| Basic Information | |
|---|---|
| Family ID | F092890 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MRRFDMRLPAIVRLEGTSEFHTETQNVSARGVFFYLDR |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.07 % |
| % of genes near scaffold ends (potentially truncated) | 99.07 % |
| % of genes from short scaffolds (< 2000 bps) | 91.59 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.131 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.215 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.168 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.598 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 28.79% Coil/Unstructured: 71.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF07238 | PilZ | 6.54 |
| PF06739 | SBBP | 5.61 |
| PF13527 | Acetyltransf_9 | 0.93 |
| PF00158 | Sigma54_activat | 0.93 |
| PF02954 | HTH_8 | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.13 % |
| Unclassified | root | N/A | 1.87 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001431|F14TB_105381843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101458231 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300003324|soilH2_10238430 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10006994 | All Organisms → cellular organisms → Bacteria | 3505 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10053758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1536 | Open in IMG/M |
| 3300004092|Ga0062389_100680740 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1200 | Open in IMG/M |
| 3300004479|Ga0062595_102102654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300004635|Ga0062388_100871297 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300005178|Ga0066688_10934171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 533 | Open in IMG/M |
| 3300005330|Ga0070690_100090779 | All Organisms → cellular organisms → Bacteria | 2011 | Open in IMG/M |
| 3300005536|Ga0070697_100994180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
| 3300005538|Ga0070731_10906203 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300005542|Ga0070732_10095336 | All Organisms → cellular organisms → Bacteria | 1750 | Open in IMG/M |
| 3300005542|Ga0070732_10714939 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300005558|Ga0066698_10648645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
| 3300005712|Ga0070764_10760621 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300005764|Ga0066903_100883318 | All Organisms → cellular organisms → Bacteria | 1614 | Open in IMG/M |
| 3300005764|Ga0066903_100946914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1566 | Open in IMG/M |
| 3300005890|Ga0075285_1001466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2435 | Open in IMG/M |
| 3300005921|Ga0070766_10289206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1050 | Open in IMG/M |
| 3300005921|Ga0070766_10609933 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300005921|Ga0070766_10636231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| 3300006028|Ga0070717_11276980 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300006800|Ga0066660_10109664 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1973 | Open in IMG/M |
| 3300009176|Ga0105242_10116766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2283 | Open in IMG/M |
| 3300009520|Ga0116214_1395501 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300009665|Ga0116135_1402855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300010047|Ga0126382_10199313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1422 | Open in IMG/M |
| 3300014199|Ga0181535_10271823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1017 | Open in IMG/M |
| 3300015052|Ga0137411_1355318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1745 | Open in IMG/M |
| 3300016357|Ga0182032_10788347 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300017936|Ga0187821_10001239 | All Organisms → cellular organisms → Bacteria | 7677 | Open in IMG/M |
| 3300017937|Ga0187809_10180335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300017941|Ga0187850_10122472 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
| 3300017943|Ga0187819_10290575 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 951 | Open in IMG/M |
| 3300017993|Ga0187823_10225885 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300017995|Ga0187816_10409365 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300017995|Ga0187816_10558085 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300018023|Ga0187889_10122070 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1262 | Open in IMG/M |
| 3300018038|Ga0187855_10326574 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300018043|Ga0187887_10472091 | Not Available | 740 | Open in IMG/M |
| 3300018482|Ga0066669_10609610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 957 | Open in IMG/M |
| 3300019786|Ga0182025_1099877 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1403 | Open in IMG/M |
| 3300019887|Ga0193729_1141539 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300020022|Ga0193733_1093792 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300020583|Ga0210401_10337474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1368 | Open in IMG/M |
| 3300021088|Ga0210404_10463196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 714 | Open in IMG/M |
| 3300021168|Ga0210406_10941547 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300021178|Ga0210408_10733623 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300021180|Ga0210396_10157969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2035 | Open in IMG/M |
| 3300021180|Ga0210396_10458253 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300021403|Ga0210397_10510334 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300021406|Ga0210386_10156284 | All Organisms → cellular organisms → Bacteria | 1910 | Open in IMG/M |
| 3300021433|Ga0210391_10507855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 946 | Open in IMG/M |
| 3300021478|Ga0210402_10595357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1025 | Open in IMG/M |
| 3300022557|Ga0212123_10419964 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300022557|Ga0212123_10669047 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300022734|Ga0224571_115216 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300025906|Ga0207699_10286110 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300025926|Ga0207659_10423497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1117 | Open in IMG/M |
| 3300025945|Ga0207679_10206625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1644 | Open in IMG/M |
| 3300025992|Ga0208775_1000341 | All Organisms → cellular organisms → Bacteria | 2430 | Open in IMG/M |
| 3300026023|Ga0207677_11790079 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300026552|Ga0209577_10431409 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300027535|Ga0209734_1074033 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300027565|Ga0209219_1085806 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300027648|Ga0209420_1035185 | All Organisms → cellular organisms → Bacteria | 1551 | Open in IMG/M |
| 3300027867|Ga0209167_10405994 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
| 3300027889|Ga0209380_10107970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1612 | Open in IMG/M |
| 3300027889|Ga0209380_10126398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1488 | Open in IMG/M |
| 3300027889|Ga0209380_10383944 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300027895|Ga0209624_10395817 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300027903|Ga0209488_10690963 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300027903|Ga0209488_11161922 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300027908|Ga0209006_11277881 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300027911|Ga0209698_10445182 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300027915|Ga0209069_10329032 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300028747|Ga0302219_10139277 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300028775|Ga0302231_10526397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300028906|Ga0308309_10948064 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300029915|Ga0311358_11093709 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300029951|Ga0311371_12116757 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300029999|Ga0311339_10009341 | All Organisms → cellular organisms → Bacteria | 15543 | Open in IMG/M |
| 3300030053|Ga0302177_10147307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1329 | Open in IMG/M |
| 3300030520|Ga0311372_10785411 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
| 3300030617|Ga0311356_11179219 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300030991|Ga0073994_10083464 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300030991|Ga0073994_12316764 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300031028|Ga0302180_10223262 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300031090|Ga0265760_10102906 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300031231|Ga0170824_100225306 | All Organisms → cellular organisms → Bacteria | 1511 | Open in IMG/M |
| 3300031234|Ga0302325_10522183 | All Organisms → cellular organisms → Bacteria | 1784 | Open in IMG/M |
| 3300031236|Ga0302324_100677590 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
| 3300031718|Ga0307474_10116382 | All Organisms → cellular organisms → Bacteria | 2005 | Open in IMG/M |
| 3300031718|Ga0307474_10369422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1113 | Open in IMG/M |
| 3300031720|Ga0307469_12461207 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300031754|Ga0307475_10706996 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300031754|Ga0307475_11460530 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300031788|Ga0302319_10655710 | Not Available | 1076 | Open in IMG/M |
| 3300031823|Ga0307478_11073149 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300031823|Ga0307478_11427513 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300031823|Ga0307478_11698378 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300031938|Ga0308175_100849946 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300031938|Ga0308175_100882433 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300031954|Ga0306926_10888255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1068 | Open in IMG/M |
| 3300031962|Ga0307479_10349497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1462 | Open in IMG/M |
| 3300032180|Ga0307471_102491938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.21% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 9.35% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 9.35% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.48% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 7.48% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.61% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.74% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.80% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.80% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.87% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.87% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.87% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.87% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.87% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.93% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.93% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005890 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU3 | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025992 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104 (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TB_1053818432 | 3300001431 | Soil | MRRFDMRLPADIRLNGSHTDEFHTETQNESARGVFFYL |
| JGIcombinedJ26739_1014582311 | 3300002245 | Forest Soil | MRRFDMRLPAVVRLDQENEFQTETQNVSARGVFFYFDKPL |
| soilH2_102384302 | 3300003324 | Sugarcane Root And Bulk Soil | MMRRFDMRLPASVRVRELGPDPFMTETQNVSARGVFFYLDRPI |
| JGIcombinedJ51221_100069941 | 3300003505 | Forest Soil | MRRFDMRLPAIVRVDGTNEFHTETLNVSARGVFFYLDRPVVAGT |
| JGIcombinedJ51221_100537582 | 3300003505 | Forest Soil | MRRFDMRLPAVVRLSQENGQENEFQTETQNVSARGVFFYLDRPVEAGT |
| Ga0062389_1006807401 | 3300004092 | Bog Forest Soil | MMRRFDMRLPAVVRLDDAAEFHTETQNVSARGVFFYLDREVSAGTKLEVTL |
| Ga0062595_1021026542 | 3300004479 | Soil | MRRFDMRLPAAVRLVGVENEFFTETQNVSARGVFFYLDRPI |
| Ga0062388_1008712972 | 3300004635 | Bog Forest Soil | MRRFDMRLPAVVHLEGATEFHTETQNVSARGVFFYLDRAVAAGTKIEV |
| Ga0066688_109341711 | 3300005178 | Soil | MRRFDMRLPATVRLAGGQADEFLTETQNVSARGVFLYLDGPVEEG |
| Ga0070690_1000907793 | 3300005330 | Switchgrass Rhizosphere | MRRFDMRLPASVRVAGNGLSDLLTETQNVSARGVFFYLDRP |
| Ga0070697_1009941801 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRFDMRLPASVKVDGVAVDELLTETQNVSARGVFFYLDRP |
| Ga0070731_109062032 | 3300005538 | Surface Soil | MRRFDMRLPATVRMAGTAAGEFHTETQNVSARGVFFYL |
| Ga0070732_100953362 | 3300005542 | Surface Soil | MRRFDMRLPAIIRLEAAGEFQTETQNVSARGVFFYLD |
| Ga0070732_107149391 | 3300005542 | Surface Soil | MRRFDMRLPAVVRLEGSSEFHTETQNVSARGVFFYLDRAVEAG |
| Ga0066698_106486452 | 3300005558 | Soil | MRRFDMRLPATVRLAGGQTDEFLTETQNVSARGVFL |
| Ga0070764_107606212 | 3300005712 | Soil | MRRFDMRLPALVRLGKDNEFQTETQNVSARGVFFYLDR |
| Ga0066903_1008833181 | 3300005764 | Tropical Forest Soil | MRRFDMRLPAIVRPEGAGEFHTETQNVSARGVFFYLDKPVS |
| Ga0066903_1009469143 | 3300005764 | Tropical Forest Soil | MMRRFDMRLPASIRVREMGSEPFMTETQNVSARGVFFYLDRA |
| Ga0075285_10014661 | 3300005890 | Rice Paddy Soil | MRRFDMRLPAIVRIESANEFRTETQNVSARGVFFYVDRPISAGT |
| Ga0070766_102892061 | 3300005921 | Soil | MRRFDMRLPAIVRLDQENEFHTETQNVSARGVFFYLD |
| Ga0070766_106099332 | 3300005921 | Soil | MRRFDMRLPAVVRLNQENGQENEFQTETQNVSARGVFFYLDRPVEAGT |
| Ga0070766_106362311 | 3300005921 | Soil | MRRFDMRLPAVVRLTGDNEFQTETQNVSARGVFFYLD |
| Ga0070717_112769801 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRFDMRLPALVKVGDVDECQTETQNVSARGVYFYLNH |
| Ga0066660_101096641 | 3300006800 | Soil | MMRRFDMRLPAIVRLASENDQENEFHTETQNVSARGVFFYLDKPLPAGT |
| Ga0105242_101167661 | 3300009176 | Miscanthus Rhizosphere | MRRFDMRLPASVRVAGNGLSDLLTETQNVSARGVF |
| Ga0116214_13955011 | 3300009520 | Peatlands Soil | MRRFDMRLPAVVRLEGASEFQTETQNVSARGVFFYLDRA |
| Ga0116135_14028551 | 3300009665 | Peatland | MRRFDMRLPAVVHLSDSTLAELLTETQNVSARGIFF |
| Ga0126382_101993132 | 3300010047 | Tropical Forest Soil | MRLPAEVRLSGTHTDEFHTETQNVSARGVFFYLDRSV |
| Ga0181535_102718232 | 3300014199 | Bog | MRRFDMRLPAVVRLDQDNEFQTETQNVSARGVFFYLDR |
| Ga0137411_13553183 | 3300015052 | Vadose Zone Soil | MRRFDMRLPATVRVLAGLRDLSTETQNVSARGVFFYLDRPLAEACASK* |
| Ga0182032_107883471 | 3300016357 | Soil | MRRFDMRLPAIVRLEGTREFHTETQNVSARGVFFYLDDPISAG |
| Ga0187821_100012391 | 3300017936 | Freshwater Sediment | MRRFDMRLPAVVRLSDTNEFQTETQNVSARGVFFYLDRV |
| Ga0187809_101803351 | 3300017937 | Freshwater Sediment | MRRFDMRLPAIVKVTDATVDELLTETQNVSARGVFLYLDRSLAPGARIQV |
| Ga0187850_101224721 | 3300017941 | Peatland | MMRRFDMRLPALVRLDRTNLGGTNADQENEFQTETQNVSARGVFFYLDRSVPTGTR |
| Ga0187819_102905751 | 3300017943 | Freshwater Sediment | MMRRFDMRLPAIVRLAGAAEFRTETQNVSARGVFFYL |
| Ga0187823_102258851 | 3300017993 | Freshwater Sediment | MRRFDMRLPAVVRLSDTNEFQTETQNVSARGVFFYLDRVVDA |
| Ga0187816_104093651 | 3300017995 | Freshwater Sediment | MRRFDMRLPAVVRLEGADELHTETQNVSARGVFFYLDRAVSA |
| Ga0187816_105580851 | 3300017995 | Freshwater Sediment | MRRFDMRLPAIVRLEDAGEVHTETQNVSARGVFLYLD |
| Ga0187889_101220701 | 3300018023 | Peatland | MRRFDMRLPAVVRLDQTGRNQKTEFKTETQNVSARGVFFYLDRP |
| Ga0187855_103265741 | 3300018038 | Peatland | MRRFDMRLPALVRLEGQNQSPEGEVQTETQNVSARGVFF |
| Ga0187887_104720913 | 3300018043 | Peatland | MRRFDMRLPALVRLEGQNQSPEGEVQTETQNVSARG |
| Ga0066669_106096102 | 3300018482 | Grasslands Soil | MRRFDMRLPASVKVDGVAVDELLTETQNVSARGVFFYLD |
| Ga0182025_10998771 | 3300019786 | Permafrost | MRRFDMRLPALVRLDENNEFQTETQNVSARGVFFYLDRTST |
| Ga0193729_11415392 | 3300019887 | Soil | MRRFDMRLPAVVRLNQENEFHTETQNVSARGVFFYLDRPLPAG |
| Ga0193733_10937922 | 3300020022 | Soil | MRRFDMRLPALVKFGAEQEPQFSTETQNVSARGVFFHL |
| Ga0210401_103374741 | 3300020583 | Soil | MRRFDMRLPAIVKVADATVDELLTETQNVSARGVFLYLDRSLA |
| Ga0210404_104631961 | 3300021088 | Soil | MRRFDMRLPASVRVAGNGFSDLLTETQNVSARGVFFYL |
| Ga0210406_109415471 | 3300021168 | Soil | MRRFDMRLPAIVRLEPTNEDQENEFHTETQNVSARGVFFYLDKSVPA |
| Ga0210408_107336231 | 3300021178 | Soil | MRRFDMRLPALVRLEGADEFQTETQNVSARGVFFYLDRA |
| Ga0210396_101579691 | 3300021180 | Soil | MMRRFDMRLPAIVRLEGSSDSATTEVQTETQNVSARGVFFYLDRPVEAGTKLEVTL |
| Ga0210396_104582532 | 3300021180 | Soil | MRRFDMRLPAIVRVEGTGAGQLSEVQTETQNVSARGVFFYLDRAIA |
| Ga0210397_105103341 | 3300021403 | Soil | MRRFDMRLPAIVRLEGTSEFHTETQNVSARGVFFYLDR |
| Ga0210386_101562841 | 3300021406 | Soil | MRRFDMRLPALVRLGEDNEFQTETQNVSARGVFFYLD |
| Ga0210391_105078551 | 3300021433 | Soil | MRRFDMRLPAIVQVEDSAVGELLTETQNVSARGVFLYLDRPL |
| Ga0210402_105953571 | 3300021478 | Soil | MRRFDMRLPAVVRLNEDQENEFHTETQNVSARGVFFYLDREVAAGT |
| Ga0212123_104199641 | 3300022557 | Iron-Sulfur Acid Spring | MRRFDMRLPAVVRLEGAHEVQTETQNVSARGVFFYLDRAVE |
| Ga0212123_106690471 | 3300022557 | Iron-Sulfur Acid Spring | MRRFDMRLPALVKVGDVDECQTETQNVSARGVFFYLDHTV |
| Ga0224571_1152161 | 3300022734 | Rhizosphere | MQSDERRTMRRFDMRLPAVVRLDQENEFQTETQNVSARGVFFYLDR |
| Ga0207699_102861102 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRFDMRLPAIVRLEGTSEFHTETQNVSARGVFFYLDRPVSAGTKLE |
| Ga0207659_104234971 | 3300025926 | Miscanthus Rhizosphere | MRRFDMRLPASVRVAGNGLSDLLTETQNVSARGVFFYLDR |
| Ga0207679_102066252 | 3300025945 | Corn Rhizosphere | MRRFDMRLPASVRVAGNGLSDLLTETQNVSARGVFF |
| Ga0208775_10003411 | 3300025992 | Rice Paddy Soil | MRRFDMRLPAIVRIESANEFRTETQNVSARGVFFYVDRPISAG |
| Ga0207677_117900791 | 3300026023 | Miscanthus Rhizosphere | MRRFDMRLPAIVRIESANEFQTETQNVSARGVFFYLDRPISAGAK |
| Ga0209577_104314091 | 3300026552 | Soil | MRRFDMRLPAIVRLASENDQENEFHTETQNVSARGVFFYLDKPLPAGT |
| Ga0209734_10740331 | 3300027535 | Forest Soil | MMRRFDMRLPALVRLEGADEVRTETQNVSARGVFFYL |
| Ga0209219_10858061 | 3300027565 | Forest Soil | MRRFYMRLPATVRMPLGGDAYEIATETQNVSARGIFFYLDQ |
| Ga0209420_10351852 | 3300027648 | Forest Soil | MRRFDMRLPAVVHIEGASEFHTETQNVSARGVFFYLDRAIA |
| Ga0209167_104059942 | 3300027867 | Surface Soil | MRRFDMRLPAIVKLEGASEFHTETQNVSARGVFFYLDH |
| Ga0209380_101079703 | 3300027889 | Soil | MRRFDMRLPAIVRLDQENEFHTETQNVSARGVFFYLDKSVPAGTRCE |
| Ga0209380_101263981 | 3300027889 | Soil | MRRFDMRLPAVVRLSQENGQENEFQTETQNVSARGVFFYLDRPVEAG |
| Ga0209380_103839441 | 3300027889 | Soil | MRRFDMRLPAVVRLNQENGQENEFQTETQNVSARGVFFYLDRPVEAG |
| Ga0209624_103958171 | 3300027895 | Forest Soil | MRRFDMRLAAVVRLNPDNEFHTETQNVSARGVFFYLD |
| Ga0209488_106909631 | 3300027903 | Vadose Zone Soil | MMRRFDMRLPAIVRLDQENEFHTETQNVSARGVFFYLDK |
| Ga0209488_111619221 | 3300027903 | Vadose Zone Soil | MRRFDMRLPATVHVAGQGLRDLSTETQNVSARGVFFYL |
| Ga0209006_112778811 | 3300027908 | Forest Soil | MRRFDMRLPALVHVEGVRPQGANEFHTETVNVSARGVYFYLDRAVSAGTKL |
| Ga0209698_104451821 | 3300027911 | Watersheds | MRRFDMRLPAIVRVEGTDEFHTETLNVSARGVFFYVDRPVNAGTKAEVT |
| Ga0209069_103290322 | 3300027915 | Watersheds | MMRRFDMRLPAIVRLEGADEVQTETQNVSARGVFFYLD |
| Ga0302219_101392772 | 3300028747 | Palsa | MRRFDMRLPAVVHIEGASEFHTETQNVSARGVFFYLDRAV |
| Ga0302231_105263971 | 3300028775 | Palsa | MMRRFDMRLPAVVRLDQDHEFHTETQNVSARGVFFYLDRPIPAGTPCEVT |
| Ga0308309_109480642 | 3300028906 | Soil | MRRFDMRLPAIVRLEGDNEFHTETQNVSARGVFFYLDRAVS |
| Ga0311358_110937091 | 3300029915 | Bog | MRLPAVVRLKSEAAPESGLGNEFQTETQNVSARGVFFYLDR |
| Ga0311371_121167571 | 3300029951 | Palsa | MMRRFDMRLPAVVRIEDAGVPLDEVHTETQNVSARGIFFYLDR |
| Ga0311339_1000934112 | 3300029999 | Palsa | MRRFDMRLPAVVRLDESSEFQTETQNVSARGVFFYLDRAV |
| Ga0302177_101473071 | 3300030053 | Palsa | MRRFDMRLPAVVRLDQDHEFHTETQNVSARGVFFYLDRP |
| Ga0311372_107854111 | 3300030520 | Palsa | MMRRFDMRLPAIVRLEGTGDVHTETQNVSARGVFFYLDRA |
| Ga0311356_111792191 | 3300030617 | Palsa | MMRRFDMRLPAVVRLDQDHEFHTETQNVSARGVFFYLDRP |
| Ga0073994_100834641 | 3300030991 | Soil | MRRFDMRLPATVRLDGAAEFHTETQNVSARGVFFYLD |
| Ga0073994_123167641 | 3300030991 | Soil | MRRFDMRLPAIVRREGANEFQTETQNVSARGVFFYLDR |
| Ga0302180_102232622 | 3300031028 | Palsa | MMRRFDMRLPAVVRIEDAGVPLDEVHTETQNVSARGIFFYLDRTVNAG |
| Ga0265760_101029061 | 3300031090 | Soil | MRRFDMRLPAVVHIAGASEFHTETQNVSARGVFFYLDRAVAAGT |
| Ga0170824_1002253061 | 3300031231 | Forest Soil | MRRFDMRLPAIVRLEGASEFHTETQNVSARGVFFYLDRAVAAGTKLEVTL |
| Ga0302325_105221832 | 3300031234 | Palsa | MRRFDMRLPAVVRLDESSEFQTETQNVSARGVFFYLDRA |
| Ga0302324_1006775901 | 3300031236 | Palsa | MRRFDMRLPAVVRLDESSEFQTETQNVSARGVFFYLDRAVAEGTRCEVT |
| Ga0307474_101163821 | 3300031718 | Hardwood Forest Soil | MRRFDMRLPAVVRLDEKNEFQTETQNVSARGVFFYLDR |
| Ga0307474_103694221 | 3300031718 | Hardwood Forest Soil | MRRFDMRLPAVVRLDQENEFHTETQNVSARGVFFYLDRPLPAGT |
| Ga0307469_124612071 | 3300031720 | Hardwood Forest Soil | MRRFDMRLPAIVRLEGANEFHTETQNVSARGVFFYVDRPVIA |
| Ga0307475_107069961 | 3300031754 | Hardwood Forest Soil | MRRFDMRLPAIVRVEGTTEFHTETLNVSARGVFFYLDRPVITGTRAEVTLT |
| Ga0307475_114605302 | 3300031754 | Hardwood Forest Soil | MMRRFDMRLPATVHLAGTIEFHTETQNVSARGVFFYLDR |
| Ga0302319_106557101 | 3300031788 | Bog | MMRRFDMRLPALVRLDRTNLGGTNADQENEFQTETQNVS |
| Ga0307478_110731491 | 3300031823 | Hardwood Forest Soil | MRRFDMRLPAVVRFDQENEFETETQNVSARGVFFYLDRPVPAGTRC |
| Ga0307478_114275131 | 3300031823 | Hardwood Forest Soil | MRRFDIRLPASIRMAGDPAGEFHTETQNVSARGVFFYI |
| Ga0307478_116983781 | 3300031823 | Hardwood Forest Soil | MRLPALVRLDQDNEFQTETQNVSARGVFFYLDRPLP |
| Ga0308175_1008499462 | 3300031938 | Soil | MRRFDMRLPAAVQLAGENDQQFVTETQNVSARGVFFYLDRPLQT |
| Ga0308175_1008824331 | 3300031938 | Soil | MRRFDMRLPAIVRIESANEFQTETQNVSARGVFFYLD |
| Ga0306926_108882551 | 3300031954 | Soil | MRRFDMRLPAIVRLEGTREFHTETQNVSARGVFFYLDDPI |
| Ga0307479_103494972 | 3300031962 | Hardwood Forest Soil | MMRRFDMRLPAIVRLEGADEVQTETQNVSARGVFFYLDRAV |
| Ga0307471_1024919381 | 3300032180 | Hardwood Forest Soil | MRRFDMRLPASVRVAGNGFRDLLTETQNVSARGVFFYLDR |
| ⦗Top⦘ |