| Basic Information | |
|---|---|
| Family ID | F092934 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 43 residues |
| Representative Sequence | AAAAGVGIARYYVLVTWATVVSLRNYLRRGVPATWDAAEGTR |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.13 % |
| % of genes from short scaffolds (< 2000 bps) | 91.59 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.393 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil (8.411 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.907 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.925 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.29% β-sheet: 0.00% Coil/Unstructured: 55.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF02397 | Bac_transf | 65.42 |
| PF00535 | Glycos_transf_2 | 6.54 |
| PF13489 | Methyltransf_23 | 3.74 |
| PF09957 | VapB_antitoxin | 1.87 |
| PF01850 | PIN | 1.87 |
| PF08241 | Methyltransf_11 | 0.93 |
| PF16363 | GDP_Man_Dehyd | 0.93 |
| PF07695 | 7TMR-DISM_7TM | 0.93 |
| PF00011 | HSP20 | 0.93 |
| PF13231 | PMT_2 | 0.93 |
| PF02698 | DUF218 | 0.93 |
| PF08242 | Methyltransf_12 | 0.93 |
| PF01370 | Epimerase | 0.93 |
| PF00732 | GMC_oxred_N | 0.93 |
| PF01041 | DegT_DnrJ_EryC1 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG2148 | Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid) | Cell wall/membrane/envelope biogenesis [M] | 65.42 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.93 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.93 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.93 |
| COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.93 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.93 |
| COG1434 | Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 family | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.93 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.93 |
| COG2949 | Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycin | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.39 % |
| Unclassified | root | N/A | 5.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001380|JGI1356J14229_10132104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 830 | Open in IMG/M |
| 3300001535|A3PFW1_10116105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1076 | Open in IMG/M |
| 3300003992|Ga0055470_10114663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 679 | Open in IMG/M |
| 3300003999|Ga0055469_10187625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 641 | Open in IMG/M |
| 3300004156|Ga0062589_101527077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 658 | Open in IMG/M |
| 3300005093|Ga0062594_100976055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 811 | Open in IMG/M |
| 3300005168|Ga0066809_10165059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 582 | Open in IMG/M |
| 3300005175|Ga0066673_10382252 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300005187|Ga0066675_10980989 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300005327|Ga0070658_10729497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 860 | Open in IMG/M |
| 3300005455|Ga0070663_100346216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1202 | Open in IMG/M |
| 3300005457|Ga0070662_100932996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 741 | Open in IMG/M |
| 3300005529|Ga0070741_10297234 | All Organisms → cellular organisms → Bacteria | 1517 | Open in IMG/M |
| 3300005557|Ga0066704_10702269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 637 | Open in IMG/M |
| 3300005557|Ga0066704_10886090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 552 | Open in IMG/M |
| 3300005560|Ga0066670_10876750 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300005564|Ga0070664_100287192 | All Organisms → cellular organisms → Bacteria | 1484 | Open in IMG/M |
| 3300005578|Ga0068854_100144382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1829 | Open in IMG/M |
| 3300005598|Ga0066706_10676232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 820 | Open in IMG/M |
| 3300005719|Ga0068861_101784858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 610 | Open in IMG/M |
| 3300005764|Ga0066903_102591551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 983 | Open in IMG/M |
| 3300005764|Ga0066903_102858213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 937 | Open in IMG/M |
| 3300005840|Ga0068870_10493340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 815 | Open in IMG/M |
| 3300006237|Ga0097621_100353593 | All Organisms → cellular organisms → Bacteria | 1307 | Open in IMG/M |
| 3300006804|Ga0079221_10681516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 712 | Open in IMG/M |
| 3300006853|Ga0075420_100707560 | Not Available | 868 | Open in IMG/M |
| 3300009137|Ga0066709_100852516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1324 | Open in IMG/M |
| 3300009840|Ga0126313_10902936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 721 | Open in IMG/M |
| 3300010037|Ga0126304_10904319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 600 | Open in IMG/M |
| 3300010042|Ga0126314_10565196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 828 | Open in IMG/M |
| 3300010325|Ga0134064_10217921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 692 | Open in IMG/M |
| 3300010362|Ga0126377_11756042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 696 | Open in IMG/M |
| 3300010375|Ga0105239_11527020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 772 | Open in IMG/M |
| 3300010880|Ga0126350_10678151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 514 | Open in IMG/M |
| 3300012008|Ga0120174_1056336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 1069 | Open in IMG/M |
| 3300012046|Ga0136634_10436420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 551 | Open in IMG/M |
| 3300012189|Ga0137388_11237193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 685 | Open in IMG/M |
| 3300012897|Ga0157285_10284625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 556 | Open in IMG/M |
| 3300012958|Ga0164299_11485687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 528 | Open in IMG/M |
| 3300012964|Ga0153916_13197718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 515 | Open in IMG/M |
| 3300013102|Ga0157371_10595672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 822 | Open in IMG/M |
| 3300013307|Ga0157372_12479813 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300014497|Ga0182008_10695199 | Not Available | 580 | Open in IMG/M |
| 3300014745|Ga0157377_11595692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
| 3300014968|Ga0157379_11166747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 740 | Open in IMG/M |
| 3300015077|Ga0173483_10001360 | All Organisms → cellular organisms → Bacteria | 7698 | Open in IMG/M |
| 3300015161|Ga0167623_1034574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1123 | Open in IMG/M |
| 3300015261|Ga0182006_1210664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 642 | Open in IMG/M |
| 3300015373|Ga0132257_100029369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5933 | Open in IMG/M |
| 3300017787|Ga0183260_10021149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4954 | Open in IMG/M |
| 3300017966|Ga0187776_11108035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 588 | Open in IMG/M |
| 3300017974|Ga0187777_10879490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 643 | Open in IMG/M |
| 3300018060|Ga0187765_10913419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 595 | Open in IMG/M |
| 3300018064|Ga0187773_11079283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 532 | Open in IMG/M |
| 3300018468|Ga0066662_12838192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 514 | Open in IMG/M |
| 3300018469|Ga0190270_11065957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 839 | Open in IMG/M |
| 3300019361|Ga0173482_10504508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 588 | Open in IMG/M |
| 3300022904|Ga0247769_1118897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 667 | Open in IMG/M |
| 3300023078|Ga0247756_1112039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 536 | Open in IMG/M |
| 3300024232|Ga0247664_1110442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 639 | Open in IMG/M |
| 3300025324|Ga0209640_10343495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1240 | Open in IMG/M |
| 3300025326|Ga0209342_10596190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 902 | Open in IMG/M |
| 3300025796|Ga0210113_1022153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1305 | Open in IMG/M |
| 3300025906|Ga0207699_10572588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 821 | Open in IMG/M |
| 3300025908|Ga0207643_10926768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 564 | Open in IMG/M |
| 3300025912|Ga0207707_11029467 | Not Available | 674 | Open in IMG/M |
| 3300025919|Ga0207657_11028881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 631 | Open in IMG/M |
| 3300025922|Ga0207646_11151319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 681 | Open in IMG/M |
| 3300025922|Ga0207646_11402361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 608 | Open in IMG/M |
| 3300025929|Ga0207664_10526347 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300025929|Ga0207664_11154515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 691 | Open in IMG/M |
| 3300025929|Ga0207664_11949514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
| 3300025932|Ga0207690_10520375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 964 | Open in IMG/M |
| 3300025951|Ga0210066_1057491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 663 | Open in IMG/M |
| 3300025981|Ga0207640_10936088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 759 | Open in IMG/M |
| 3300026041|Ga0207639_11314769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 678 | Open in IMG/M |
| 3300026530|Ga0209807_1044332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2081 | Open in IMG/M |
| 3300027773|Ga0209810_1118314 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
| 3300027857|Ga0209166_10559884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 583 | Open in IMG/M |
| 3300027866|Ga0209813_10284520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 638 | Open in IMG/M |
| 3300028104|Ga0247713_1030033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1365 | Open in IMG/M |
| 3300028592|Ga0247822_10790707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 772 | Open in IMG/M |
| 3300028597|Ga0247820_10617274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 749 | Open in IMG/M |
| 3300028716|Ga0307311_10113867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 762 | Open in IMG/M |
| 3300028812|Ga0247825_10017513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 4684 | Open in IMG/M |
| 3300028812|Ga0247825_10218591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1320 | Open in IMG/M |
| 3300028865|Ga0302291_10245056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 613 | Open in IMG/M |
| 3300030006|Ga0299907_10550555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 904 | Open in IMG/M |
| 3300031234|Ga0302325_10325545 | Not Available | 2467 | Open in IMG/M |
| 3300031236|Ga0302324_102562215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 621 | Open in IMG/M |
| 3300031239|Ga0265328_10095507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1099 | Open in IMG/M |
| (restricted) 3300031248|Ga0255312_1121531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 643 | Open in IMG/M |
| 3300031249|Ga0265339_10518749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 549 | Open in IMG/M |
| 3300031938|Ga0308175_101841529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 678 | Open in IMG/M |
| 3300031939|Ga0308174_11075713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 684 | Open in IMG/M |
| 3300031996|Ga0308176_12802306 | Not Available | 518 | Open in IMG/M |
| 3300032075|Ga0310890_11681610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 526 | Open in IMG/M |
| 3300032770|Ga0335085_10272353 | All Organisms → cellular organisms → Bacteria | 2023 | Open in IMG/M |
| 3300032829|Ga0335070_10668220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 973 | Open in IMG/M |
| 3300032829|Ga0335070_11198709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 697 | Open in IMG/M |
| 3300032892|Ga0335081_12109379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 597 | Open in IMG/M |
| 3300032892|Ga0335081_12557700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 525 | Open in IMG/M |
| 3300032893|Ga0335069_12767260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 503 | Open in IMG/M |
| 3300033158|Ga0335077_10630952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1114 | Open in IMG/M |
| 3300033550|Ga0247829_10027875 | All Organisms → cellular organisms → Bacteria | 3718 | Open in IMG/M |
| 3300033807|Ga0314866_048341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 693 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 8.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.48% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 5.61% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.74% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.74% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.80% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.80% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.80% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.87% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.87% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.87% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.87% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.87% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.87% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.87% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.93% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.93% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.93% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.93% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.93% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001380 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m | Environmental | Open in IMG/M |
| 3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300003992 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 | Environmental | Open in IMG/M |
| 3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012008 | Permafrost microbial communities from Nunavut, Canada - A39_80cm_12M | Environmental | Open in IMG/M |
| 3300012046 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015161 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1B, Ice margin) | Environmental | Open in IMG/M |
| 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300022904 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L166-409R-6 | Environmental | Open in IMG/M |
| 3300023078 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L066-202C-4 | Environmental | Open in IMG/M |
| 3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025796 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025951 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028104 | Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 2-1-E_N | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028865 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_4 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Host-Associated | Open in IMG/M |
| 3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1356J14229_101321043 | 3300001380 | Groundwater | AAGVGIARYYVLVTWATVVSLRNYLRRGVPATWDAAEGAQ* |
| A3PFW1_101161053 | 3300001535 | Permafrost | FGVGLPRYYVLVTWATVVALWNYLRRGVPTTWDVAEGTR* |
| Ga0055470_101146631 | 3300003992 | Natural And Restored Wetlands | AAAFGVGLPRYYVLVTWATNVALWNYLRRGVPATWTPAEGTR* |
| Ga0055469_101876252 | 3300003999 | Natural And Restored Wetlands | LGLAAAFAARVPIARYYVYVTWATVQALWNYLHRGVPATWDAAEGTR* |
| Ga0062589_1015270772 | 3300004156 | Soil | VGIARYYGLVTLATLVSLWNYLRRGVPATWATGEEARGAAA* |
| Ga0062594_1009760552 | 3300005093 | Soil | ALLGAAAARVGIARYYVLVTWATVASLANYLRRGVPAAWDPGATR* |
| Ga0066809_101650591 | 3300005168 | Soil | AAFAAGVPIARYYVYVTWATVQALWNYLRHGVPAAWDPAVTR* |
| Ga0066673_103822522 | 3300005175 | Soil | AGVGIARYYVLVTWATVVSLWNYLRRGVPTTWTPPEGTR* |
| Ga0066675_109809891 | 3300005187 | Soil | AAQLLVLLAAALGVGIARYYVLVTWATVVALWNYIKRGVPATWEAAAGTR* |
| Ga0070658_107294973 | 3300005327 | Corn Rhizosphere | VLTAFAAGVPIARYYVYVTWATVQALWNYLRLGVPATWDAAEGTR* |
| Ga0070663_1003462161 | 3300005455 | Corn Rhizosphere | ALLAQLGLFAAFAAGVPIARYYVYVTWATVQALWNYLRHGVPAAWDPAVTR* |
| Ga0070662_1009329961 | 3300005457 | Corn Rhizosphere | LAAFAAGVPIARYYVYVTWATVQAFRNYLRRGVPATWDAAEGTR* |
| Ga0070741_102972343 | 3300005529 | Surface Soil | GIARYYVLVTWATVQSLVNYLRRGVPTTWDAAEGTR* |
| Ga0066704_107022692 | 3300005557 | Soil | IARYYVLVTWATIVSLANVLRRGVPATWQAAEGTR* |
| Ga0066704_108860901 | 3300005557 | Soil | LPRYYVLVTWATVVSLFNYVRRGVPATWEAAEGTR* |
| Ga0066670_108767501 | 3300005560 | Soil | AAALGVGIARYYVLVTWATVVALWNYIKRGVPATWEAAAGTR* |
| Ga0070664_1002871924 | 3300005564 | Corn Rhizosphere | FAAGVPIARYYVYVTWATVQALRNYLRRGVPATWDAAEGTR* |
| Ga0068854_1001443821 | 3300005578 | Corn Rhizosphere | YALVLLGQLAVLTAFAAGVPIARYYVYVTWATVQALRNYLRRGVPATWDAAEGTR* |
| Ga0066706_106762322 | 3300005598 | Soil | LHYYLLVTWATFVSLVRYLRRGVPATWDAAAGTRTLG* |
| Ga0068861_1017848581 | 3300005719 | Switchgrass Rhizosphere | FVAGVPIARYYVFVTWATVQALWNYLRRGVPAAWDPAATR* |
| Ga0066903_1025915513 | 3300005764 | Tropical Forest Soil | GVGVARYYVLVTCATLESLFNYARRGVPTTWESAEGTR* |
| Ga0066903_1028582133 | 3300005764 | Tropical Forest Soil | GIARYYVLVTWATVVALANYLRRGVPATWEAPEGTR* |
| Ga0068870_104933402 | 3300005840 | Miscanthus Rhizosphere | AAQVALGAAFVAGVPIARYYVFVTWATVQALWNYLRRGVPAAWDPAATR* |
| Ga0097621_1003535933 | 3300006237 | Miscanthus Rhizosphere | LLLAALFGVGIARYYVLVTWATVVALWNYARRGVPATWEIAEGTR* |
| Ga0079221_106815161 | 3300006804 | Agricultural Soil | LILVAAAAGVGIARYYVLVTWATLVSLVNYLRRGVPATWEVAEGTR* |
| Ga0075420_1007075601 | 3300006853 | Populus Rhizosphere | HYYTLVSWATVVALARYLQQGGVSPTWEKAEGTR* |
| Ga0105245_105805593 | 3300009098 | Miscanthus Rhizosphere | GAAAVAGVGIARYYVLVTWATLVSLWNYLRRGVPAGWEPARE* |
| Ga0066709_1008525161 | 3300009137 | Grasslands Soil | QLGLLLAALVGVGVARYYVLVTWATVVALWNYGRRGVPATWEVAEGTR* |
| Ga0126313_109029362 | 3300009840 | Serpentine Soil | LLLLAAALGVGVARYYVLVTWATVLALRNYLRRGVPATWEVAEGTR* |
| Ga0126304_109043192 | 3300010037 | Serpentine Soil | LAYYYALVTWATVVSLWNYARRGVPATWAPPEGTR* |
| Ga0126314_105651962 | 3300010042 | Serpentine Soil | AARGAQLLLLLAAALGVGIARYYVLVTWATVLALRNYLRRGVPATWEVAEGTR* |
| Ga0134064_102179212 | 3300010325 | Grasslands Soil | GVGIARYYVLVTWATVVSLVNYVRRGVPATWEAAEGTR* |
| Ga0126377_117560421 | 3300010362 | Tropical Forest Soil | VPIARYYVYVTWATAQALWNYLRRGVPATWDAAEGTR* |
| Ga0105239_115270201 | 3300010375 | Corn Rhizosphere | AFVAGVPIARYYVFVTWATVQALWNYLRRGVPAAWDPAATR* |
| Ga0126350_106781511 | 3300010880 | Boreal Forest Soil | VLAAALVGVGLPRYYVLVTWATVQALFNYLRHGVPVTWDPAEGTR* |
| Ga0120174_10563362 | 3300012008 | Permafrost | LLLAAAVGVGIARYYVLVTWATLVALLNYLRRGVPATWQPAHE* |
| Ga0136634_104364201 | 3300012046 | Polar Desert Sand | QLALAAQLALLAAAAAGVGIVRYYVLVTWATVVSLWNYLRRGVPAAWEPGSTR* |
| Ga0137388_112371932 | 3300012189 | Vadose Zone Soil | ALGVQLGVLLAALFGVGLPRYYVLVTWATVVALWNYLRRGVPTTCDAAEGTR* |
| Ga0157285_102846251 | 3300012897 | Soil | AGQLAVLAAFAARVPLARYYVYVAWATVQALWNYLRRGVPATWDAAEGTR* |
| Ga0164299_114856871 | 3300012958 | Soil | PIARYYVYVTWATVQALWNYLRHGVPAAWDPAITR* |
| Ga0153916_131977182 | 3300012964 | Freshwater Wetlands | ALFGVGLPRYYVLVTWATVVALWNYLRRGVPTTWDVADGTR* |
| Ga0157371_105956723 | 3300013102 | Corn Rhizosphere | PIARYYVYVTWATVQALRNYLRRGVPAAWDAAEGTR* |
| Ga0157372_124798131 | 3300013307 | Corn Rhizosphere | VLLAALFGVGIPRYYVLVTWATVVALWNYARRGVATTWDVAEGTR* |
| Ga0182008_106951992 | 3300014497 | Rhizosphere | VGFPRYYVLVTWATVVALWNYARRGVPTTWETAEGTR* |
| Ga0157377_115956922 | 3300014745 | Miscanthus Rhizosphere | FAAGVPIARYYVYVTWATVQALRNYLRRGVPAIWDAAEGTR* |
| Ga0157379_111667472 | 3300014968 | Switchgrass Rhizosphere | AAFGAGVPIARYYVYVTWATVQALWNYLRHGVPAAWDPAVTR* |
| Ga0173483_100013601 | 3300015077 | Soil | VALAAAFAARVPIARYYVYVTWATVQALWNYVRRGVPATWEAAEGTR* |
| Ga0167623_10345743 | 3300015161 | Glacier Forefield Soil | LAAFAARVPIARYYVYVTWATAQALWNYLRRGVPAAWDPAATR* |
| Ga0182006_12106641 | 3300015261 | Rhizosphere | GIARNYELVTLATIVSLWNYVRRGVPATWEAAEGTR* |
| Ga0132257_1000293691 | 3300015373 | Arabidopsis Rhizosphere | AAFAARVPIARYYVYVTWATVQALWNYVRRGVPATWEAAEGTR* |
| Ga0183260_100211497 | 3300017787 | Polar Desert Sand | AGVPIARYYVYVTWATAQALWNYLRRGVPAAWDPAATR |
| Ga0187776_111080352 | 3300017966 | Tropical Peatland | AVGVGVARYYVLVTWATLEALVKYLRRGVPTTWEAAEGTR |
| Ga0187777_108794902 | 3300017974 | Tropical Peatland | YDLVLAAQLGLLLAAALGVGIARYYVLVTWATLVALLNYVRRGVPATWEAAEGTR |
| Ga0187765_109134191 | 3300018060 | Tropical Peatland | VGVGVARYYVLVTWATLESLVNYVRRGVPATWDAAEGTR |
| Ga0187773_110792832 | 3300018064 | Tropical Peatland | LAAALLGVGIARYYVLVTWATVQSLFNYLHRGVPPTWDAAEGTR |
| Ga0066662_128381921 | 3300018468 | Grasslands Soil | ALAGVGIARYYVLVTWATIVSLVNYLRRGVPTTWDVAEGTR |
| Ga0190270_110659573 | 3300018469 | Soil | PIARYYTYVTWATVQALWNYLRHGVAAAWDPAATR |
| Ga0173482_105045081 | 3300019361 | Soil | IAAAAAGVALPRYYVLITWATNVALWNYLRRGVPATWDAAEGTR |
| Ga0247769_11188971 | 3300022904 | Plant Litter | PIARYYVYVTWATVQALRNYLRRGVPATWDAAEGTR |
| Ga0247756_11120392 | 3300023078 | Plant Litter | AAAGVGIARYYVLVTWATLVSLRNYLQRGVPATWDVAEGTR |
| Ga0247664_11104421 | 3300024232 | Soil | VALPRYYVLITWATNVALWNYLRRGVPATWQIAEGTR |
| Ga0209640_103434953 | 3300025324 | Soil | GALLAAAAVGVGIARYYVLVTWATVVSLANYLRRGVPATWEAPAR |
| Ga0209342_105961901 | 3300025326 | Soil | AAAAGVGIARYYVLVTWATVVSLRNYLRRGVPATWDAAEGTR |
| Ga0210113_10221534 | 3300025796 | Natural And Restored Wetlands | ALLAAFAADVPIARYYVYVTWATVQALWNYLRRGVPAAWDPAATR |
| Ga0207699_105725881 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | GLLLVAAGLGVGIARYYVLVTWATVVALWNYLRRGVPATWAAPEGTR |
| Ga0207643_109267681 | 3300025908 | Miscanthus Rhizosphere | VVLAAFAAGVPIARYYVYVTWATVQAFRNYLRRGVPATWDAAEGTR |
| Ga0207707_110294671 | 3300025912 | Corn Rhizosphere | LLAAAAAGVGVARYYVLVTWATVVALWNFMRRGVPATWGPPEGTRA |
| Ga0207657_110288811 | 3300025919 | Corn Rhizosphere | AFAAGVPIARYYVYVTWATVQALWNYLRHGVPAAWDPAVTR |
| Ga0207646_111513192 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | GAAALGVGIARYYVLVTWATVVGLANYLKRGVPATWEVAEGTR |
| Ga0207646_114023611 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LAAAALGVGIARYYVLVTWATLVSLLNYVRRGVPATWEVAEGTRV |
| Ga0207664_105263471 | 3300025929 | Agricultural Soil | GLPRYYILITWATVQALFNYLRNGVPATWDAAQGTR |
| Ga0207664_111545152 | 3300025929 | Agricultural Soil | FVAQGLLLVAAGLGVGIARYYVLVTWATVVALWNYLRRGVPATWAAPEGTR |
| Ga0207664_119495141 | 3300025929 | Agricultural Soil | LVGVGIARYYVLISWATVVALVNYVRRGVPTTWEAAEGTR |
| Ga0207690_105203753 | 3300025932 | Corn Rhizosphere | AALFGVGLPRYYVLVTWATNVALWNYLRRGVPTTWEAAEGTR |
| Ga0210066_10574912 | 3300025951 | Natural And Restored Wetlands | FLGAAAAGVPLARYYTLVTWATLQALVNYLRRGVPATWEAAEGTR |
| Ga0207640_109360882 | 3300025981 | Corn Rhizosphere | VLTAFAAGVPIARYYVYVTWATVQALRNYLRRGVPATWDAAEGTR |
| Ga0207639_113147691 | 3300026041 | Corn Rhizosphere | FAAFAAGVPIARYYVYVTWATVQALWNYLRHGVPAAWDPAVTR |
| Ga0209807_10443324 | 3300026530 | Soil | QLGVLAAALLGVGIARYYVLVTWATVQSLFNYLRRGVPATWDAAEGTR |
| Ga0209810_11183142 | 3300027773 | Surface Soil | IARYYVLVTWATVVSLVNYLRRGVPATWEAAEGTR |
| Ga0209166_105598842 | 3300027857 | Surface Soil | VILGLQLGVLAAALVGVGLPRYYVLVTWATVQSLVNYLRRGVPSTWDAAEGTR |
| Ga0209813_102845202 | 3300027866 | Populus Endosphere | AGQLAVLAAFAARVPVARYYVYVAWATVQALWNYLRRGVPATWDAAEGTR |
| Ga0247713_10300333 | 3300028104 | Soil | LLAAAAARPGLPRYYVLVTWATVQALANYLRRGVPATWQAAEGTR |
| Ga0247822_107907072 | 3300028592 | Soil | LGQLAVLAAFAAGIPIARYYTYVTWATVQALRNYLRHGVAAAWDPAATR |
| Ga0247820_106172741 | 3300028597 | Soil | QLAVLAAFAAGIPIARYYTYVTWATVQALRNYLRHGVAAAWDPAATR |
| Ga0307311_101138672 | 3300028716 | Soil | GLLLAALVGVGIARYYVLVTWATVVALWNYVRRGVPTTWDVAEGTR |
| Ga0247825_100175131 | 3300028812 | Soil | AAGIPIARYYTYVTWATVQALRNYLRHGVAAAWDPAATR |
| Ga0247825_102185911 | 3300028812 | Soil | LGVGIARYYVLITWATVVALANYLRRGVPATWQVAEGTR |
| Ga0302291_102450561 | 3300028865 | Fen | LAFVARVSIARYYVYITWATVQALVNYLRRGVPATWEAAEGTR |
| Ga0299907_105505553 | 3300030006 | Soil | WLAAAAAGVGIARYTVLVNWATVVALWNYLRRGVPATWKVAEGTR |
| Ga0302325_103255454 | 3300031234 | Palsa | SIARYYLLITLATGVALVNYLRRGVPATWKVAEGTR |
| Ga0302324_1025622151 | 3300031236 | Palsa | SIARYYVLISWATVVALVNYVRRGVPATWKAAEGLR |
| Ga0265328_100955071 | 3300031239 | Rhizosphere | AAALFGVGIARYYVLVTWATVESLFNYVRHGVPATWEIAEGTR |
| (restricted) Ga0255312_11215311 | 3300031248 | Sandy Soil | QLGVLAAALVGVGLPRYYVLVTWATVQSLFNYIRHGVPATWDAAEGTR |
| Ga0265339_105187491 | 3300031249 | Rhizosphere | AAFGVGVARYYVLVTWATVASLVNYLRRGVSVTWEVAEGTR |
| Ga0308175_1018415292 | 3300031938 | Soil | GAALKGVGIARYYVLVTGATAVALGNYLRRGVPATWQPAEGTR |
| Ga0308174_110757131 | 3300031939 | Soil | VLGLQLGVLLAAALGVGLPRYYVLVTWATVVALWNYLRRGVPATWELAEGPR |
| Ga0308176_128023062 | 3300031996 | Soil | VGLPRYYVLITWATVAALWNYARKGVPSTWEAAEGTR |
| Ga0310890_116816102 | 3300032075 | Soil | ALLGQLALAAAFAARVPIARYYVYVTWATVQALWNYARRGVPAAWDPAATR |
| Ga0335085_102723532 | 3300032770 | Soil | GVGVARYYVLVTWATLESLVNYVRRGVPATWDAAEGTR |
| Ga0335070_106682202 | 3300032829 | Soil | GVGVARYYVLVTWATLESLFNYARRGVPATWDAAEGTR |
| Ga0335070_111987091 | 3300032829 | Soil | ALGLQLGLLAAAAVGVGVARYYVLVTWATLEALVKYLRRGVPTTWEAAEGTR |
| Ga0335081_121093792 | 3300032892 | Soil | LAAAAVGVGVPRYYVLVTWATLESLFNYVRRGVPVTWEAAEGTR |
| Ga0335081_125577001 | 3300032892 | Soil | YPVALGLQLGVLAAAAVGVGVPRYYVLVTWATLESLFNYVRRGVPTTWEAAEGTR |
| Ga0335069_127672601 | 3300032893 | Soil | ALGLQLGLLAAAAVGVGVARYYVLVTWATLESLVNYVRRGVPATWDAAEGTR |
| Ga0335077_106309522 | 3300033158 | Soil | VARYYVLVTWATLESLVNYVRRGVPATWDAAEGTR |
| Ga0247829_100278756 | 3300033550 | Soil | ALLGQLAVLAAFAAGIPIARYYTYVTWATVQALWNYLRHGVAAAWDPAATR |
| Ga0314866_048341_2_157 | 3300033807 | Peatland | LGLQLGVLAAAAVGVGLPRYYVLVTWATLESLFNYVRRGVPATWEAAEGTR |
| ⦗Top⦘ |