| Ga0335068_0324409_3_155 | 3300034116 | Freshwater | MKKFVNFKNIAIAALIIYILLQWFNPGGVMPGGRTIRIEGKKYEVIKHEID |
| Ga0335056_0283398_805_924 | 3300034120 | Freshwater | MKKLLNFKNIAIAALIIYVLLQWFNPGGVMPGGRTIRIEG |
| Ga0335058_0736424_2_133 | 3300034121 | Freshwater | MKKLLNFKNIAIAVLIIFVLLEWFNPGGVMPGKKVFIAGKAYEV |
| Ga0335065_0132248_1_159 | 3300034200 | Freshwater | MKNLLNFKNIAIAVLIIFVLLEWFNPGGVMPGKKVFIAGKAYEVIKHDIDTVD |
| Ga0335065_0324957_2_142 | 3300034200 | Freshwater | MKKLLNFKNIAIAALIIYVLLQWFNPGGVMPGGRTIRIDGNKYEVIK |
| Ga0335052_0191740_1062_1181 | 3300034279 | Freshwater | MKKFLNLKNIAIAVLVVIVLLEYFNPGGKMPGRTVRIDGK |
| ⦗Top⦘ |