| Basic Information | |
|---|---|
| Family ID | F092926 |
| Family Type | Metagenome |
| Number of Sequences | 107 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MTPAITLEELLAWNQESSDFWKAHLDANPALLELPCGIGGNA |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.10 % |
| % of genes near scaffold ends (potentially truncated) | 97.20 % |
| % of genes from short scaffolds (< 2000 bps) | 84.11 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (67.290 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog (30.841 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.056 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (36.449 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.71% β-sheet: 0.00% Coil/Unstructured: 64.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF02843 | GARS_C | 73.83 |
| PF02844 | GARS_N | 11.21 |
| PF01715 | IPPT | 4.67 |
| PF07992 | Pyr_redox_2 | 3.74 |
| PF01745 | IPT | 0.93 |
| PF13701 | DDE_Tnp_1_4 | 0.93 |
| PF05163 | DinB | 0.93 |
| PF12706 | Lactamase_B_2 | 0.93 |
| PF04295 | GD_AH_C | 0.93 |
| PF13476 | AAA_23 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0151 | Phosphoribosylamine-glycine ligase | Nucleotide transport and metabolism [F] | 85.05 |
| COG0324 | tRNA A37 N6-isopentenylltransferase MiaA | Translation, ribosomal structure and biogenesis [J] | 4.67 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.93 |
| COG2721 | Altronate dehydratase | Carbohydrate transport and metabolism [G] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.29 % |
| Unclassified | root | N/A | 32.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001401|JGI20189J14885_1007995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1788 | Open in IMG/M |
| 3300005345|Ga0070692_10156733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1301 | Open in IMG/M |
| 3300005614|Ga0068856_100038918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 4669 | Open in IMG/M |
| 3300005921|Ga0070766_11018870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 570 | Open in IMG/M |
| 3300009628|Ga0116125_1035160 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
| 3300009635|Ga0116117_1093190 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300009638|Ga0116113_1104567 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300009645|Ga0116106_1077257 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300009759|Ga0116101_1129631 | Not Available | 605 | Open in IMG/M |
| 3300010343|Ga0074044_10678775 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300010399|Ga0134127_10045846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3592 | Open in IMG/M |
| 3300013104|Ga0157370_11826192 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300014153|Ga0181527_1220227 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300014153|Ga0181527_1383001 | Not Available | 540 | Open in IMG/M |
| 3300014167|Ga0181528_10822244 | Not Available | 523 | Open in IMG/M |
| 3300014168|Ga0181534_10407834 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300014168|Ga0181534_10745271 | Not Available | 575 | Open in IMG/M |
| 3300014199|Ga0181535_10504548 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300014200|Ga0181526_10414895 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300014495|Ga0182015_10628551 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300014655|Ga0181516_10472923 | Not Available | 642 | Open in IMG/M |
| 3300014657|Ga0181522_10746052 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300017988|Ga0181520_10554965 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300018022|Ga0187864_10273066 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300018023|Ga0187889_10301447 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300018033|Ga0187867_10707199 | Not Available | 549 | Open in IMG/M |
| 3300018035|Ga0187875_10539848 | Not Available | 617 | Open in IMG/M |
| 3300018035|Ga0187875_10544355 | Not Available | 614 | Open in IMG/M |
| 3300018038|Ga0187855_10847698 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300018044|Ga0187890_10489801 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300018046|Ga0187851_10560145 | Not Available | 647 | Open in IMG/M |
| 3300018047|Ga0187859_10658968 | Not Available | 593 | Open in IMG/M |
| 3300018057|Ga0187858_10418809 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300019082|Ga0187852_1411840 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300021170|Ga0210400_10910018 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300021404|Ga0210389_10958573 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300022863|Ga0224532_1040659 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300023088|Ga0224555_1031061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2259 | Open in IMG/M |
| 3300023091|Ga0224559_1052133 | Not Available | 1614 | Open in IMG/M |
| 3300024295|Ga0224556_1052368 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300025612|Ga0208691_1060114 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300026142|Ga0207698_10835107 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300028068|Ga0255355_1012256 | Not Available | 1999 | Open in IMG/M |
| 3300028087|Ga0255354_1041417 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300028566|Ga0302147_10087042 | Not Available | 1077 | Open in IMG/M |
| 3300028572|Ga0302152_10260162 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300028762|Ga0302202_10052817 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2616 | Open in IMG/M |
| 3300028765|Ga0302198_10032329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3464 | Open in IMG/M |
| 3300028788|Ga0302189_10025347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3299 | Open in IMG/M |
| 3300028813|Ga0302157_10193115 | Not Available | 1173 | Open in IMG/M |
| 3300028866|Ga0302278_10451574 | Not Available | 557 | Open in IMG/M |
| 3300028873|Ga0302197_10129506 | Not Available | 1237 | Open in IMG/M |
| 3300028873|Ga0302197_10482708 | Not Available | 542 | Open in IMG/M |
| 3300028882|Ga0302154_10314636 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300029882|Ga0311368_10309730 | Not Available | 1193 | Open in IMG/M |
| 3300029883|Ga0311327_10324949 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300029883|Ga0311327_10814612 | Not Available | 544 | Open in IMG/M |
| 3300029908|Ga0311341_10655053 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300029908|Ga0311341_10675189 | Not Available | 577 | Open in IMG/M |
| 3300029913|Ga0311362_10271963 | Not Available | 1809 | Open in IMG/M |
| 3300029914|Ga0311359_10901944 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300029916|Ga0302148_1166767 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300029917|Ga0311326_10080669 | Not Available | 1828 | Open in IMG/M |
| 3300029922|Ga0311363_10092702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 4214 | Open in IMG/M |
| 3300029922|Ga0311363_10253049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2044 | Open in IMG/M |
| 3300029945|Ga0311330_11068197 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300029954|Ga0311331_11476451 | Not Available | 556 | Open in IMG/M |
| 3300029985|Ga0302280_1276790 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300029990|Ga0311336_11138184 | Not Available | 680 | Open in IMG/M |
| 3300030007|Ga0311338_11320839 | Not Available | 676 | Open in IMG/M |
| 3300030041|Ga0302274_10392713 | Not Available | 621 | Open in IMG/M |
| 3300030045|Ga0302282_1206054 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300030049|Ga0302191_10124195 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300030051|Ga0302195_10374374 | Not Available | 620 | Open in IMG/M |
| 3300030399|Ga0311353_11503134 | Not Available | 546 | Open in IMG/M |
| 3300030506|Ga0302194_10010190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5479 | Open in IMG/M |
| 3300030506|Ga0302194_10202266 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300030507|Ga0302192_10014638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 4606 | Open in IMG/M |
| 3300030507|Ga0302192_10199164 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300030519|Ga0302193_10023992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4291 | Open in IMG/M |
| 3300030617|Ga0311356_12027937 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300030688|Ga0311345_10600787 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300030739|Ga0302311_10282493 | Not Available | 1213 | Open in IMG/M |
| 3300031236|Ga0302324_102393194 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300031241|Ga0265325_10269529 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300031242|Ga0265329_10087023 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300031247|Ga0265340_10019293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3511 | Open in IMG/M |
| 3300031258|Ga0302318_10368615 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300031259|Ga0302187_10294740 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300031708|Ga0310686_108936159 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300031708|Ga0310686_110870034 | Not Available | 1662 | Open in IMG/M |
| 3300031712|Ga0265342_10326230 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300031788|Ga0302319_10017834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 12976 | Open in IMG/M |
| 3300031902|Ga0302322_100164917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2388 | Open in IMG/M |
| 3300031902|Ga0302322_101608090 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300031918|Ga0311367_11292583 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300032515|Ga0348332_14282275 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300032677|Ga0316227_1253289 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300033158|Ga0335077_11342482 | Not Available | 692 | Open in IMG/M |
| 3300033402|Ga0326728_10890735 | Not Available | 632 | Open in IMG/M |
| 3300033405|Ga0326727_10071702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 4983 | Open in IMG/M |
| 3300033561|Ga0371490_1053167 | Not Available | 1192 | Open in IMG/M |
| 3300033818|Ga0334804_080786 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300034091|Ga0326724_0285308 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300034282|Ga0370492_0448942 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 30.84% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 11.21% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 9.35% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 7.48% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 6.54% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 5.61% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.61% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 3.74% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 3.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.93% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.93% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.93% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.93% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001401 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 deep-072012 | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300022863 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 1-5 | Environmental | Open in IMG/M |
| 3300023088 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34 | Environmental | Open in IMG/M |
| 3300023091 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34 | Environmental | Open in IMG/M |
| 3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028068 | Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T75 | Environmental | Open in IMG/M |
| 3300028087 | Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T50 | Environmental | Open in IMG/M |
| 3300028566 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300028572 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300028762 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028765 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300028783 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028813 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028873 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300028882 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029908 | II_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029916 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_1 | Environmental | Open in IMG/M |
| 3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029985 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_1 | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300030045 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_3 | Environmental | Open in IMG/M |
| 3300030049 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_1 | Environmental | Open in IMG/M |
| 3300030051 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030506 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_1 | Environmental | Open in IMG/M |
| 3300030507 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300030519 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_3 | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Host-Associated | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
| 3300031259 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032677 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18019 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033561 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fraction | Environmental | Open in IMG/M |
| 3300033818 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-M | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI20189J14885_10079953 | 3300001401 | Arctic Peat Soil | MSVGITFEEMLAWSNQASDYWKAHLDANPNLLDLPCGIGGAKNVQE |
| Ga0070692_101567331 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | VDVGISLKELLAWNEEVADFWKAHLDANPHLLELPCDIGGTKNVQE |
| Ga0068856_1000389186 | 3300005614 | Corn Rhizosphere | VDVGISLKELLAWNEEVADFWKAHLDANPHLLELPCDIGG |
| Ga0070766_110188702 | 3300005921 | Soil | MRMTQGLSLEELLAWNEEASAFWKAHFEANPELLQLPCDIGGNKTVQE |
| Ga0116125_10351601 | 3300009628 | Peatland | MTVGTTLEELLAWNRESAHFWNGHFVANPALLELPCGIGGT |
| Ga0116117_10931902 | 3300009635 | Peatland | MTPVITHQELLVWSQEASRFWKAHLDANPDLLELPCDIGGSANVQ |
| Ga0116113_11045672 | 3300009638 | Peatland | MTVAISLEELLIWNEESSAFWKGLLEDNPSLLQLPCGI |
| Ga0116106_10772571 | 3300009645 | Peatland | MSVGISLEELLAWNEQSAAWWKTHLETNPALLELPCDIGGT |
| Ga0116101_11296311 | 3300009759 | Peatland | MSVGISLEELLAWNEQSAAYWKTHLETNPALLELPCDI |
| Ga0074044_106787752 | 3300010343 | Bog Forest Soil | MTPAITLEELLTWNQESSDFWKAHLDANPALLELPC |
| Ga0134127_100458465 | 3300010399 | Terrestrial Soil | VDVGISLKELLAWNEEVADFWKAHLDANPHLLELPCDIGGTKNVQ |
| Ga0157370_118261921 | 3300013104 | Corn Rhizosphere | MSVGITLAELLAWNDEASSHWKIHLDANGSLLDLPCDIGGAKT |
| Ga0181527_12202272 | 3300014153 | Bog | MTPAITLEELLAWNQESSNFWKAHLDANPALLELPCD |
| Ga0181527_13830012 | 3300014153 | Bog | MSVGISLEELLAWNEQSAAYWKTHLETNPTLLELPCD |
| Ga0181528_108222442 | 3300014167 | Bog | MSVGITLEELVAWNEQSSDYWKAHLETNPALLELPCDIGGTANVQGFVR |
| Ga0181534_104078342 | 3300014168 | Bog | MSVAISLEELLAWNQEASNWWKAHLDANPTLLELPCGIGGTA |
| Ga0181534_107452712 | 3300014168 | Bog | MTPAITLEELLKWTEESAAWWKAHLEANPALLDLPCGIGG |
| Ga0181535_105045481 | 3300014199 | Bog | MSVGITLEELLVWCQDSSAYWKAHLDANPALLELPCDIGGTANVQG |
| Ga0181526_104148952 | 3300014200 | Bog | VTVGISLEELLAWNEQSAAYWKTHLEMNPALLELPCDIGGTAT |
| Ga0182015_106285512 | 3300014495 | Palsa | MTPAISFEELLVWNQESADFWKAHFEANPALLELPCGIGGTAT |
| Ga0181516_104729231 | 3300014655 | Bog | MSAGITLEELLAWNDEVARYWKAHLDANPNLLALPCDIGPATNVQE |
| Ga0181522_107460521 | 3300014657 | Bog | MTPAITIEELQAWNQETAKFWKEHLEANPALLELPCGVGGAAN |
| Ga0181520_105549651 | 3300017988 | Bog | MSVGITLEELLAWNEQASDYWKTHLETNPALLDLPCDIGGTANAQG |
| Ga0187864_102730662 | 3300018022 | Peatland | MTPAITLDELLAWNHESAAFWKAHLEANPALLELPCGISGTAN |
| Ga0187889_103014472 | 3300018023 | Peatland | MSLAISLEELLAWNQESSNFWKAHLEANPALLELPCDIGGTANVLEFAG |
| Ga0187867_107071992 | 3300018033 | Peatland | MTPAITLDELLAWNHESAAFWKAHLEANPALLELPCGISG |
| Ga0187875_105398481 | 3300018035 | Peatland | MMTHGVSLEELLAWNDEASAFWKAHLEANPALLQLPCDIGGTANVQD |
| Ga0187875_105443552 | 3300018035 | Peatland | MSVGITLEELVAWNEQSSDYWKAHLETNPALLELPCDIGGTAN |
| Ga0187855_108476981 | 3300018038 | Peatland | VTVGISLEELLAWNEQSAAYWKTHLEMNPALLELPCDI |
| Ga0187887_107284031 | 3300018043 | Peatland | MSVGVSMKELLIWNNEASEFWKAHLEANPGLLELK |
| Ga0187890_104898012 | 3300018044 | Peatland | MSVGITLEELLAWNDEAARYWKAHLEANPHLLALPCDIGPATSVQ |
| Ga0187851_105601452 | 3300018046 | Peatland | MSVGISLEELLAWNEQSAAYWKTHLETNPALLELP |
| Ga0187859_106589682 | 3300018047 | Peatland | MSVGITLEELLAWNDQSAASWKTHLETNPALLELPC |
| Ga0187858_104188092 | 3300018057 | Peatland | MSVGISLEELLAWNEQSAAWWKTHLETNPALLELPCDIGGTA |
| Ga0187852_14118401 | 3300019082 | Peatland | MTPAITMQELLVWSQESSGFWNEHLKANPALLQLPCGIG |
| Ga0210400_109100181 | 3300021170 | Soil | VTPAITLEELFAWNQETSTFWKGFLEDNLAVLEQPCDIGGVLTVQQFV |
| Ga0210389_109585731 | 3300021404 | Soil | MTPALTLEELLHWNDEASRWWKAHLGANLGLLELPCDI |
| Ga0224532_10406591 | 3300022863 | Soil | MTAAITLAELLAWNQEASNFWKAHLEANPALLELP |
| Ga0224555_10310614 | 3300023088 | Soil | MSAAITLEELLAWNDEAARYWKSHLEANPHLLALPCDIGPAKNVQEFV |
| Ga0224559_10521331 | 3300023091 | Soil | MTIAISLEELLAWNRESSNFWKLHLDANPALLQLPCGIGGTANV |
| Ga0224556_10523681 | 3300024295 | Soil | MTHAVSMEELLTWNDEASTFWKAHLDANPALLQLPCGIGG |
| Ga0208691_10601141 | 3300025612 | Peatland | MTPAITLEELLAWNEEVSRFWKVHLDANPALLELPCGIGGNVDVQ |
| Ga0207698_108351071 | 3300026142 | Corn Rhizosphere | VDVGISLKELLAWNEEVADFWKAHLDANPHLLELPCDIGGDE |
| Ga0255355_10122561 | 3300028068 | Soil | MTTAISLEELLAWNRESSNFWKLHLDANPALLQLPCGIGGTANVQ |
| Ga0255354_10414172 | 3300028087 | Soil | MTAAITLNELLAWNQEASDFWKAHLEANPALLELPCGIGGT |
| Ga0302147_100870421 | 3300028566 | Bog | MTVGITMEELLAWNNESAGFWKAHLEANPALLELPCGIGGTANV |
| Ga0302152_102601621 | 3300028572 | Bog | MTPAITLEELLAWNDEASKFWKAHLDANPALLALPCGIGGA |
| Ga0302202_100528174 | 3300028762 | Bog | MSVGITLEELLAWNDEAARYWKAHLEANPHLLALPCDIGPATSVQE |
| Ga0302198_100323294 | 3300028765 | Bog | MTSAISMEELLAWSEESAAFWKAHLEANPALLELPCGIGGTANVQ |
| Ga0302279_102120801 | 3300028783 | Bog | MTPAITLEELLAWDQEASSFWKTWLDANPAVLELPCDIGRAKSVQEF |
| Ga0302189_100253471 | 3300028788 | Bog | MTIGITLEELLAWNNESAGFWKAHLEANPSLLELPCGIGGTAN |
| Ga0302157_101931151 | 3300028813 | Bog | MSLAISIEELLAWNDEASAWWKTHLEANQALLELPCGIGGAPTV |
| Ga0302278_104515741 | 3300028866 | Bog | MTAAVTLAELLAWNQESSNFWKAHLEANPALLALPCGIGGT |
| Ga0302197_101295062 | 3300028873 | Bog | VTPAITLEELLAWSCQNSAWWKAHFDANPALLELPCDINRGS |
| Ga0302197_104827081 | 3300028873 | Bog | MTPAITLEELVAWDHESAVFWKTYLEANQALLRLPCGIGGAMDVQEF |
| Ga0302154_103146361 | 3300028882 | Bog | MTPAITLEELLTWNKEASNFWKTHLDANPALLELPCGIGGAANV |
| Ga0311368_103097301 | 3300029882 | Palsa | MTPAITLEELLAWNQESSDFWKAHLDANPALLELPCGIGGNA |
| Ga0311327_103249492 | 3300029883 | Bog | MTPAITLEELLTWNKEASNFWKTHLDANPALLELPCGIG |
| Ga0311327_108146121 | 3300029883 | Bog | MSVGISLTELLVWNDEASQFWKAHLDANPQVLPLPCDIGSAT |
| Ga0311341_106550531 | 3300029908 | Bog | MSAAISMQELLVWNQEASNWWKAHLDTNPALLELPCGIGGTANV |
| Ga0311341_106751891 | 3300029908 | Bog | MTAAITLNELLAWNQEASDFWKAHLEANPALLELPCGIGGTV |
| Ga0311362_102719631 | 3300029913 | Bog | VSVGITLEELLAWNDEAAIVWKNHLDINPALLDAACDIGG |
| Ga0311359_109019441 | 3300029914 | Bog | MSTVAGVSLEELLAWSQESASFWKSHLDANPALLELPCS |
| Ga0302148_11667671 | 3300029916 | Bog | MTPAITLNELLAWNQQSSNFWKAHLEANPALLELPCGIGGAA |
| Ga0311326_100806691 | 3300029917 | Bog | MSAAITLEELLAWNDEAARYWKSHLEANPHLLALPCDIGPAKNV |
| Ga0311363_100927021 | 3300029922 | Fen | MTPAITLEELLGWNQQSSVFWKAWLDANPAALALPCDIDRTTNVQE |
| Ga0311363_102530491 | 3300029922 | Fen | MTPAITLEELLTWNEEASNFWKAHLDANPALLELPCGI |
| Ga0311330_110681971 | 3300029945 | Bog | MTAAITLEELLAWNEESSAFWKGHLEANPGLLELPCDIGGTKTVQ |
| Ga0311331_114764512 | 3300029954 | Bog | MSVGITLEELLVWCQDSSAYWKAHLDANPALLELP |
| Ga0302280_12767901 | 3300029985 | Fen | MTPAITLEELLAWNRESADFWKAHFDANPALLALPCG |
| Ga0311336_111381841 | 3300029990 | Fen | MSTGITLQELLAWNQEASNFWKAHFDSNPHLLELACGIGG |
| Ga0311338_113208391 | 3300030007 | Palsa | VNLAITVEEFLAWSDEASTWWKTHLDANPALLELPCG |
| Ga0302274_103927131 | 3300030041 | Bog | MSVAVTLEELSRWNQETSAFWNQHLDANPTLLELPCDI |
| Ga0302282_12060541 | 3300030045 | Fen | MTPAITLEELLIWNQESSNFWKAHLDANPALLELPCGIGGAAN |
| Ga0302191_101241951 | 3300030049 | Bog | MTAAITLNELLAWNQEASDFWKAHLEANPALLELPCGI |
| Ga0302195_103743742 | 3300030051 | Bog | MTPAITLEELLVWNQETSSFWKTWLDANPAVLELPCDIGRAKSVQEF |
| Ga0311353_115031341 | 3300030399 | Palsa | MATGITLEELMGWSEEAAEFWKDHLEANPALLELPCGIGGTANV |
| Ga0302194_100101906 | 3300030506 | Bog | MTIGITLEELLAWNNESAGFWKAHLEANPSLLELPCGIGG |
| Ga0302194_102022661 | 3300030506 | Bog | MTPAITLEELLAWSDEASNFWKAHLDANPALLEPP |
| Ga0302192_100146386 | 3300030507 | Bog | MTPAITLNELLAWNQQSSNFWKAHLEANPALLELPCG |
| Ga0302192_101991641 | 3300030507 | Bog | MSVAISMQELLVWNQEASNWWKAHLDTNPALLELP |
| Ga0302193_100239921 | 3300030519 | Bog | MTPAITLEELLAWSDEASNFWKVHLDANPALLEPPCGIGES |
| Ga0311356_120279372 | 3300030617 | Palsa | MTIGITLEELLAWNQESANFWKAHLEANPTLLELPCGIGGTANVQEL |
| Ga0311345_106007871 | 3300030688 | Bog | MTPAISLDELLAWSQESSRFWKEHFDANPVLLELPCSIDNSGTVLGL |
| Ga0302311_102824931 | 3300030739 | Palsa | MTHGISLEELLDWNEEVSAFWKAHFETSPALLQLPCGI |
| Ga0302324_1023931941 | 3300031236 | Palsa | MATGITLEELMGWSEEAAEFWKDHLEANPALLELPCGIGGT |
| Ga0265325_102695291 | 3300031241 | Rhizosphere | MSAGITLRELLVWNQEASNFWNAHFNANPHLLELECGIGGAATV |
| Ga0265329_100870232 | 3300031242 | Rhizosphere | MTPAITLEELLAWNHESAAFWKAHLEANLSLLELPCDIGGTASV |
| Ga0265340_100192931 | 3300031247 | Rhizosphere | MCVGITLQELLAWNRESSRFWKDHLDANPHLLALSCDIGGTTN |
| Ga0302318_103686151 | 3300031258 | Bog | MTPAITLEELLTWNKEASNFWKTHLDANPALLELPCGI |
| Ga0302187_102947401 | 3300031259 | Bog | MTPAITLEELLTWNEEASNFWKAHLDANPALLELP |
| Ga0310686_1089361592 | 3300031708 | Soil | LTPAITLEELLTWNQESADFWKAHLDANPVLLELPCGIGGNVHVQAF |
| Ga0310686_1108700343 | 3300031708 | Soil | MTPAITHEELLAWNCESADFWKAHLGANPALLQLPCGIGGN |
| Ga0265342_103262302 | 3300031712 | Rhizosphere | MTPAITFEELLAWNEESSDFWKAHLDANPTLLQMPC |
| Ga0302319_100178341 | 3300031788 | Bog | MTPAITLDELLAWSCQSSNFWKAHLDANPALLALPCGIGGA |
| Ga0302322_1001649171 | 3300031902 | Fen | MIPAISLEELLVWNDEASQFWKRHLEANPALLALPCEIGGTA |
| Ga0302322_1016080901 | 3300031902 | Fen | MTPAITLEELLGWNQEAALFWKEHLEANPALLELPCDIGDTK |
| Ga0311367_112925832 | 3300031918 | Fen | MIPAISLEELLVWNDEASQFWKRHLEANPALLALPCEIGGTAN |
| Ga0348332_142822751 | 3300032515 | Plant Litter | VTPAITFEGVFAWSDEASRFWKAHLDANPSLLELPSGIGGTATVQSW |
| Ga0316227_12532892 | 3300032677 | Freshwater | MTPAITIEELLAWNQESAGFWKSHLEANPALLELPCDI |
| Ga0335077_113424822 | 3300033158 | Soil | MSVGITLEELLAWNVDSSNYWKAYFDANPASLELPCDIG |
| Ga0326728_108907351 | 3300033402 | Peat Soil | MSVGNTLDELLAWNEQSANYWKTHFDANPALLGLTCEIGG |
| Ga0326727_100717025 | 3300033405 | Peat Soil | MSVGITLEELLAWNEQSSDYWKTHLETNPALLELPCDIGGTST |
| Ga0371490_10531671 | 3300033561 | Peat Soil | MSVGITLEELLAWNEQSAAYWKTHLATNPALLELPCDIGGTA |
| Ga0334804_080786_2_121 | 3300033818 | Soil | MTPAITLEELLTWNKEASNFWKTHLDANPALLELPCGIGG |
| Ga0326724_0285308_821_925 | 3300034091 | Peat Soil | MSVGISLEELLAWHEQSAAWWKTHLETNPALLELP |
| Ga0370492_0448942_403_522 | 3300034282 | Untreated Peat Soil | MTPAITLEELLAWNQETSSFWKTWLDANPAALELPCDIGR |
| ⦗Top⦘ |