| Basic Information | |
|---|---|
| Family ID | F092925 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 43 residues |
| Representative Sequence | SQTVEVKGPLGPLLGGMLGPQVSKEFGTLLGNLAKKAEAT |
| Number of Associated Samples | 82 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.87 % |
| % of genes near scaffold ends (potentially truncated) | 95.33 % |
| % of genes from short scaffolds (< 2000 bps) | 82.24 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (28.972 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.776 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.075 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.65% β-sheet: 0.00% Coil/Unstructured: 57.35% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF12802 | MarR_2 | 31.78 |
| PF04264 | YceI | 10.28 |
| PF13460 | NAD_binding_10 | 3.74 |
| PF00005 | ABC_tran | 3.74 |
| PF01738 | DLH | 3.74 |
| PF01048 | PNP_UDP_1 | 2.80 |
| PF00072 | Response_reg | 1.87 |
| PF00892 | EamA | 0.93 |
| PF13649 | Methyltransf_25 | 0.93 |
| PF00211 | Guanylate_cyc | 0.93 |
| PF14417 | MEDS | 0.93 |
| PF13796 | Sensor | 0.93 |
| PF00271 | Helicase_C | 0.93 |
| PF03551 | PadR | 0.93 |
| PF16884 | ADH_N_2 | 0.93 |
| PF07722 | Peptidase_C26 | 0.93 |
| PF09900 | DUF2127 | 0.93 |
| PF12730 | ABC2_membrane_4 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 10.28 |
| COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 2.80 |
| COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 2.80 |
| COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 2.80 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.93 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.93 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.93 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001401|JGI20189J14885_1022355 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300001538|A10PFW1_10360216 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300005172|Ga0066683_10069222 | All Organisms → cellular organisms → Bacteria | 2109 | Open in IMG/M |
| 3300005174|Ga0066680_10551133 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300005175|Ga0066673_10198602 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300005177|Ga0066690_10265277 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300005181|Ga0066678_10057141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2242 | Open in IMG/M |
| 3300005187|Ga0066675_10294881 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300005187|Ga0066675_10521151 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300005467|Ga0070706_100756036 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300005468|Ga0070707_101016392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 794 | Open in IMG/M |
| 3300005471|Ga0070698_101674502 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300005471|Ga0070698_101911107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_66_12 | 546 | Open in IMG/M |
| 3300005546|Ga0070696_101443824 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300005555|Ga0066692_10780930 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300005557|Ga0066704_10055059 | All Organisms → cellular organisms → Bacteria | 2522 | Open in IMG/M |
| 3300005557|Ga0066704_10684473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 648 | Open in IMG/M |
| 3300005557|Ga0066704_10779151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 596 | Open in IMG/M |
| 3300005558|Ga0066698_10730429 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300005559|Ga0066700_10733329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium | 673 | Open in IMG/M |
| 3300005563|Ga0068855_102385059 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300005980|Ga0066798_10202883 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300005994|Ga0066789_10462733 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300006041|Ga0075023_100056297 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300006041|Ga0075023_100111173 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300006041|Ga0075023_100165547 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300006057|Ga0075026_100541477 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300006794|Ga0066658_10766893 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300006800|Ga0066660_10081232 | All Organisms → cellular organisms → Bacteria | 2234 | Open in IMG/M |
| 3300006903|Ga0075426_10436584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 968 | Open in IMG/M |
| 3300009089|Ga0099828_10047430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3550 | Open in IMG/M |
| 3300009089|Ga0099828_10573770 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300009660|Ga0105854_1268411 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300010304|Ga0134088_10044389 | All Organisms → cellular organisms → Bacteria | 2032 | Open in IMG/M |
| 3300010337|Ga0134062_10484637 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300010361|Ga0126378_12054647 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300011971|Ga0120175_1022018 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300012096|Ga0137389_10054924 | All Organisms → cellular organisms → Bacteria | 3023 | Open in IMG/M |
| 3300012096|Ga0137389_10559801 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300012189|Ga0137388_10151798 | All Organisms → cellular organisms → Bacteria | 2052 | Open in IMG/M |
| 3300012202|Ga0137363_10016256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4888 | Open in IMG/M |
| 3300012202|Ga0137363_10733746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_66_12 | 837 | Open in IMG/M |
| 3300012205|Ga0137362_11103697 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300012208|Ga0137376_10028197 | All Organisms → cellular organisms → Bacteria | 4428 | Open in IMG/M |
| 3300012211|Ga0137377_11449382 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300012285|Ga0137370_10203492 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
| 3300012285|Ga0137370_10256376 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300012349|Ga0137387_10376955 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300012351|Ga0137386_10124594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1834 | Open in IMG/M |
| 3300012351|Ga0137386_10180205 | All Organisms → cellular organisms → Bacteria | 1515 | Open in IMG/M |
| 3300012356|Ga0137371_10047493 | All Organisms → cellular organisms → Bacteria | 3318 | Open in IMG/M |
| 3300012357|Ga0137384_10139994 | All Organisms → cellular organisms → Bacteria | 2025 | Open in IMG/M |
| 3300012362|Ga0137361_10109526 | All Organisms → cellular organisms → Bacteria | 2417 | Open in IMG/M |
| 3300012362|Ga0137361_10910364 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300012363|Ga0137390_10900712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_66_12 | 839 | Open in IMG/M |
| 3300012363|Ga0137390_10996046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_66_12 | 790 | Open in IMG/M |
| 3300012363|Ga0137390_11305598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_66_12 | 671 | Open in IMG/M |
| 3300012363|Ga0137390_11426461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 636 | Open in IMG/M |
| 3300012392|Ga0134043_1116378 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300012917|Ga0137395_11116859 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300012918|Ga0137396_10572400 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300012918|Ga0137396_11131380 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300012923|Ga0137359_10802222 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300012972|Ga0134077_10529441 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300013503|Ga0120127_10090406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 673 | Open in IMG/M |
| 3300014052|Ga0120109_1001933 | All Organisms → cellular organisms → Bacteria | 4846 | Open in IMG/M |
| 3300014052|Ga0120109_1067280 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300015054|Ga0137420_1372222 | All Organisms → cellular organisms → Bacteria | 5908 | Open in IMG/M |
| 3300015357|Ga0134072_10215329 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300015359|Ga0134085_10166633 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300016357|Ga0182032_12041834 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300017936|Ga0187821_10435853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 541 | Open in IMG/M |
| 3300018054|Ga0184621_10106541 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300018431|Ga0066655_10059898 | All Organisms → cellular organisms → Bacteria | 1998 | Open in IMG/M |
| 3300018431|Ga0066655_10481911 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300018468|Ga0066662_10817175 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300020579|Ga0210407_11038434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 624 | Open in IMG/M |
| 3300021479|Ga0210410_11522654 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300022691|Ga0248483_113059 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300024283|Ga0247670_1094363 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300025504|Ga0208356_1000034 | All Organisms → cellular organisms → Bacteria | 55234 | Open in IMG/M |
| 3300025544|Ga0208078_1086262 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300026272|Ga0209913_1117536 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300026291|Ga0209890_10283190 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300026325|Ga0209152_10397406 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300026325|Ga0209152_10426955 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300026327|Ga0209266_1231635 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300026327|Ga0209266_1279798 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300026332|Ga0209803_1162334 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300026332|Ga0209803_1328767 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300026333|Ga0209158_1015527 | All Organisms → cellular organisms → Bacteria | 3567 | Open in IMG/M |
| 3300026376|Ga0257167_1015036 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300026538|Ga0209056_10611727 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300026542|Ga0209805_1273678 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300026551|Ga0209648_10091656 | All Organisms → cellular organisms → Bacteria | 2511 | Open in IMG/M |
| 3300026551|Ga0209648_10124440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Thermosporotrichaceae → Thermosporothrix → Thermosporothrix hazakensis | 2074 | Open in IMG/M |
| 3300027565|Ga0209219_1016732 | All Organisms → cellular organisms → Bacteria | 1767 | Open in IMG/M |
| 3300027565|Ga0209219_1020477 | All Organisms → cellular organisms → Bacteria | 1615 | Open in IMG/M |
| 3300027587|Ga0209220_1025189 | All Organisms → cellular organisms → Bacteria | 1595 | Open in IMG/M |
| 3300027587|Ga0209220_1111636 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300027846|Ga0209180_10120295 | All Organisms → cellular organisms → Bacteria | 1506 | Open in IMG/M |
| 3300027846|Ga0209180_10464772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 712 | Open in IMG/M |
| 3300027882|Ga0209590_10869397 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300028673|Ga0257175_1027896 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300031720|Ga0307469_11452531 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300031753|Ga0307477_10872491 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300032180|Ga0307471_101040775 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 28.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 21.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.61% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 4.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.67% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.74% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 3.74% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.74% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.80% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.80% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.93% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.93% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001401 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 deep-072012 | Environmental | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005980 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009660 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300011971 | Permafrost microbial communities from Nunavut, Canada - A7_80cm_12M | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012392 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300014052 | Permafrost microbial communities from Nunavut, Canada - A23_35cm_12M | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022691 | Soil microbial communities from Calhoun CZO, South Carolina, United States - 60cm depth | Environmental | Open in IMG/M |
| 3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
| 3300025504 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025544 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300026272 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203 (SPAdes) | Environmental | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026376 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-B | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI20189J14885_10223552 | 3300001401 | Arctic Peat Soil | MVEIKGPLGPIMRGMMGPQVSKEFPTLLANLARKAEAG* |
| A10PFW1_103602161 | 3300001538 | Permafrost | VNGPLGPILRGMLGPGVSKEFGTLLANLAKKAETS* |
| Ga0066683_100692221 | 3300005172 | Soil | KISQTVEVGGPLGPVVGGVLGPQVARDFGTLLGNLARKAESS* |
| Ga0066680_105511332 | 3300005174 | Soil | AGAKTKISQMVEVGGPLGPVMGGMLGPQVSKEFGTLLSNLARKAEST* |
| Ga0066673_101986023 | 3300005175 | Soil | SRVGQWVEVKGPLGFLGFMFGPNVSKEFGTLLRNLAKKAEATPPS* |
| Ga0066690_102652773 | 3300005177 | Soil | AGGKTTVGQWVEVKGPLGPVLGGMMGPQVSKEFGTLLTNLAKQAESSQL* |
| Ga0066678_100571411 | 3300005181 | Soil | GKTRISQHVQVKGPLGFLGFMLGPQVSAEFGTLLGNLAKKAEAAS* |
| Ga0066675_102948813 | 3300005187 | Soil | KTKISQTVEVGGPLGPVIGGMLGPQVSRDFGTLLGNLARKAESS* |
| Ga0066675_105211513 | 3300005187 | Soil | QTVEVGGPLGSVLGGMLGPQVSKEFGTLLSNLARKAETT* |
| Ga0070706_1007560361 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | RIGQYVEVKGPLGPIMGGMLGPQVSKEFGTLLGNLARKAEAG* |
| Ga0070707_1010163921 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | IESAGGKTKISQTVEVKGPLGPLLGGMLGPQVSKEFGTLLGNLAKRAESA* |
| Ga0070698_1016745022 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | IGQYVEVKGPLGPILGGMLGPQVSKEFGTLLSNLAKKAEAAS* |
| Ga0070698_1019111071 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | TVGQWVEVKGPLGPIAGGMLGPQVSKEFGTLLGNLAKRAESS* |
| Ga0070696_1014438241 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VGQWVEVKGPLGPVLGGMLGPQVSKEFGILLENLARKAETA* |
| Ga0066692_107809301 | 3300005555 | Soil | KGPLGFLGFMFGPNVSKEFGTLLRNLAKKAESGPPS* |
| Ga0066704_100550591 | 3300005557 | Soil | EPAGAKTKISQTVEVGGPLGPVMGGMLGPQVSKEFGTLLSNLARKAETT* |
| Ga0066704_106844732 | 3300005557 | Soil | RVSQHVEVKGPLGPILGGMLGPQVSKEFGTLLGNLAKKAEAA* |
| Ga0066704_107791512 | 3300005557 | Soil | GKTRISQHVQVKGPLGFLGFMFGPQASSEFGTLLGNLAKKAEAAS* |
| Ga0066698_107304292 | 3300005558 | Soil | QTVEVGGPLGPVMGGMLGPQVSKEFGTLLSNLARKAETT* |
| Ga0066700_107333292 | 3300005559 | Soil | GKTRISQHVQVKGPLGFLGFMFGPQVSAEFGTLLGNLAKKAEAAS* |
| Ga0068855_1023850592 | 3300005563 | Corn Rhizosphere | GQWVEVKGPLGPVLGGMLGPQVSKEFGTLLENLARKAEGG* |
| Ga0066798_102028832 | 3300005980 | Soil | EVKGPLGPILRGMLGPQVSKEFGILLANLAKRAEAA* |
| Ga0066789_104627331 | 3300005994 | Soil | ETKISQTVEVKGPLGFLGGMLGPGVSKEFGTLLSNLAKKAETSDQ* |
| Ga0075023_1000562971 | 3300006041 | Watersheds | TRVSQTVEVGGPLGPVMGRMLGPQVSKEFGTLLTNLAKKAEAA* |
| Ga0075023_1001111731 | 3300006041 | Watersheds | GAAGKTRISQMVEVKGPLGPVMQGILGPQVSKEFGTLLANLARRAEAGS* |
| Ga0075023_1001655471 | 3300006041 | Watersheds | YVEVKGPLGPILGGMLGPQVSKEFGTLLGNLAKKAESA* |
| Ga0075026_1005414772 | 3300006057 | Watersheds | VEVGGALGPVMGGMLGPQVSKEFGTLLANLAKRAEAG* |
| Ga0066658_107668931 | 3300006794 | Soil | TVEVGGPLGPVLGWMLGPQVSREFGTLLSNLARKAETT* |
| Ga0066660_100812325 | 3300006800 | Soil | GGPLGPVMGGMLGPQVSKEFGILLANLARKAETV* |
| Ga0075426_104365841 | 3300006903 | Populus Rhizosphere | PAAGGKTKVGQTVEVGGPLGPVLGGMMGPQVSKEFGTLLSNLARKAESA* |
| Ga0099828_100474306 | 3300009089 | Vadose Zone Soil | VEVKGPLGFLGFMFGPNVSKEFGTLLRNLAKKAEATAPS* |
| Ga0099828_105737701 | 3300009089 | Vadose Zone Soil | KIGQYVEVKGPLGPILGGMLGPQVSKEFGTLLSNLAKKAESA* |
| Ga0105854_12684111 | 3300009660 | Permafrost Soil | GPLGFLRGMLGPGVSKEFGTLLSNLAKKAETSDQ* |
| Ga0134088_100443894 | 3300010304 | Grasslands Soil | AGVKTKISQTVEVGGPLGPVMGGMLGPQVSKEFGTLLSNLARKAETT* |
| Ga0134062_104846371 | 3300010337 | Grasslands Soil | PAGAKTKISQTVEVGGPLGPILGGMLGPQVSREFGTLLSNLARTAETT* |
| Ga0126378_120546471 | 3300010361 | Tropical Forest Soil | KTMVGQWVEVGGPLGPVMGGMLGPQVSKEFGTLLTNLARKAETA* |
| Ga0120175_10220182 | 3300011971 | Permafrost | VGAETKISQTVEIKGPFGFLGGMLGPGVSKEFGTLLSKLAKKAETS* |
| Ga0137389_100549241 | 3300012096 | Vadose Zone Soil | KTKISQMGEGKWPVGPSLGGMLGPEVSKEFGTLLANLARRAEAG* |
| Ga0137389_105598013 | 3300012096 | Vadose Zone Soil | GSRVGQWVEVKGPLGFLGFMFGPNVSKEFGTLLRNLAKKAEATAHS* |
| Ga0137388_101517981 | 3300012189 | Vadose Zone Soil | VEVKGPLGPVLGGMMGPQVSKEFGTLLSNLAKRAEST* |
| Ga0137363_100162561 | 3300012202 | Vadose Zone Soil | RIGSTGGKTTVGQWVEVKGPLGPIMGGMMGPQVSKEFGTLLSNLAKRAESS* |
| Ga0137363_107337461 | 3300012202 | Vadose Zone Soil | RIGSTGGKTTVGQWVEVKGPLGPIMGGMMGPQVSKEFGTLLSNLAKKAEAS* |
| Ga0137362_111036971 | 3300012205 | Vadose Zone Soil | VKGLLGPLLGGMLGPQVSKEFGTLLGNLAKRAEAA* |
| Ga0137376_100281971 | 3300012208 | Vadose Zone Soil | KISQMVEVGGPLGPVMGGMLGPQVSKEFGTLLSNLARKAEST* |
| Ga0137377_114493822 | 3300012211 | Vadose Zone Soil | QWVEVRGPLGPVLGGMMGPQVSKEFGTLLSNLAKKAESS* |
| Ga0137370_102034923 | 3300012285 | Vadose Zone Soil | QWVEVKGPLGFLGFMFGPHVSKEFGTLLRNLAKKAEATPPS* |
| Ga0137370_102563761 | 3300012285 | Vadose Zone Soil | EPAGTKTKISQTVEVGGPLGPVVGGMLGPQVSRDFGTLLGNLARKAESS* |
| Ga0137387_103769553 | 3300012349 | Vadose Zone Soil | GQWVEVKGPLGFLGFMFGPNVSKEFGTLLRNLAKKAESGPPS* |
| Ga0137386_101245943 | 3300012351 | Vadose Zone Soil | KARVSQTVEVKGPLGPVLGGVLGPQVSKEFGTLLSNLARRAEGA* |
| Ga0137386_101802051 | 3300012351 | Vadose Zone Soil | EVGGPLGPILGGMLGPQVSREFGTLLSNLARKAETT* |
| Ga0137371_100474933 | 3300012356 | Vadose Zone Soil | MEPAGTKTKISQTVEVGGPLGPVVGGMLGPQVSRDFGTLLGNLARKAESS* |
| Ga0137384_101399943 | 3300012357 | Vadose Zone Soil | CRIGSEGGKTTVGQWVEVKGPLGSVLGGMMGPQVSKEFGTLLSTLAKRAEST* |
| Ga0137361_101095261 | 3300012362 | Vadose Zone Soil | KISQTVEVKGLLGPLLGGMLGPQVSKEFGTLLGNLAKRAEAT* |
| Ga0137361_109103641 | 3300012362 | Vadose Zone Soil | KISQTVEVKGLLGPLLGGMLGPQVSKEFGTLLGNLAKRAEAA* |
| Ga0137390_109007121 | 3300012363 | Vadose Zone Soil | TTVGQWVEVKGPLGPIMGGMMGPQVSKEFGTLLSNLAKRAEAS* |
| Ga0137390_109960463 | 3300012363 | Vadose Zone Soil | GGKTTVGQWVEVKGPLGPIMGGMMGPQVSKEFGTLLSNLAKRAESS* |
| Ga0137390_113055982 | 3300012363 | Vadose Zone Soil | GGKTTVGQWVEVKGPLGPIMGGMMGPQVSKEFGMLLSNLAKRAESS* |
| Ga0137390_114264611 | 3300012363 | Vadose Zone Soil | EPAGGKTRISQTVEVKGPLGPLLGGMLGPQVSKDFGTLLGNLAKQAEAG* |
| Ga0134043_11163783 | 3300012392 | Grasslands Soil | VEVKGPLGFLGFMFGPNVSKEFGTLLRNLAKKAESGPPS* |
| Ga0137395_111168592 | 3300012917 | Vadose Zone Soil | QTVEVKGPLGPILAPMMGPQVSKEFGTLLANLARNAEAS* |
| Ga0137396_105724001 | 3300012918 | Vadose Zone Soil | SRVGQWVEVKGPLGFLGFMFGPNVSKEFGTLLRNLAKRAEVTP* |
| Ga0137396_111313802 | 3300012918 | Vadose Zone Soil | TVEVRGPLGPIMGGMLGPPVAKDFGTLLSNLARKAETS* |
| Ga0137359_108022221 | 3300012923 | Vadose Zone Soil | IEAVGGETKIGQYVEVKGPLGPILGGLLGPQVSKEFGTLLSNLAKKAESA* |
| Ga0134077_105294412 | 3300012972 | Grasslands Soil | GSRVGQWVEVKGPLGFLGFMFGPNVSKEFGTLLRNLAKKAESGPPS* |
| Ga0120127_100904061 | 3300013503 | Permafrost | VKGPLGFLGGMLGPGVSKDFGTLLSNLAKTAETSHQ* |
| Ga0120109_10019338 | 3300014052 | Permafrost | GKTTISQMVEVKGPLGPILQGMLGPQVSKEFGTLLANLAKRAEAP* |
| Ga0120109_10672802 | 3300014052 | Permafrost | AKTKISQTVEVRGPLGGAMGPMMGPQVSKEFGTLLANLAKEAESA* |
| Ga0137420_13722224 | 3300015054 | Vadose Zone Soil | MVEVKGPLGFLGGMLGPGVAKDFERCWRNLAKKAETA* |
| Ga0134072_102153291 | 3300015357 | Grasslands Soil | TVEVGGPLGPVMGGMLGPQVSKEFGTLLANLARKAETV* |
| Ga0134085_101666331 | 3300015359 | Grasslands Soil | SQTVEVGGPLGPVVGGMLGPQVARDFGTLLGNLARKAESS* |
| Ga0182032_120418341 | 3300016357 | Soil | VEPSSAGKTKVSQTVEVGGPLGPAMGGMLAPQVSKELGTLLYNLAAKAETS |
| Ga0187821_104358531 | 3300017936 | Freshwater Sediment | NVGQWVEVKGPLGPVLGGMLGPQVSREFGTLLKNLAAKAEAAG |
| Ga0184621_101065413 | 3300018054 | Groundwater Sediment | SQTVEVKGPLGFLGGMLGPGVAKDFGALLSNLAKRAETR |
| Ga0066655_100598984 | 3300018431 | Grasslands Soil | QTVEVGGPLGPVLGGMMGPQVSKEFGTLLSNLARKAETT |
| Ga0066655_104819113 | 3300018431 | Grasslands Soil | IEPAGAKTKVSQTVEVGGPLGSVLGGMLGPQVSKEFGTLLSNLARKAETT |
| Ga0066662_108171753 | 3300018468 | Grasslands Soil | GKTKVGQTVEVKGPLGSILGPVMGPQVSKEFGTLLENLTRKAEQSPG |
| Ga0210407_110384342 | 3300020579 | Soil | GRTKISQTVEVKGPLGPLLGGMLGPQVSKEFGTLLGNLAKKAEAA |
| Ga0210410_115226541 | 3300021479 | Soil | ISQMVEVKGPLGPVVQGMMGPQVSKEFGTLLANLARKAEAG |
| Ga0248483_1130592 | 3300022691 | Soil | KTKVSQTVEVHGPLGPIIGGMLGPQVAKDFGTLLSNLARKAETS |
| Ga0247670_10943632 | 3300024283 | Soil | GKTKISQTVEIKGPLGPVMQGMMGPQVSKEFPTLLANLARRSEAG |
| Ga0208356_100003459 | 3300025504 | Arctic Peat Soil | MVEIKGPLGPIMRGMMGPQVSKEFPTLLANLARKAEAG |
| Ga0208078_10862622 | 3300025544 | Arctic Peat Soil | GGEAKIAQYVEVKGPLGPILRRMLGPQVSKEFGILLANLAQRAEAA |
| Ga0209913_11175362 | 3300026272 | Soil | EVKGPLGPILRGMLGPQVSKEFGILLANLAKRAEAA |
| Ga0209890_102831901 | 3300026291 | Soil | EVKGPLGFLGGMLGPGVSKEFGTLLSNLAKKAETSDQ |
| Ga0209152_103974062 | 3300026325 | Soil | TVEVGGPLGPVLGWMLGPQVSREFGTLLSNLARKAETT |
| Ga0209152_104269552 | 3300026325 | Soil | GAKTKISQTVEIGGPLGPVMGGMLGPQVSKEFGTLLANLARKAETV |
| Ga0209266_12316352 | 3300026327 | Soil | SQTVEVGGPLGPILGGMLGPQVSREFGTLLSNLARTAETT |
| Ga0209266_12797982 | 3300026327 | Soil | GGKTKVGQTVEVGGPLGPVLGGMLGPQVSKEFGTLLSNLARKAETT |
| Ga0209803_11623341 | 3300026332 | Soil | EVGGPLGPVMGGMIGPQVSKEFGTLLSNLAQKAESA |
| Ga0209803_13287672 | 3300026332 | Soil | GAKTKISQTVEVGGPLGPVMGGMLGPQVSKEFGTLLANLARKADRLAHIR |
| Ga0209158_10155271 | 3300026333 | Soil | GSAGGRTTVGQWVEVKGPLGPVLGGMLGPQVSKEFGTLLTNLARKAEAG |
| Ga0257167_10150361 | 3300026376 | Soil | SAGGKTTVGQWVEVKGPLGPIMGGMMGPQVSKEFGTLLSNLAKKAEAS |
| Ga0209056_106117271 | 3300026538 | Soil | SGSRVGQWVEVKGPLGFLGFMFGPNVSKEFGTLLRNLAKKAEATPPS |
| Ga0209805_12736781 | 3300026542 | Soil | EPAGAKTKVSQTVEVGGPLGGVMGGMLGPQVSKEFGTLLANLARKAESV |
| Ga0209648_100916561 | 3300026551 | Grasslands Soil | GGKTTVGQWVEVKGPLGPIMGGMMGPQVSKEFGTLLSNLAKKAETS |
| Ga0209648_101244401 | 3300026551 | Grasslands Soil | SQTVEVKGPLGPLLGGMLGPQVSKEFGTLLGNLAKKAEAT |
| Ga0209219_10167321 | 3300027565 | Forest Soil | ISQMVEIKGPWGPIMQGIMGPQVSKEFGTLLANLAKRAEAT |
| Ga0209219_10204771 | 3300027565 | Forest Soil | EVKGPLGPILRGMLGPQVSKEFGTLLTNLAKKAEAP |
| Ga0209220_10251891 | 3300027587 | Forest Soil | DPLPGGKTKIGQTVEVNGPLGFLRGMLGPGVSKEFGTLLANLANKAEAT |
| Ga0209220_11116361 | 3300027587 | Forest Soil | EPGAAGKTRISQMVEVKGPLGPVMQGMLGPQVSKEFGILLANLARKAEAGS |
| Ga0209180_101202954 | 3300027846 | Vadose Zone Soil | TVGQWVEVKGPLGPIMGGMMGPQVSKEFGTLLSNLAKRAESS |
| Ga0209180_104647722 | 3300027846 | Vadose Zone Soil | TKITQTVEVRGPLGPLLGGMLGPQVSKEFGTLLGNLAKRAERA |
| Ga0209590_108693972 | 3300027882 | Vadose Zone Soil | EPVGAESKLSQTVEVKGPLGFLHGMLGPGVSKEFGTLLSNLAKKAEAS |
| Ga0257175_10278963 | 3300028673 | Soil | QWVEVKGPLGPIMGGMMGPQVSKEFGTLLSNLAKKAEAS |
| Ga0307469_114525312 | 3300031720 | Hardwood Forest Soil | GQWVEVKGPLGAILGGMLGPQVSKEFGTLLSNLAKRAEAS |
| Ga0307477_108724911 | 3300031753 | Hardwood Forest Soil | QTVEVGGPLGPVMGGVLGPQVSKDFVTLLQNLARKAEAS |
| Ga0307471_1010407751 | 3300032180 | Hardwood Forest Soil | TVEVHGPLGPVLGGVLGPQVAKDFGTLLENLARKAETA |
| ⦗Top⦘ |