| Basic Information | |
|---|---|
| Family ID | F093155 |
| Family Type | Metagenome |
| Number of Sequences | 106 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MRLIIMRRSSSLYSKGLIATGEQDQELGPWFTASSLGGTVAAKRRLFHEEIKN |
| Number of Associated Samples | 59 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 9.90 % |
| % of genes near scaffold ends (potentially truncated) | 69.81 % |
| % of genes from short scaffolds (< 2000 bps) | 95.28 % |
| Associated GOLD sequencing projects | 59 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.19 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (66.981 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (94.340 % of family members) |
| Environment Ontology (ENVO) | Unclassified (95.283 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (95.283 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.57% β-sheet: 0.00% Coil/Unstructured: 65.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 66.98 % |
| All Organisms | root | All Organisms | 33.02 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300009098|Ga0105245_11966021 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae | 638 | Open in IMG/M |
| 3300013296|Ga0157374_12438733 | Not Available | 550 | Open in IMG/M |
| 3300013297|Ga0157378_11827011 | Not Available | 656 | Open in IMG/M |
| 3300013297|Ga0157378_12926471 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 530 | Open in IMG/M |
| 3300015269|Ga0182113_1035275 | Not Available | 682 | Open in IMG/M |
| 3300015269|Ga0182113_1040596 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 654 | Open in IMG/M |
| 3300015269|Ga0182113_1045150 | Not Available | 635 | Open in IMG/M |
| 3300015274|Ga0182188_1022056 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 659 | Open in IMG/M |
| 3300015274|Ga0182188_1033192 | Not Available | 594 | Open in IMG/M |
| 3300015275|Ga0182172_1055051 | Not Available | 556 | Open in IMG/M |
| 3300015276|Ga0182170_1055959 | Not Available | 554 | Open in IMG/M |
| 3300015276|Ga0182170_1059822 | Not Available | 544 | Open in IMG/M |
| 3300015277|Ga0182128_1051969 | Not Available | 570 | Open in IMG/M |
| 3300015279|Ga0182174_1027734 | Not Available | 697 | Open in IMG/M |
| 3300015279|Ga0182174_1046338 | Not Available | 605 | Open in IMG/M |
| 3300015279|Ga0182174_1071344 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 532 | Open in IMG/M |
| 3300015281|Ga0182160_1048737 | Not Available | 590 | Open in IMG/M |
| 3300015282|Ga0182124_1071107 | Not Available | 526 | Open in IMG/M |
| 3300015282|Ga0182124_1083446 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 501 | Open in IMG/M |
| 3300015283|Ga0182156_1044566 | Not Available | 615 | Open in IMG/M |
| 3300015285|Ga0182186_1033128 | Not Available | 657 | Open in IMG/M |
| 3300015285|Ga0182186_1048459 | Not Available | 591 | Open in IMG/M |
| 3300015285|Ga0182186_1061877 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 549 | Open in IMG/M |
| 3300015287|Ga0182171_1081414 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 516 | Open in IMG/M |
| 3300015288|Ga0182173_1011051 | Not Available | 888 | Open in IMG/M |
| 3300015288|Ga0182173_1078136 | Not Available | 518 | Open in IMG/M |
| 3300015289|Ga0182138_1046702 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 609 | Open in IMG/M |
| 3300015291|Ga0182125_1087459 | Not Available | 515 | Open in IMG/M |
| 3300015292|Ga0182141_1035458 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 670 | Open in IMG/M |
| 3300015292|Ga0182141_1051224 | Not Available | 603 | Open in IMG/M |
| 3300015292|Ga0182141_1077202 | Not Available | 534 | Open in IMG/M |
| 3300015292|Ga0182141_1092359 | Not Available | 506 | Open in IMG/M |
| 3300015294|Ga0182126_1056003 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 592 | Open in IMG/M |
| 3300015294|Ga0182126_1064346 | Not Available | 567 | Open in IMG/M |
| 3300015295|Ga0182175_1086219 | Not Available | 524 | Open in IMG/M |
| 3300015298|Ga0182106_1033163 | Not Available | 705 | Open in IMG/M |
| 3300015299|Ga0182107_1068161 | Not Available | 574 | Open in IMG/M |
| 3300015299|Ga0182107_1099576 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 510 | Open in IMG/M |
| 3300015300|Ga0182108_1082207 | Not Available | 546 | Open in IMG/M |
| 3300015300|Ga0182108_1088846 | Not Available | 533 | Open in IMG/M |
| 3300015300|Ga0182108_1108181 | Not Available | 500 | Open in IMG/M |
| 3300015302|Ga0182143_1010335 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 974 | Open in IMG/M |
| 3300015302|Ga0182143_1081382 | Not Available | 543 | Open in IMG/M |
| 3300015304|Ga0182112_1030622 | Not Available | 726 | Open in IMG/M |
| 3300015305|Ga0182158_1083305 | Not Available | 539 | Open in IMG/M |
| 3300015305|Ga0182158_1089827 | Not Available | 527 | Open in IMG/M |
| 3300015307|Ga0182144_1074589 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 565 | Open in IMG/M |
| 3300015308|Ga0182142_1075732 | Not Available | 573 | Open in IMG/M |
| 3300015308|Ga0182142_1091938 | Not Available | 540 | Open in IMG/M |
| 3300015314|Ga0182140_1043156 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 679 | Open in IMG/M |
| 3300015314|Ga0182140_1074119 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 579 | Open in IMG/M |
| 3300015314|Ga0182140_1100778 | Not Available | 525 | Open in IMG/M |
| 3300015321|Ga0182127_1106496 | Not Available | 529 | Open in IMG/M |
| 3300015341|Ga0182187_1110303 | Not Available | 624 | Open in IMG/M |
| 3300015342|Ga0182109_1199521 | Not Available | 525 | Open in IMG/M |
| 3300015342|Ga0182109_1223996 | Not Available | 501 | Open in IMG/M |
| 3300015344|Ga0182189_1177060 | Not Available | 555 | Open in IMG/M |
| 3300015344|Ga0182189_1203626 | Not Available | 526 | Open in IMG/M |
| 3300015345|Ga0182111_1004462 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 1916 | Open in IMG/M |
| 3300015345|Ga0182111_1080653 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 766 | Open in IMG/M |
| 3300015345|Ga0182111_1091806 | Not Available | 731 | Open in IMG/M |
| 3300015346|Ga0182139_1150570 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 608 | Open in IMG/M |
| 3300015351|Ga0182161_1100399 | Not Available | 740 | Open in IMG/M |
| 3300015355|Ga0182159_1036120 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 1266 | Open in IMG/M |
| 3300015355|Ga0182159_1198739 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 645 | Open in IMG/M |
| 3300015355|Ga0182159_1286620 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 549 | Open in IMG/M |
| 3300015361|Ga0182145_1192058 | Not Available | 504 | Open in IMG/M |
| 3300017404|Ga0182203_1126782 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 548 | Open in IMG/M |
| 3300017407|Ga0182220_1084779 | Not Available | 540 | Open in IMG/M |
| 3300017407|Ga0182220_1089198 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 532 | Open in IMG/M |
| 3300017410|Ga0182207_1126895 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 563 | Open in IMG/M |
| 3300017410|Ga0182207_1157997 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 522 | Open in IMG/M |
| 3300017411|Ga0182208_1047532 | Not Available | 685 | Open in IMG/M |
| 3300017411|Ga0182208_1086015 | Not Available | 572 | Open in IMG/M |
| 3300017413|Ga0182222_1044627 | Not Available | 634 | Open in IMG/M |
| 3300017413|Ga0182222_1098518 | Not Available | 515 | Open in IMG/M |
| 3300017413|Ga0182222_1104807 | Not Available | 506 | Open in IMG/M |
| 3300017413|Ga0182222_1107190 | Not Available | 503 | Open in IMG/M |
| 3300017420|Ga0182228_1089456 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 575 | Open in IMG/M |
| 3300017425|Ga0182224_1053095 | Not Available | 720 | Open in IMG/M |
| 3300017425|Ga0182224_1156677 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 511 | Open in IMG/M |
| 3300017430|Ga0182192_1131357 | Not Available | 554 | Open in IMG/M |
| 3300017433|Ga0182206_1112070 | Not Available | 563 | Open in IMG/M |
| 3300017438|Ga0182191_1099982 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 617 | Open in IMG/M |
| 3300017438|Ga0182191_1133429 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 560 | Open in IMG/M |
| 3300017438|Ga0182191_1178882 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 506 | Open in IMG/M |
| 3300017443|Ga0182193_1161690 | Not Available | 539 | Open in IMG/M |
| 3300017680|Ga0182233_1080326 | Not Available | 591 | Open in IMG/M |
| 3300017681|Ga0182226_1044617 | Not Available | 798 | Open in IMG/M |
| 3300017683|Ga0182218_1047313 | Not Available | 720 | Open in IMG/M |
| 3300017683|Ga0182218_1140079 | Not Available | 517 | Open in IMG/M |
| 3300017684|Ga0182225_1071664 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 625 | Open in IMG/M |
| 3300017685|Ga0182227_1040349 | Not Available | 816 | Open in IMG/M |
| 3300017685|Ga0182227_1091330 | Not Available | 584 | Open in IMG/M |
| 3300017685|Ga0182227_1106659 | Not Available | 551 | Open in IMG/M |
| 3300017686|Ga0182205_1143147 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 535 | Open in IMG/M |
| 3300017690|Ga0182223_1057627 | Not Available | 623 | Open in IMG/M |
| 3300017690|Ga0182223_1091841 | Not Available | 548 | Open in IMG/M |
| 3300017690|Ga0182223_1093095 | Not Available | 545 | Open in IMG/M |
| 3300021060|Ga0182232_1076747 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 544 | Open in IMG/M |
| 3300026089|Ga0207648_11781992 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 577 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 94.34% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015269 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015274 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015275 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015276 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015277 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015279 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015281 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015282 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015283 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015285 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015287 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015288 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015289 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015291 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015292 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015294 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015295 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015298 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015299 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015300 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015302 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015305 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015307 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015308 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015314 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015321 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015341 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015342 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015361 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017407 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017410 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017413 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017420 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017430 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017433 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017438 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017443 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017680 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017681 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017683 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017684 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017685 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017686 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017690 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300021060 | Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0105245_119660212 | 3300009098 | Miscanthus Rhizosphere | MSSSLYSKGLIATGEKDQELGPWFTASSLGGTVAAKRCLFHE |
| Ga0157374_124387332 | 3300013296 | Miscanthus Rhizosphere | SSVYLKGLITTGEQDQELGPCFTASSLGGIVAAKRCLFHEEIKN* |
| Ga0157378_118270112 | 3300013297 | Miscanthus Rhizosphere | MRLMIMRKSSSLYSKGLIATDEQDQELGPWFTASGLGGTVAAKRCLFHKEIKN* |
| Ga0157378_129264711 | 3300013297 | Miscanthus Rhizosphere | ERNLKLQINMRLMKIRRSSSLYSKGLIATSEQDQELGPWFTASSLGGTVAAK* |
| Ga0182113_10352751 | 3300015269 | Miscanthus Phyllosphere | MRLMITRRSSSLYSKGLIAIGEQDQELGSWFTASGLGGTVAAKQYMFHEEIKN* |
| Ga0182113_10405961 | 3300015269 | Miscanthus Phyllosphere | GLYSKGLITTGEQDQELGPWITASSLGSTVTAKRHLFHEEIKN* |
| Ga0182113_10451501 | 3300015269 | Miscanthus Phyllosphere | INMRLMITRRSSSLYSKGLIATGEQDQELGPWFTASSLDGTVAAK* |
| Ga0182188_10220561 | 3300015274 | Miscanthus Phyllosphere | KLQIDMSLMKIRRCSSLYSKELIATGEQDQELGPWFTASGLGGTVAAKRLLFHKKIKN* |
| Ga0182188_10331921 | 3300015274 | Miscanthus Phyllosphere | MKRSSSLYSKGLIATGEQDQELGPWFTASSLGGTVAAKRCLFHEEIKK* |
| Ga0182172_10550512 | 3300015275 | Miscanthus Phyllosphere | MRFMITRRISSLYLKGLIAIGEQDQELGPWFSTSGLGGTVAAKRRLFHEEIKN* |
| Ga0182170_10310181 | 3300015276 | Miscanthus Phyllosphere | TTGEQDQEYGPWFTASGIGGTVAAKRRLFHEEIKN* |
| Ga0182170_10559591 | 3300015276 | Miscanthus Phyllosphere | MRRSSSLYSKGLIVTGEQDQELGPWFTASNLGGTVAAKRCLFHEEI |
| Ga0182170_10598221 | 3300015276 | Miscanthus Phyllosphere | LITIGEQDQELGPWFTTSGLGDIVAAKRRLSHKEIKN* |
| Ga0182128_10519691 | 3300015277 | Miscanthus Phyllosphere | DEHNLKLQINMRIMITRRSSSLYSKGLIAIGEQDQELGRWFTASSLGGTVAAKRCLFHE* |
| Ga0182174_10277341 | 3300015279 | Miscanthus Phyllosphere | LSLYLKGLIATGEQDQELGPWFTASSLGGTVAAKRCMFHEETKN* |
| Ga0182174_10463381 | 3300015279 | Miscanthus Phyllosphere | QINMRLMKIRSSSLYSKGLIATGEEDQELGPWFTASSLGGTVTAKQCLFHKKIKN* |
| Ga0182174_10713441 | 3300015279 | Miscanthus Phyllosphere | LKLQINMRLRITRRSSSLYSKRLIVTGEQDQEQGPWFTASSIGGTVATKRCLFHEEIKN* |
| Ga0182160_10487371 | 3300015281 | Miscanthus Phyllosphere | LKLQINMRLKKTRRSSSLYSKALITTGEQDQELGPWFISNNLGGTVAAKRRLFHKEI* |
| Ga0182124_10711071 | 3300015282 | Miscanthus Phyllosphere | MRLMITRRSSSLYSKGLIATGGQDQELGPWFTASGLGGTVAAKRCLF |
| Ga0182124_10834461 | 3300015282 | Miscanthus Phyllosphere | RSSSLYSKGLIATGEQDQELGSWFTANGLGGTVAAKRRLFHEEIKN* |
| Ga0182156_10445661 | 3300015283 | Miscanthus Phyllosphere | MSSSHYLKGLIATGEQDQELGPWFIASGLGGTVAVKQRLFHEEIKN* |
| Ga0182156_10645841 | 3300015283 | Miscanthus Phyllosphere | MRLTKIRSSSLYSKGLVAIGEQDQELGSWFTASSFGGTVAAKR |
| Ga0182186_10331282 | 3300015285 | Miscanthus Phyllosphere | RLMITTRSSTFYSKGLIAIGEQDQELGPWFTASNLGGTVAAKRRLFHEEIKN* |
| Ga0182186_10484591 | 3300015285 | Miscanthus Phyllosphere | RSSSLYSKGLITTGEQDQELGPWFIASSLGGTVAAKQCLFHEEIKN* |
| Ga0182186_10618771 | 3300015285 | Miscanthus Phyllosphere | RSSSLYSKGQIATGEQDQEQGPWFTASGPGGTVAAKRRLFHEKIKN* |
| Ga0182171_10814141 | 3300015287 | Miscanthus Phyllosphere | MKSRRSSSLYSKGLITTGEQDQELGPWFTASSLGGTVAAKQCLFYEEIKN* |
| Ga0182173_10110511 | 3300015288 | Miscanthus Phyllosphere | ECNLKWQINMRFMIMRRSSSLYSKGLIAIDEQDQELGPWFTASDLGGTVVAKQCQFHEEIKN* |
| Ga0182173_10781361 | 3300015288 | Miscanthus Phyllosphere | MRLMITRRSSSLYLKELIAIGKQNQELGPWFIASSLCGTVAVK |
| Ga0182138_10467021 | 3300015289 | Miscanthus Phyllosphere | ERNLKLQINMRLMKTRRSSSLYSKGLIAIGEQDKELGPWFTASSLGGTVVAKRCLFHEKIKN* |
| Ga0182125_10874591 | 3300015291 | Miscanthus Phyllosphere | MKLQINMRLMKTRSLSVYSKGLIATGEQDQELGPWFTASSLGGTVAAKQRLFHEKIKN* |
| Ga0182141_10354582 | 3300015292 | Miscanthus Phyllosphere | MRFMITRISSSLYSKGLIVTGEQDQEQGPWFTASGLGGIVAAKRHMFHEEIKN* |
| Ga0182141_10512241 | 3300015292 | Miscanthus Phyllosphere | MRLMKIRRSSSLYSKGLIATGEQDQELGPWFTASSLGVTVTAKRCMFHEEIKN* |
| Ga0182141_10772021 | 3300015292 | Miscanthus Phyllosphere | MRLMIMRRSSSLYSKGLIATGEQDQELGAWFTANDLGGTVAAKRHLFHKEIKN* |
| Ga0182141_10923591 | 3300015292 | Miscanthus Phyllosphere | MRLMKIRSSSLYSKGLIATGEQDQELGPWFIANSLGGTVAAKQHLFHEEIKN* |
| Ga0182126_10560031 | 3300015294 | Miscanthus Phyllosphere | ATDEQDQELGPWFTASSLGGTVATKQCMFHEEIKN* |
| Ga0182126_10643461 | 3300015294 | Miscanthus Phyllosphere | MRLKKTRSSSLYSKGLITTGEQDKELGPWFTVRSLAATVAAKKCLFHEEIKN* |
| Ga0182175_10862191 | 3300015295 | Miscanthus Phyllosphere | MRLMIMRKSSSLYSKGLIATGEKDQEQGPWFTANSLGGIVAAKRCMFYEEIKN* |
| Ga0182106_10331632 | 3300015298 | Miscanthus Phyllosphere | MKTRSSSLYSKGLITIGEQDQELGPWFTASDLGGTVAAKQYLFHKEIKN* |
| Ga0182107_10681611 | 3300015299 | Miscanthus Phyllosphere | KQVWDERNLKLQVNMRLMKTRSSSLYSNGLIATGEQDQELGPWFTAGSLGGTVVAKRCLFHEEIKN* |
| Ga0182107_10751092 | 3300015299 | Miscanthus Phyllosphere | MTMKRSSSLYLKRLIATDEKDQELGPWFTASGHSGTVAAK* |
| Ga0182107_10995761 | 3300015299 | Miscanthus Phyllosphere | RSSSLYSKGLIATGEQDQELGPWFTASSLGGTVAAKRCLFHKENKNTIKLKP* |
| Ga0182108_10744871 | 3300015300 | Miscanthus Phyllosphere | KGLIATGEQDQEPGSWFTANSLGGTVAAKRRLFHEEIKN* |
| Ga0182108_10822071 | 3300015300 | Miscanthus Phyllosphere | MRLMIMRRSSSLYSKGLITIGEQDEEPGPWFTASGLGGTVTVKRRLFHEGIKN* |
| Ga0182108_10888461 | 3300015300 | Miscanthus Phyllosphere | SKGQITTGEQDQELGPWFTASDLGSTVAAKRCLFHEEIKN* |
| Ga0182108_11081811 | 3300015300 | Miscanthus Phyllosphere | RIMIMRRSSGLYSKGQITIGEQDQKPGPWFTASGLGGIVAAKQCLFHEEIKN* |
| Ga0182143_10103351 | 3300015302 | Miscanthus Phyllosphere | MRKSSSLYSKGLIATGEQDQELGPWFTANSLGGTVAAKRRLFHEEIKN* |
| Ga0182143_10813821 | 3300015302 | Miscanthus Phyllosphere | MRLMIIRRSSSLYLKGLIITGEQDQEQGPWFIASDLGGTVVAKRCLFH |
| Ga0182112_10306221 | 3300015304 | Miscanthus Phyllosphere | MKLQINMRLMIMRRSSGLYSKGLIATGEQDQERGPWFTASGLGGTVAAKRRLFHEEIKN* |
| Ga0182158_10833051 | 3300015305 | Miscanthus Phyllosphere | MITRRSSSLYSKGLIATGEQDQELGPWFIAGGLGGIVAAKRCLFHVE |
| Ga0182158_10898271 | 3300015305 | Miscanthus Phyllosphere | TRKSSSLYSKGLIIKGEQDQEPRPWFTTKGLGGTVAAKRCLFHEEIKN* |
| Ga0182144_10745892 | 3300015307 | Miscanthus Phyllosphere | SKGLIATGEQDQELGLWFTASSLGGTVATKQCLFHEKIKN* |
| Ga0182142_10757322 | 3300015308 | Miscanthus Phyllosphere | RLMIMRKSSSLYSKGLIATGKQDQELGPWFTASILGGIVAAKRCLFHEEIKN* |
| Ga0182142_10919381 | 3300015308 | Miscanthus Phyllosphere | LYSKGLIATGEQDQELGPWFTASSLGGIVAAKRCLFHEEIKN* |
| Ga0182140_10431561 | 3300015314 | Miscanthus Phyllosphere | INMRLMIMRRSLSLYLKGLIAIGEQDQELGPWFTASSLGGTVTTNRCLFHEEIKN* |
| Ga0182140_10741191 | 3300015314 | Miscanthus Phyllosphere | KLMITKRSSSLYFKGLIATSKQDQELGPWFTESGLGGTVTAKRRLFYEEIKN* |
| Ga0182140_11007782 | 3300015314 | Miscanthus Phyllosphere | MRLMITRRSSSLYSKGLIAIGEQVQELGPWFTASGLGGTVAAKRCLFHKKIKN* |
| Ga0182127_11064961 | 3300015321 | Miscanthus Phyllosphere | KGLIAIGEQDQELGPWFTASSLGSTVAAKRCLFHEEIKN* |
| Ga0182187_11103032 | 3300015341 | Miscanthus Phyllosphere | INMRLMITKRRSSLYLKGLIATIEQDQELGPWFTASSLGGTVVAKRCIFHEEIKN* |
| Ga0182109_11995211 | 3300015342 | Miscanthus Phyllosphere | NLKLKINMRLMITRRSSSLYSKGLIAIGEQDQELGPWFTASRLGGTVAAKQRLFHEEIKN |
| Ga0182109_12239961 | 3300015342 | Miscanthus Phyllosphere | KGLIAIGKQDQELGPWFTTSGCGSTVTAKRCMFHEEINN* |
| Ga0182155_11999651 | 3300015343 | Miscanthus Phyllosphere | KGLITIGEQDQQLGPWLTASSLGDTVAAKRRLFHEEIKN* |
| Ga0182189_11770601 | 3300015344 | Miscanthus Phyllosphere | LMKSRSLSLYSKGLIATGEQDQELGPWFTASSLGDTVAAKRCLFHEEIKN* |
| Ga0182189_12036261 | 3300015344 | Miscanthus Phyllosphere | DERNLKLQINMRPMITRRSSSLYSKGLIATGEQDQELGPWFTASSLGNTVAAKRCLFHEEIKN* |
| Ga0182111_10044623 | 3300015345 | Miscanthus Phyllosphere | ERDECNVKLQINMRLMITKRSSSLYSKELIATGEQDQEQRPWFTASGLGGTVAAKRCLFHEKIKN* |
| Ga0182111_10806532 | 3300015345 | Miscanthus Phyllosphere | RSSSLYSKGLIAIGEQDQELGPWFTASGLGSTVAAKRRLFHEEINN* |
| Ga0182111_10918061 | 3300015345 | Miscanthus Phyllosphere | LQINMRLMITRSSSLYSKGLITIGEQDQELGPWFTASGLGGTVAVKQRLFHEDIKN* |
| Ga0182139_11505701 | 3300015346 | Miscanthus Phyllosphere | QINMRLMITRRSSSLYSKGLIATGEQDQELGPWFTATSLGGIVAAKRHLFHEEIKN* |
| Ga0182161_11003991 | 3300015351 | Miscanthus Phyllosphere | SLYSKELIATGEQDQELRPWFTASGLGGTVTAKRRLFHEEIKN* |
| Ga0182159_10361201 | 3300015355 | Miscanthus Phyllosphere | MRLMITRRSSSLYSKGLIATDEQDQEQGPWFTASGLGGTVAAKRLLFHEEIKN* |
| Ga0182159_11987391 | 3300015355 | Miscanthus Phyllosphere | RSSSLYSKGLIAIGKQDQELGPWFIASSLGGTVAAKRCLFHEEIMN* |
| Ga0182159_12866201 | 3300015355 | Miscanthus Phyllosphere | YSKGLIATGEQDQELGPWFTTSSLGDTVAAKRCLFHEEIKN* |
| Ga0182145_11920581 | 3300015361 | Miscanthus Phyllosphere | LYSKGLIATGEQDQELGPWFTASGLGGTIAAKRLLFHEEIKN* |
| Ga0182203_11267821 | 3300017404 | Miscanthus Phyllosphere | SKGLITTGKQDQELGPWFTASSLGGTVAAKRCLFHEEIKN |
| Ga0182220_10847791 | 3300017407 | Miscanthus Phyllosphere | MRLMIMRRSSSLYSKGLIVTGKKDQELGPWFTASSLGGTVAAKRCLFHEEIKN |
| Ga0182220_10891981 | 3300017407 | Miscanthus Phyllosphere | QERDERNLKLQINMMLMITRSSSLYSKGLIATGEQDQELGPWFTASSLGGTVAAKRCLFHKKIKN |
| Ga0182207_11268951 | 3300017410 | Miscanthus Phyllosphere | INMRLKKTRRSSGLYSKGLIAIGEQDQELGPWFTPSDLGDTVAAKRCLFHEEIKN |
| Ga0182207_11579971 | 3300017410 | Miscanthus Phyllosphere | RNLKLQINMRLMTMRSSGLYSKGLIATGEQDQEPGPWFTASGLSGTVAVKRRLFHEKIKN |
| Ga0182208_10475321 | 3300017411 | Miscanthus Phyllosphere | NERNLKLQINMRLMKTRRSSSLYSKGLIATGEQDQELGPWFTASSLGGTVAAKRYLFHEEIKN |
| Ga0182208_10860151 | 3300017411 | Miscanthus Phyllosphere | MSLMIMRQSSSLYLKGLITIDKQDQELGPWFTASGLGGIVAAKQHLVHEE |
| Ga0182222_10446271 | 3300017413 | Miscanthus Phyllosphere | RRSSSLYSKGLIATGEQDQEQGPWFTASSLGGTVAAKRHLFHEEIKN |
| Ga0182222_10985182 | 3300017413 | Miscanthus Phyllosphere | MRLMITRSSSFYSKGLIAIGEQDQELGPWFTASSLGGIVAAKRYLFHKEIKN |
| Ga0182222_11048072 | 3300017413 | Miscanthus Phyllosphere | MKRSSSLYSKGLIATGEQDQEQGLWFTASGLGGTVAAKRRLFQEEIKN |
| Ga0182222_11071902 | 3300017413 | Miscanthus Phyllosphere | MNLKRSSSLYSEGLIATGEQDQEPRPWFTASGLGGTVAAKRRLFHEEI |
| Ga0182228_10894561 | 3300017420 | Miscanthus Phyllosphere | YSKGLIAIGKQDQELGPWFTTSGLGGTVAAKRRLFHKEIKN |
| Ga0182224_10530951 | 3300017425 | Miscanthus Phyllosphere | DERNLKLQINMRLMIMRRSSSLYSKGLIATGEQDQKLGPWFTASDLGGTVAAKRRLFHKEIKN |
| Ga0182224_11566771 | 3300017425 | Miscanthus Phyllosphere | SLYSKGLIATSEQDQELGPWFTASSLGGTVAAKRHLFHKEIKN |
| Ga0182192_11313571 | 3300017430 | Miscanthus Phyllosphere | GLIATGEQDQELGPWFTTSGLSGTVAAKRYLFHKKIKN |
| Ga0182206_11120702 | 3300017433 | Miscanthus Phyllosphere | NLYSKGLIATGEQDQELGPCFTAISLGSTVAAKRCLFHEEIKN |
| Ga0182191_10999822 | 3300017438 | Miscanthus Phyllosphere | SSLYSKGLIATDEQDQEQGPWFTASGLGSIVVAKRCLFHEEIKN |
| Ga0182191_11334292 | 3300017438 | Miscanthus Phyllosphere | MRLMITTRSSGLYSTGLNATGEQEQEEGPWFIASSLGGTVAAKRCLFHEEIMN |
| Ga0182191_11788821 | 3300017438 | Miscanthus Phyllosphere | YSKGLIATGEQDQELGPWFTASSLGGTVAAKQCLFHEEIKN |
| Ga0182193_11616901 | 3300017443 | Miscanthus Phyllosphere | RSSSLYSKGLIAIGEQDQDQGPWFIASGVGGTVAAK |
| Ga0182233_10803262 | 3300017680 | Miscanthus Phyllosphere | ITRRRSNLYSKGLITTGEQDKELGPWFIASSLGGTVTAKRCLFHEEIKN |
| Ga0182226_10446171 | 3300017681 | Miscanthus Phyllosphere | MRLMITRRSSSLYSKGIIAIGEQDQELGPRFIASSLGGTVAAKRCLFHEEIKN |
| Ga0182218_10473131 | 3300017683 | Miscanthus Phyllosphere | TRSSSSLYSKGLIVTGEQNQELGSWFTASSLGGTVVAKRCLFHKEIKN |
| Ga0182218_11400791 | 3300017683 | Miscanthus Phyllosphere | MRLMIMRKSSSLYSKGLIATGEQDQEQGPWFTASGLGGTVVAKQHLFHDKIKN |
| Ga0182225_10716641 | 3300017684 | Miscanthus Phyllosphere | MRLMIMKKSSSLYSKGLIATGEQDQELGPWFTASGLGGTIVAKRCLFYEEIKN |
| Ga0182227_10403491 | 3300017685 | Miscanthus Phyllosphere | MRLIIMRRSSSLYSKGLIATGEQDQELGPWFTASSLGGTVAAKRRLFHEEIKN |
| Ga0182227_10913302 | 3300017685 | Miscanthus Phyllosphere | MRLMITRRSSGLYSKILIASGEQDQELGPWFTASGLGGTVAAK |
| Ga0182227_11066591 | 3300017685 | Miscanthus Phyllosphere | SSSLYSKGLIATGEQDQELGPWFTASSLGGTVAAKRYLFYEKIKN |
| Ga0182205_11431471 | 3300017686 | Miscanthus Phyllosphere | ERNLKLHINMRLVITRRSSSLYSKGLIATSEQYQEQGPWFTASGLGGTVAVKQRLFHEEIKN |
| Ga0182223_10576271 | 3300017690 | Miscanthus Phyllosphere | NLKLQINMRLMIMRRSSGLYSNGLITTGEQDQEQGPGLTANDLGCTVAETQH |
| Ga0182223_10918411 | 3300017690 | Miscanthus Phyllosphere | TKRSSSLYSKGLIATGEQDQEQGPWFTASGLGGTVAAKGCLFHKKIKD |
| Ga0182223_10930951 | 3300017690 | Miscanthus Phyllosphere | ITRRSSSLYSKGLIATGEQDQELGPWFTVSGLGGTVAAKRRQFHKEIKN |
| Ga0182232_10767471 | 3300021060 | Phyllosphere | SIYSKGLIATGEQDQELGPWFTASSLGSTVAAKRCLFHEEIKN |
| Ga0207648_117819922 | 3300026089 | Miscanthus Rhizosphere | MRLIKTRSLSLYSKGLIAIGEQDQEQGPWFTASGLGGTVAAKRRLFHEKIKN |
| ⦗Top⦘ |