| Basic Information | |
|---|---|
| Family ID | F093279 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 43 residues |
| Representative Sequence | NSYVVLTQVSASLNFVDDTAAAAGGVPLGGLYRNGNFILIRIS |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 1.89 % |
| % of genes from short scaffolds (< 2000 bps) | 0.00 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (99.057 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (22.642 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.057 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (54.717 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.45% β-sheet: 12.68% Coil/Unstructured: 78.87% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF13884 | Peptidase_S74 | 7.55 |
| PF01391 | Collagen | 5.66 |
| PF13385 | Laminin_G_3 | 1.89 |
| PF00959 | Phage_lysozyme | 0.94 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.94 |
| PF10979 | DUF2786 | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 99.06 % |
| All Organisms | root | All Organisms | 0.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300008107|Ga0114340_1022562 | Not Available | 5066 | Open in IMG/M |
| 3300021365|Ga0206123_10042427 | All Organisms → cellular organisms → Bacteria | 2427 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 22.64% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 10.38% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.43% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 8.49% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.72% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.72% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.83% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.83% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.83% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.83% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.89% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.89% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.89% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.89% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.89% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.89% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.89% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.94% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.94% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.94% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.94% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.94% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.94% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.94% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003412 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD | Environmental | Open in IMG/M |
| 3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300004128 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (version 2) | Environmental | Open in IMG/M |
| 3300004776 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA14M | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300007618 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 | Environmental | Open in IMG/M |
| 3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
| 3300007722 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly) | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300009024 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300012528 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013136 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.5m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019122 | Metatranscriptome of marine microbial communities from Baltic Sea - GS677_0p1 | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300020578 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35m | Environmental | Open in IMG/M |
| 3300021093 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surface | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025072 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025704 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes) | Environmental | Open in IMG/M |
| 3300026459 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8d | Environmental | Open in IMG/M |
| 3300027121 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300027229 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027597 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8d | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031759 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003P | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| RCM31_101883331 | 3300001851 | Marine Plankton | LALGNYVDDTAAAAGGVAIGQIYRNGNFIVIRVS* |
| JGI25908J49247_100714412 | 3300003277 | Freshwater Lake | NSYVVLTQVSQSLNYVDDVAAAAGGVPLGGIYRNGNFILIRLS* |
| JGI25909J50240_11058732 | 3300003393 | Freshwater Lake | IVILSQVSSSLNFVNDTTAAAGGVPLGGLYRNGNAIQIRLV* |
| JGI25912J50252_101300092 | 3300003412 | Freshwater Lake | NKVTHTNGYVVLSQVSASLNFVDDTAAASGGVPLGGLYRNGNFIVIRIV* |
| Ga0063232_100794343 | 3300004054 | Freshwater Lake | YVVLSEVSQSLNFANDNAAASNGVPLGGLYRNGNFIQIRIS* |
| Ga0065166_101968111 | 3300004112 | Freshwater Lake | IVVLSQVSSSLNFINDAAAALGGVPLGGLYRNGNVIQIRLV* |
| Ga0066180_104533921 | 3300004128 | Freshwater Lake | TNVKVQSGYVILNQVSSSLNFVDDVAAATAGVPKGGLYRNGNFILIRIT* |
| Ga0007800_101431221 | 3300004776 | Freshwater | NPVINSFVVLTQVSQSLNFTDDTTAAAGGVPLGGLYRNGSFVVIRIV* |
| Ga0049081_102004632 | 3300005581 | Freshwater Lentic | KVTHTNGYVVLSQVSASLNFVDDTAAAAGGVPLGGLYRNGNFIVIRIV* |
| Ga0049080_102088762 | 3300005582 | Freshwater Lentic | ILNQVSSSLNFVDDVAAATAGVPKGGLYRNGNFILIRIT* |
| Ga0078894_110646082 | 3300005662 | Freshwater Lake | YVVLSHVSQSLNYANDNAAALNGVPLGGLYRNGNFIQIRIS* |
| Ga0079957_10847092 | 3300005805 | Lake | QSSLLLLNVSSSLNFSDDAAAAAGGVPLGGIYRNGNFILIRLV* |
| Ga0102896_10031461 | 3300007618 | Estuarine | TAINVVNGYVVLSEVSQSLNFANDNAAASNGVPLGGLYRNGNFIQIRIS* |
| Ga0102865_12421121 | 3300007639 | Estuarine | NSYVVLTQVSASLNFVDDTAAAAGGVPLGGLYRNGNFILIRIS* |
| Ga0105051_103848931 | 3300007722 | Freshwater | NQSKGNFVLTEVSESLNFANDINAANGGVPLGGLYRDGNTIKIRIN* |
| Ga0108970_110274392 | 3300008055 | Estuary | VLTQVSASLDFVDDTAAAAGGVPLGGLYRNGNFILIRIS* |
| Ga0114340_102256215 | 3300008107 | Freshwater, Plankton | QVSSSLNFSNDASASVGGVPLGGLYRNGNVIQIRLV* |
| Ga0114346_12177911 | 3300008113 | Freshwater, Plankton | MVSSSLQFIDDAAAALGGVPLGGLYRNGNFILIRIT* |
| Ga0114350_11355683 | 3300008116 | Freshwater, Plankton | TVTQYVTLPTVSASLNFVDDTAAAAAGVPLGGLYRNGSNIQIRLV* |
| Ga0114364_10296151 | 3300008267 | Freshwater, Plankton | GAIVLSQVSASLNFADDTAAAAGGIPLGGLYRNGNFIAIRLT* |
| Ga0114364_11479262 | 3300008267 | Freshwater, Plankton | NTFNGNQTISTGYVILSQVSSSLNYADDTAAAAGGVPLGGLYRNGNFILIRIT* |
| Ga0102811_10140711 | 3300009024 | Estuarine | NGTAINVVNGYVVLSEVSQSLNFANDNAAASNGVPLGGLYRNGNFIQIRIS* |
| Ga0102860_10941772 | 3300009056 | Estuarine | LASVSSSLNFADDTAAAAGGVPLGGLYRNGNFVMIRLT* |
| Ga0114973_104226411 | 3300009068 | Freshwater Lake | QIVILTQVSSSLQFTDDTAAALGGVPLGGLYRNGNFILIRLT* |
| Ga0114959_102174293 | 3300009182 | Freshwater Lake | MSGSFTQNGYAILTAVSQSLNYADDPAAAAGGVPLGGLYRNGNFILI |
| Ga0114976_104442971 | 3300009184 | Freshwater Lake | VINNGFVVLTQVSQSLNFANDAAAAIGGVPLGGLYRNGNVIAIRIS* |
| Ga0115572_107794231 | 3300009507 | Pelagic Marine | VTVENGHTILTQVSESLNSHDDFQASVLGVPLGGLYRNGNFIQIRIN* |
| Ga0115001_102104991 | 3300009785 | Marine | QVSSSLNFTDDTAAASGGIPLGGLYRNGNFIVIRLT* |
| Ga0114964_104938572 | 3300010157 | Freshwater Lake | LTTTQGFITLTQVSQSFNFADDASAAVGGVPLGGLYRNGNFIVIRLV* |
| Ga0114967_100351924 | 3300010160 | Freshwater Lake | SQSLNYVDDVAAAAGGVPLGGIYRNGNFILIRLS* |
| Ga0133913_135942871 | 3300010885 | Freshwater Lake | TGYITLSQVSQSLNFADDAAAAAGGVPLGGLYRNGNFILIRLS* |
| Ga0139557_10838492 | 3300011010 | Freshwater | TTGYVILSQVSSSLNYADDTAAAAGGVPLGGLYRNGNFILIRIT* |
| Ga0151620_12691092 | 3300011268 | Freshwater | IQSGYVVLSQVSSSLNFLDDTAAAAGGVPLGGLYRNGNFILIRIT* |
| Ga0153805_10384741 | 3300012013 | Surface Ice | VSQSLNYVDDTAAAAGGVPLGGLYRNGNAIMIRLV* |
| Ga0129352_107648251 | 3300012528 | Aqueous | GTSFTLENGHVVLAQVSQSLNYADDTAAAAGGVPLGGLYRSGNFIAIRLT* |
| Ga0163109_103825871 | 3300012936 | Surface Seawater | GAVVLTKVSESLNFTNDTDAATGGVPLGGLYRNGNDIKIRIT* |
| Ga0164292_101746891 | 3300013005 | Freshwater | SYLNPIVSSYVVLTQVSQSLNFADDTSAAAGGVPLGGLYRNGNFILIRIS* |
| (restricted) Ga0172370_105735462 | 3300013136 | Freshwater | VSSYVVLTQVSQSLNYVDDTAASAGGVPLGGLYRNGNFIMIRLT* |
| Ga0177922_106814982 | 3300013372 | Freshwater | IVSSYVVLTQVSQSLNFVDDDAAAAGGVPLGGLYRNGNFILIRIS* |
| Ga0181347_10611721 | 3300017722 | Freshwater Lake | ILSQVSASLNYADDTAAAAGGVPLGGLYRNGNFILIRIS |
| Ga0181401_10995142 | 3300017727 | Seawater | LAQVSESLEFDNDTLAAAGGVPLGGLYRSGNFIAIRLT |
| Ga0181356_10346453 | 3300017761 | Freshwater Lake | LNPIQSSYVILSQVSASLNYADDTAAAAGGVPLGGLYRNGNFILIRIS |
| Ga0181356_10359673 | 3300017761 | Freshwater Lake | LSQVSASLNYADDTAAAAGGVPLGGLYRNGNFILIRIS |
| Ga0181356_10472312 | 3300017761 | Freshwater Lake | LTQVSASLNFVDDTAAAAGGIPLGGLYRNGNFILIRIS |
| Ga0181358_11882152 | 3300017774 | Freshwater Lake | LTQVSQSLNFVDDAAAAAGGIPLGGLYRNGNFILIRIS |
| Ga0181357_10269123 | 3300017777 | Freshwater Lake | YVILSQVSASLNYADDTAAAAGGVPLGGLYRNGNFILIRIS |
| Ga0181357_10404131 | 3300017777 | Freshwater Lake | LNPIVSSYVVLTQVSQSLNFVDDTAAAAGGIPLGGLYRNGNFILIRIS |
| Ga0181357_10720373 | 3300017777 | Freshwater Lake | ASYLNPIVSSYIILTQVSQSLDFPDDSAAAAGGVPLGGLYRNVNSILIRIS |
| Ga0181348_10813742 | 3300017784 | Freshwater Lake | IVSSYVVLTQVSSSLNFVDDTAAAAGGIPLGGLYRNGNFILIRIS |
| Ga0181348_12185202 | 3300017784 | Freshwater Lake | SYVILSQVSASLNYADDTAAAAGGVPLGGLYRNGNFILIRIS |
| Ga0181424_102519731 | 3300017786 | Seawater | PLIQSTYNFIDDAAAATGGVPLGGLYRNGSDIKIRLT |
| Ga0181591_111359561 | 3300018424 | Salt Marsh | TSVTIENGYTILTEISESGHYADDTAAALGGVPLGGVYRNGNILQIRTGS |
| Ga0188839_10336272 | 3300019122 | Freshwater Lake | NAGFILTTQVSSTSYANDTAAAAGGVPVGGLYRNGNFVQIRLA |
| Ga0181359_10783112 | 3300019784 | Freshwater Lake | VILTQVSASLNYADDTAAAAGGVPLGGLYRNGNFILIRIS |
| Ga0181359_11683262 | 3300019784 | Freshwater Lake | KVSQSLNFANDNAAASNGVPLGGLYRNGNFIQIRIS |
| Ga0211732_11393832 | 3300020141 | Freshwater | LNPIVSSYVVLTQVSQSLNFVDDAAAAAGGVPLGGLYRNGNFILIRIS |
| Ga0211736_109041372 | 3300020151 | Freshwater | ILTQVSSSLQFTDDIAAAAGGVPLGGLYRNGNFILIRLT |
| Ga0194115_100954981 | 3300020183 | Freshwater Lake | LTQVSQSLNFVDDAAASSSGVPLGGLYRNGNFIMIRIT |
| Ga0206131_100172831 | 3300020185 | Seawater | NTFESKTDGNLVLANVYLNKNYEDDTAAAAGGVPLGGLYRSGNFIAIRIQ |
| Ga0194129_103439042 | 3300020578 | Freshwater Lake | LTQVSQSLNFIDDAAASSSGVPLGGLYRNGNFIMIRIT |
| Ga0194123_102233522 | 3300021093 | Freshwater Lake | VLTQVSQSLNFVDDAAASSSGVPLGGLYRNGNFIMIRIT |
| Ga0213859_103859881 | 3300021364 | Seawater | IFSQVSSSLDFVDDTAAAAGGVPLGGIYRSGSLIRIRLV |
| Ga0206123_100424275 | 3300021365 | Seawater | YIILTEVSESLNFVDDSAAQAGGVPLGGLYRNGSDIKIRIS |
| Ga0222713_101507821 | 3300021962 | Estuarine Water | VTNGYVVLTQVSMSLNFVDDTAAAAGGVPLGGLYRNGNFILIRLT |
| Ga0222713_105270712 | 3300021962 | Estuarine Water | LTQVSQSLNFVDDTAAAAGGVPLGGLYRNGNFISIRIA |
| Ga0222712_105851661 | 3300021963 | Estuarine Water | GTVQSDVKIQSGYVVLSQVSSSLNFLDDTAAAAGGVPLGGLYRNGNFILIRIT |
| Ga0196899_10937781 | 3300022187 | Aqueous | VENGHTILAQVSESLNYNNDTEAAAGGVPLGGLYRSGNFIAIRLT |
| Ga0181354_11636241 | 3300022190 | Freshwater Lake | SYVVLTQVSQSLNYVDDVAAAAGGVPLGGIYRNGNFILIRLS |
| Ga0214923_103288302 | 3300023179 | Freshwater | TNNNLTASYAILASVSMSLNFVDDTAAAAGGVPLGGLYRNGNFILIRLT |
| Ga0244775_113326332 | 3300024346 | Estuarine | FTGSLSQNIGFVVLTQVSQSLNYADDNAAAAGGVPLGGLYRNGNFILIRLS |
| Ga0208920_10802021 | 3300025072 | Marine | YVVLTQVSQSLNYTTDSLAGAGGVPYGGLYRSGSYIKIRMS |
| Ga0209602_11530142 | 3300025704 | Pelagic Marine | VLTEVSESLDFANDGLAAAGGVPLGGLYRNGNVIQIRIV |
| Ga0255170_10531041 | 3300026459 | Freshwater | IQNGYVILSQVSQSLNFSDDAAAALGGVPLGGLYRNGNFIAIRIS |
| Ga0255074_10032521 | 3300027121 | Freshwater | SDVKIQSGYVVLSQVSSSLNFLDDTAAAAGGVPLGGLYRNGNFILIRLT |
| Ga0208442_10059461 | 3300027229 | Estuarine | INVVNGYVVLSEVSQSLNFANDNAAASNGVPLGGLYRNGNFIQIRIS |
| Ga0255088_10784252 | 3300027597 | Freshwater | TVSNGYIILTQVSASLNFVDDTAAAAGGVPLGGLYRNGNFILIRLT |
| Ga0208974_11885432 | 3300027608 | Freshwater Lentic | ILNQVSSSLNFVDDVAAATAGVPKGGLYRNGNFILIRIT |
| Ga0208133_11514291 | 3300027631 | Estuarine | NNGFVVLTQVSQSLNYADDNAAAAGGVPLGGLYRNGNFILIRLS |
| Ga0209442_10835243 | 3300027732 | Freshwater Lake | VSASLNFVDDTAAASGGVPLGGLYRNGNFIVIRIV |
| Ga0209297_12389352 | 3300027733 | Freshwater Lake | QTNVKVQGGYVILNQVSSSLNFVDDAAAATAGVPKGGLYRNGNFILIRIT |
| Ga0209596_10845271 | 3300027754 | Freshwater Lake | ASYLNPITNSYVVLTQVSQSLNYVDDVAAAAGGVPLGGIYRNGNFILIRLS |
| Ga0209770_100369705 | 3300027769 | Freshwater Lake | YVVLSHVSQSLNYANDNAAALNGVPLGGLYRNGNFIQIRIS |
| Ga0209358_105756541 | 3300027804 | Freshwater Lake | GNVQSNVKVQSGYVVLSQVSSSLNFVDDNAAGLAGVPLGGLYRNGNFILIRIT |
| Ga0209400_12110691 | 3300027963 | Freshwater Lake | PITNSYVVLTQVSQSLNYVDDVAAAAGGVPLGGIYRNGNFILIRLS |
| Ga0307376_107284132 | 3300031578 | Soil | VTSNVDFIDGYVIMSKVSSSLDFVDDTAAAAGGVPLGGLYRNGNFIQIRIA |
| Ga0315907_107148661 | 3300031758 | Freshwater | TLTQVSQSLNYADDAAAAAGGVPLGGLYRNGNFIAIRIV |
| Ga0316219_10742522 | 3300031759 | Freshwater | LTGSFTQTGYHILTTVSQSLNFADDVAAAAGGVPLGGLYRNGNFILIRLS |
| Ga0315900_105032773 | 3300031787 | Freshwater | ETTTILAHVSASLNYANDTAAAAGGVPLGGIYRNGNVIQIRLV |
| Ga0315909_101812351 | 3300031857 | Freshwater | YLNPLNQIIILPTVSSSLNFTDDASAAAGGVPLGGLYRNGNFILIRMT |
| Ga0315904_113071752 | 3300031951 | Freshwater | AAFTGSLSQNNGFVVLTQVSQSLNYADDNAAAAGGVPLGGLYRNGNFILIRLS |
| Ga0315294_107894772 | 3300031952 | Sediment | QSGYVILNQVSSSLNFVDDVAAATAGVPKGGLYRNGNFILIRIT |
| Ga0315901_100315621 | 3300031963 | Freshwater | LTQVSQSLNYADDAAAAVGGVPLGGLYRNGNFIAIRIV |
| Ga0315901_100492151 | 3300031963 | Freshwater | IVVLSQVSSSLNFINDAAAALGGVPLGGLYRNGNVIQIRLV |
| Ga0315901_106326712 | 3300031963 | Freshwater | AHVSASLNYANDTAAAAGGVPLGGIYRNGNVIQIRLV |
| Ga0315274_117970062 | 3300031999 | Sediment | VILNQVSSSLNFVDDVAAATAGVPKGGLYRNGNFILIRIT |
| Ga0315902_100358348 | 3300032093 | Freshwater | NGAQTVTTGYITLTQVSQSLNYADDAAAAAGGVPLGGLYRNGNFIAIRIV |
| Ga0315903_104113642 | 3300032116 | Freshwater | TGYIVLTQVSQSLNYVDDTDAAANGVPLGGLYRNGNFIAIRIV |
| Ga0315903_108301461 | 3300032116 | Freshwater | ILSQVSSSLNFSNDASASVGGVPLGGLYRNGNVIQIRLV |
| Ga0315903_112037423 | 3300032116 | Freshwater | GYVVLTQVSRSLNYLNDTAAASGGVPLGGLYRSGSFILIRLV |
| Ga0334996_0107334_2_139 | 3300033994 | Freshwater | TQNGYAILTAVSQSLNFANDAAAAAGGVPLGGLYRSGNFILIRLS |
| Ga0334987_0532194_11_130 | 3300034061 | Freshwater | VLTQVSQSLNYADDTAAAAGGVPLGGLYRNGNFIAIRIV |
| Ga0335012_0368936_560_709 | 3300034093 | Freshwater | GNQTVTTGYVILSQVSSSLNYADDTAAAAGGVPLGGLYRNGNFILIRIT |
| Ga0335031_0042764_14_133 | 3300034104 | Freshwater | VLTQVSQSLNYADDAAAAAGGVPLGGLYRNGNFIAIRIV |
| Ga0335066_0643527_407_541 | 3300034112 | Freshwater | LNQIVILTQVSSSLEFIDDVAAAAGGVPLGGLYRNGNFILIRLT |
| Ga0335033_0443202_3_149 | 3300034117 | Freshwater | GRFTQNGFKILTAVSQSLNFANDAAAAAGGVPLGGLYRSGNFILIRLS |
| Ga0335049_0804849_2_160 | 3300034272 | Freshwater | NVNNDVKIENGFSILTSVSQSLEFANDAAAAAGGVPLGGLYRSGNFILIRLV |
| ⦗Top⦘ |