| Basic Information | |
|---|---|
| Family ID | F092837 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 46 residues |
| Representative Sequence | QETVGQIRNYMDGARSALKEGDVLRANTLAVKAHLLSEDLVKH |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.95 % |
| % of genes near scaffold ends (potentially truncated) | 97.20 % |
| % of genes from short scaffolds (< 2000 bps) | 86.92 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.72 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.458 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (13.084 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.318 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.187 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.52% β-sheet: 0.00% Coil/Unstructured: 46.48% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.72 |
| Powered by PDBe Molstar | |
| SCOP family | SCOP domain | Representative PDB | TM-score |
|---|---|---|---|
| a.102.1.9: Trehalase-like | d2jg0a_ | 2jg0 | 0.95175 |
| a.24.19.0: automated matches | d5mawe_ | 5maw | 0.92834 |
| a.8.11.1: AF1782-like | d2oo2a1 | 2oo2 | 0.92749 |
| f.25.1.1: Cytochrome c oxidase subunit III-like | d7cohc_ | 7coh | 0.92703 |
| a.118.8.0: automated matches | d6kp3a_ | 6kp3 | 0.92459 |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF13578 | Methyltransf_24 | 20.56 |
| PF01850 | PIN | 14.95 |
| PF00483 | NTP_transferase | 9.35 |
| PF02604 | PhdYeFM_antitox | 2.80 |
| PF03720 | UDPG_MGDP_dh_C | 1.87 |
| PF13181 | TPR_8 | 1.87 |
| PF03743 | TrbI | 0.93 |
| PF04073 | tRNA_edit | 0.93 |
| PF02698 | DUF218 | 0.93 |
| PF02823 | ATP-synt_DE_N | 0.93 |
| PF01596 | Methyltransf_3 | 0.93 |
| PF13424 | TPR_12 | 0.93 |
| PF02515 | CoA_transf_3 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 2.80 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 2.80 |
| COG0355 | FoF1-type ATP synthase, epsilon subunit | Energy production and conversion [C] | 0.93 |
| COG1434 | Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 family | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.93 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| COG2948 | Type IV secretory pathway, VirB10 component | Intracellular trafficking, secretion, and vesicular transport [U] | 0.93 |
| COG2949 | Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycin | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG4123 | tRNA1(Val) A37 N6-methylase TrmN6 | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.46 % |
| Unclassified | root | N/A | 6.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573001|GZR05M101CJJP8 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300001593|JGI12635J15846_10391226 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 841 | Open in IMG/M |
| 3300001593|JGI12635J15846_10395284 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300002910|JGI25615J43890_1026601 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10216910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 777 | Open in IMG/M |
| 3300004080|Ga0062385_11207867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 517 | Open in IMG/M |
| 3300004091|Ga0062387_101380142 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300004092|Ga0062389_100337251 | All Organisms → cellular organisms → Bacteria | 1597 | Open in IMG/M |
| 3300004635|Ga0062388_101951551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 606 | Open in IMG/M |
| 3300005995|Ga0066790_10007211 | All Organisms → cellular organisms → Bacteria | 4933 | Open in IMG/M |
| 3300006052|Ga0075029_100233563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 1157 | Open in IMG/M |
| 3300006059|Ga0075017_100697600 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300006162|Ga0075030_100382710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 1121 | Open in IMG/M |
| 3300009029|Ga0066793_10244925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1040 | Open in IMG/M |
| 3300009088|Ga0099830_10589453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 911 | Open in IMG/M |
| 3300009143|Ga0099792_10977327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300009519|Ga0116108_1017210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2541 | Open in IMG/M |
| 3300009521|Ga0116222_1465613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300009521|Ga0116222_1480886 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300009522|Ga0116218_1152917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1047 | Open in IMG/M |
| 3300009552|Ga0116138_1014768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 2515 | Open in IMG/M |
| 3300009631|Ga0116115_1011654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2673 | Open in IMG/M |
| 3300009634|Ga0116124_1097438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 833 | Open in IMG/M |
| 3300009635|Ga0116117_1101442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300009639|Ga0116122_1066040 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
| 3300009643|Ga0116110_1082126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1112 | Open in IMG/M |
| 3300009644|Ga0116121_1056884 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1226 | Open in IMG/M |
| 3300010341|Ga0074045_10288829 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300010379|Ga0136449_102703786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 704 | Open in IMG/M |
| 3300010379|Ga0136449_103079048 | Not Available | 648 | Open in IMG/M |
| 3300010379|Ga0136449_104583538 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300011270|Ga0137391_11435993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300012205|Ga0137362_10707439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 866 | Open in IMG/M |
| 3300012362|Ga0137361_11409944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300012582|Ga0137358_10151950 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1577 | Open in IMG/M |
| 3300012924|Ga0137413_10144642 | All Organisms → cellular organisms → Bacteria | 1545 | Open in IMG/M |
| 3300012925|Ga0137419_10482299 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300012925|Ga0137419_10989495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300014155|Ga0181524_10210040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 945 | Open in IMG/M |
| 3300014158|Ga0181521_10156654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1300 | Open in IMG/M |
| 3300014162|Ga0181538_10741720 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300014494|Ga0182017_10447173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 796 | Open in IMG/M |
| 3300014496|Ga0182011_10160617 | All Organisms → cellular organisms → Bacteria | 1546 | Open in IMG/M |
| 3300014638|Ga0181536_10209796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 962 | Open in IMG/M |
| 3300016730|Ga0181515_1442428 | Not Available | 1243 | Open in IMG/M |
| 3300016750|Ga0181505_10468944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300017931|Ga0187877_1344881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300017933|Ga0187801_10030325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1894 | Open in IMG/M |
| 3300017941|Ga0187850_10463018 | Not Available | 550 | Open in IMG/M |
| 3300018006|Ga0187804_10003107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5112 | Open in IMG/M |
| 3300018012|Ga0187810_10320839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300018014|Ga0187860_1221883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 763 | Open in IMG/M |
| 3300018016|Ga0187880_1059220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2009 | Open in IMG/M |
| 3300018019|Ga0187874_10455042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300018020|Ga0187861_10451809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300018034|Ga0187863_10309036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 879 | Open in IMG/M |
| 3300018035|Ga0187875_10060692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2189 | Open in IMG/M |
| 3300018035|Ga0187875_10575880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300018046|Ga0187851_10049200 | All Organisms → cellular organisms → Bacteria | 2762 | Open in IMG/M |
| 3300018057|Ga0187858_10366291 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300018057|Ga0187858_10402070 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 851 | Open in IMG/M |
| 3300019787|Ga0182031_1381146 | All Organisms → cellular organisms → Bacteria | 2000 | Open in IMG/M |
| 3300020199|Ga0179592_10409373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300020579|Ga0210407_10133222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1907 | Open in IMG/M |
| 3300021168|Ga0210406_10471385 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 996 | Open in IMG/M |
| 3300021170|Ga0210400_11165612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300021171|Ga0210405_10831484 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
| 3300021474|Ga0210390_11281715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300021478|Ga0210402_10588760 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1031 | Open in IMG/M |
| 3300022532|Ga0242655_10261819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300022873|Ga0224550_1034543 | Not Available | 720 | Open in IMG/M |
| 3300025406|Ga0208035_1014089 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
| 3300025448|Ga0208037_1016464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1842 | Open in IMG/M |
| 3300025453|Ga0208455_1008853 | All Organisms → cellular organisms → Bacteria | 2571 | Open in IMG/M |
| 3300025480|Ga0208688_1027392 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
| 3300025507|Ga0208188_1109956 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300026499|Ga0257181_1043761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300026557|Ga0179587_10761692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300027297|Ga0208241_1056277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300027583|Ga0209527_1119953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300027591|Ga0209733_1017190 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1941 | Open in IMG/M |
| 3300027604|Ga0208324_1183588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300027616|Ga0209106_1103322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300027783|Ga0209448_10248233 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300027803|Ga0209910_10028962 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300027812|Ga0209656_10159092 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1125 | Open in IMG/M |
| 3300027894|Ga0209068_10273496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 943 | Open in IMG/M |
| 3300027908|Ga0209006_10423388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1119 | Open in IMG/M |
| 3300027911|Ga0209698_10207345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1582 | Open in IMG/M |
| 3300029903|Ga0247271_128652 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300029985|Ga0302280_1051134 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1736 | Open in IMG/M |
| 3300029995|Ga0302210_10094285 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300030019|Ga0311348_10857059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300030049|Ga0302191_10099701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1171 | Open in IMG/M |
| 3300030058|Ga0302179_10017009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3593 | Open in IMG/M |
| 3300030503|Ga0311370_11558355 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300030520|Ga0311372_12597123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300030659|Ga0316363_10165475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 940 | Open in IMG/M |
| 3300030659|Ga0316363_10322790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300031823|Ga0307478_11508077 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300032174|Ga0307470_11041754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300032805|Ga0335078_11426126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
| 3300032829|Ga0335070_10844867 | Not Available | 850 | Open in IMG/M |
| 3300033402|Ga0326728_10033296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8518 | Open in IMG/M |
| 3300033983|Ga0371488_0119073 | All Organisms → cellular organisms → Bacteria | 1430 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 13.08% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 12.15% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.28% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.48% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.48% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 5.61% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.67% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.74% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.74% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.80% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.80% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.87% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.87% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.93% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.93% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.93% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.93% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.93% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.93% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573001 | Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
| 3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
| 3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300016730 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
| 3300025406 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025448 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025453 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025480 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027803 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712S3S | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300029903 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703 | Environmental | Open in IMG/M |
| 3300029985 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_1 | Environmental | Open in IMG/M |
| 3300029995 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_2 | Environmental | Open in IMG/M |
| 3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030049 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_1 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FD2_07156560 | 2189573001 | Grass Soil | APGDSTAPFDSQELETVSQIHNYMEGSRLALKQGDVSRAHTLAQKASLLTEDLASH |
| JGI12635J15846_103912263 | 3300001593 | Forest Soil | NYMEGARSALKEGDVRRANTLAQKAHLLSEDLVKH* |
| JGI12635J15846_103952843 | 3300001593 | Forest Soil | RNYMDGARSALKEGDVLRANTLAVKADLLSEDLVKH* |
| JGI25615J43890_10266011 | 3300002910 | Grasslands Soil | QDKLKGLAGRAMDARKQETLEQIRNYMEGARSALKEGDVRRANTLAQKAHLLSDDLVKH* |
| JGIcombinedJ51221_102169102 | 3300003505 | Forest Soil | LPAQRQETVAQIHNYMDGARAALQEGDVRRASTLAEKAHLLADELVRR* |
| Ga0062385_112078672 | 3300004080 | Bog Forest Soil | QETIGQIRNYMDGARAALREGDLRRASTLAEKAHLLSEDLVTH* |
| Ga0062387_1013801421 | 3300004091 | Bog Forest Soil | GQIRNYMDGARSALKEGDVRRANTLAEKAHLLADDLVKH* |
| Ga0062389_1003372514 | 3300004092 | Bog Forest Soil | AGRTLDARQQETAGQIRNYMDGARSALKEGDLRRASTLAEKAHLLADDLVKH* |
| Ga0062388_1019515512 | 3300004635 | Bog Forest Soil | LSAQQQETVEQIHNYMDGARSALKEGDVRRAGTLAEKAHLLTDDLVKH* |
| Ga0066686_108095162 | 3300005446 | Soil | QQEMFVQIRHYIDGARSALKESDTQRAHTLALKAYLLSDDLVKH* |
| Ga0066790_100072113 | 3300005995 | Soil | MRLKPLTGRTLDERQAETLGQIRNYMTGARSALQEGDVRRASTLAEKAHLLADDLIGR* |
| Ga0075029_1002335633 | 3300006052 | Watersheds | LAARTLEEKRQETVGQIRNYMDHARLALKEGDLRRANTLAEKAHLLSDDLVKR* |
| Ga0075017_1006976001 | 3300006059 | Watersheds | AHRQETVGQIRNYMEGARSALKEGDVRRASTLAQKAHLLAEDLVKH* |
| Ga0075030_1003827101 | 3300006162 | Watersheds | NYMDHARLALKEGDLRRANTLAEKAHLLSDDLVRR* |
| Ga0066793_102449251 | 3300009029 | Prmafrost Soil | TVGQIRNYMDGARSALKEGDVLRANTLAVKAHLLSEDLVKH* |
| Ga0099830_105894531 | 3300009088 | Vadose Zone Soil | GRTLDAKQQEAVGQIRNYMEGARSALKEGDVRRANTLAQKAHLLSEDLVKH* |
| Ga0099792_109773271 | 3300009143 | Vadose Zone Soil | DAKQRETVGQIRNYMDGARSALKEGDVRRANTLAQKAHLLSEDLVKH* |
| Ga0116108_10172101 | 3300009519 | Peatland | QETVGQIRNYMDGARSALKEGDVLRANTLAVKAHLLSEDLVKH* |
| Ga0116222_14656132 | 3300009521 | Peatlands Soil | LDAREQETAGQIRNYMVGARSALKEGDLRRASTLAEKAHLLAEDIVKR* |
| Ga0116222_14808862 | 3300009521 | Peatlands Soil | KQLAGRTLDARQQETVGQIRNFMNGARSALKEGDTRRASTLAQKAHLLSEDLVKH* |
| Ga0116218_11529171 | 3300009522 | Peatlands Soil | IRNYMGGARSALQEGDLWRANTLAQKAHLLADDLVKH* |
| Ga0116138_10147681 | 3300009552 | Peatland | LKAQQQETVGQIRNYMDGARSALQEGDLRRASTLAEKAHLLADDLVKH* |
| Ga0116115_10116544 | 3300009631 | Peatland | DARQQETVGQIRNYMDGARSALKEGDVLRANTLAVKAHLLSEDLVKH* |
| Ga0116124_10974382 | 3300009634 | Peatland | GQIRNYMVGARSALQEGDLRRANTLAQKAHLLADDLVKH* |
| Ga0116117_11014421 | 3300009635 | Peatland | ETVAQIRNYMNGARGALQDGDVSRANTLAEKAHLLADDLLRH* |
| Ga0116122_10660401 | 3300009639 | Peatland | QIRNYMDGARSALKEGDVLRANTLAVKAHLLSEDLVKH* |
| Ga0116110_10821261 | 3300009643 | Peatland | AQQQETVGQIRNYMVGARSALQEGDLRRANTLAQKAHLLADDLVKH* |
| Ga0116121_10568841 | 3300009644 | Peatland | QQETVGQIRNYMVGARSALQEGDLWRANTLAQKSHLLADDLVKH* |
| Ga0074045_102888293 | 3300010341 | Bog Forest Soil | RPLDPQRQETVEQIRNYMEGARSALKEGDVQRASTLAEKAHLLAEDLVKH* |
| Ga0136449_1027037863 | 3300010379 | Peatlands Soil | YMGGARSALQEGDLWRANTLAQKAHLLADDLVKH* |
| Ga0136449_1030790481 | 3300010379 | Peatlands Soil | VGQIRNYMGGARSALQEGDLWRANTLAQKAHLLADDLVKH* |
| Ga0136449_1045835381 | 3300010379 | Peatlands Soil | RQQETVGQIRNYMGGARSALQEGDLWRANTLAQKAHLLADDLVKH* |
| Ga0137391_114359932 | 3300011270 | Vadose Zone Soil | YMDGARSALKEGDLRRAGTLAEKAHMLSDDLVRH* |
| Ga0137362_107074391 | 3300012205 | Vadose Zone Soil | GRPLDAKQQEAVAQIRSYMDGARSALKEGDVRRANTLAQKAHLLSEDLVKH* |
| Ga0137361_114099442 | 3300012362 | Vadose Zone Soil | QIRSYMDGARSALKEGDVRRANTLAQKAHLLSEDLVKH* |
| Ga0137358_101519501 | 3300012582 | Vadose Zone Soil | RLKRLTGQALDAPQQETVVQIRNYMDGARSALKDGDVRRANTLALKAHLLSKDLVKD* |
| Ga0137413_101446421 | 3300012924 | Vadose Zone Soil | RQYMDGARSALKESDIQRAHTLALKAHLLSDDLVKH* |
| Ga0137419_104822991 | 3300012925 | Vadose Zone Soil | KQQETVGQIRNYMEGARSALKEGDVRRANTLAQKAHLLSEDLVRH* |
| Ga0137419_109894951 | 3300012925 | Vadose Zone Soil | QQEAVAQIRNYMDGARSALKEGDVRRANTLAQKAHLLSEDLVKH* |
| Ga0181524_102100401 | 3300014155 | Bog | DQLKVLAARTLDVQQQETVGQIRNYMVGARSALQEGDLWRANTLAQKAHLLADDLVKH* |
| Ga0181521_101566544 | 3300014158 | Bog | DARQQETVGQIRNYMDGARSALHEGDVRRASTLAQKAHLLAEDLAKH* |
| Ga0181538_107417202 | 3300014162 | Bog | EGRSLDARQQEVAGQIRNYMDGARSALQEGDLRKASTLALKANLLAEDLLKH* |
| Ga0182017_104471733 | 3300014494 | Fen | GRTLDAPQQETVGQIRNYMNGARLALQEGDVRRASTLAQKAHLLSEDLVKH* |
| Ga0182011_101606171 | 3300014496 | Fen | YRNGARSALQEGDLLRAGTLAASAHWLADDLAKR* |
| Ga0181536_102097961 | 3300014638 | Bog | TLDAQQQETVGQIRNYMVGARSALQEGDLRRANTLAQKAHLLADDLVKH* |
| Ga0181515_14424282 | 3300016730 | Peatland | GDRLKQLAERTLDAQRQETVGQIRNYMEGARSALREGDVQRANTLAEKAHLLAEDLAKH |
| Ga0181505_104689443 | 3300016750 | Peatland | AGRTLNTQQQETVGQIHNYMDGARSALKEGDVQRASTLAEKAHLLAEDLAKH |
| Ga0187818_102087571 | 3300017823 | Freshwater Sediment | TVSQIHNYMEGARSALKEGDISRAHTLAMKAALLAEDLARH |
| Ga0187877_13448812 | 3300017931 | Peatland | GRNLNPQQQETLGQIRNYMEGARGALQEGDVRRASTLAEKAHLLADDLLKH |
| Ga0187801_100303253 | 3300017933 | Freshwater Sediment | LAERTLDARQQETVGQIRNYMEGARSALQEGDVRRANTLALKAHLLAADLVKH |
| Ga0187850_104630181 | 3300017941 | Peatland | TVGQIRNYMVGARSALQEGDLWRANTLAQKAHLLADDLVKH |
| Ga0187804_100031071 | 3300018006 | Freshwater Sediment | TRTLGARQQETVAQIHSYMRGASSALKEGDVRRANTLAQKAHLLAEDLVKH |
| Ga0187810_103208391 | 3300018012 | Freshwater Sediment | GDQLKQLAERTLDARQQDTVGQIRNYMDGARAALKEGDVRRASTLAQKAHLLAEDLVKH |
| Ga0187860_12218833 | 3300018014 | Peatland | VGRTLDAQQQETVGQVRNYMGGARSALQEGDVRRASTLAEKARLLAEDLVRH |
| Ga0187880_10592201 | 3300018016 | Peatland | QETVGQIRNYMEGARSALREGDVQRANTLAEKAHLLAEDLAKH |
| Ga0187874_104550422 | 3300018019 | Peatland | KQLAGRNLNPQQQETLGQIRNYMEGARGALQEGDVRRASTLAEKAHLLADDLLKH |
| Ga0187861_104518092 | 3300018020 | Peatland | NYMDGARSALKEGDLRRAGTLAEKAHLLVDDLVTH |
| Ga0187863_103090361 | 3300018034 | Peatland | QQETVGQIRNYMDGARGALREGDLRRASTLAEKAHLLSEDMVTH |
| Ga0187875_100606923 | 3300018035 | Peatland | VGQIRNYMVGARSALQEGDLWRANTLAQKAHLLADDLVKH |
| Ga0187875_105758801 | 3300018035 | Peatland | QIRNYMDGARSALREGDVRRASTLAQKAHLLAEDLVKH |
| Ga0187851_100492005 | 3300018046 | Peatland | VGQIRNYMDGARGALREGDLRRASTLAEKAHLLSEDMVTH |
| Ga0187858_103662911 | 3300018057 | Peatland | IRNYMDGARSALKEGDVLRANTLAVKAHLLSEDLVKH |
| Ga0187858_104020703 | 3300018057 | Peatland | GRTLDARQQETVGQIRNYMVGARSALQEGDLRRANTLAQKAHLLADDLVKH |
| Ga0182031_13811466 | 3300019787 | Bog | PGQIRNYMEGARGALQEGDVRRASTLAEKAHLLADDLLKH |
| Ga0179592_104093732 | 3300020199 | Vadose Zone Soil | LKRLAGRTLDAKQQETVGQIRNYMEGARSALKEGDVRRANTLAQKAHLLSEDLVKH |
| Ga0210407_101332221 | 3300020579 | Soil | DKLKRLTGRTLDAKQQETVGQIRNYMEGVRSALKEGDVRRANTLAQKAHLLSEDLVKH |
| Ga0210406_104713851 | 3300021168 | Soil | GQIRNYMEGVRSALKEGDVRRANTLAQKAHLLSEDLVKH |
| Ga0210400_111656121 | 3300021170 | Soil | ETIGQIRNYMQGARSALKEGDVRRAGTLAEKAQLLAEDLVKH |
| Ga0210405_108314843 | 3300021171 | Soil | DAKQQETVGQIRNYMEGVRSALKEGDVRRANTLAQKAHLLSEDLVKH |
| Ga0210390_112817151 | 3300021474 | Soil | QLKQVTERTLNAQQQETVGQIHNYMDGSRAALKEGDVRRARTLAQKAHLLAEDLVKH |
| Ga0210402_105887604 | 3300021478 | Soil | KLKRLTGRTLDAKQQETVGQIRNYMEGVRSALKEGDVRRANTLAQKAHLLSEDLLKH |
| Ga0242655_102618191 | 3300022532 | Soil | LDAKQQETVGQIRNYMEGVRSALKEGDVRRANTLAQKAHLLSEDLLKH |
| Ga0224550_10345432 | 3300022873 | Soil | ADRTLDTQKRETVGQIRNYMDGARSALKEGDVRRASTLAQKAHLLSEDLLKH |
| Ga0208035_10140891 | 3300025406 | Peatland | LKQLAGRNLNPQQQETLGQIRNYMEGARGALQEGDVRRASTLAEKAHLLADDLLKH |
| Ga0208037_10164641 | 3300025448 | Peatland | IRNYMDGARSALQEGDLRRASTLAEKAHLLADDLVKH |
| Ga0208455_10088531 | 3300025453 | Peatland | VGQVRNYMGGARSALQEGDVRRASTLAEKARLLAEDLVRH |
| Ga0208688_10273921 | 3300025480 | Peatland | TLDARQQETVGQIRNYMDGARSALKEGDVLRANTLAVKAHLLSEDLVKH |
| Ga0208188_11099562 | 3300025507 | Peatland | QQQETVGQIRNYMVGARSALQEGDLRRANTLAQKAHLLADDLVKH |
| Ga0257181_10437611 | 3300026499 | Soil | LKRLAGLTLDAPQQETVGQIRNYMDGARSALKEGDVRRANTLALKAHLLSEDLVKD |
| Ga0179587_107616923 | 3300026557 | Vadose Zone Soil | IRNYMDGARSALKEGDVRRANTLAQKAHLLSEDLVKH |
| Ga0208241_10562772 | 3300027297 | Forest Soil | QQETIGQIRNYMQGARSALKEGDVRRAGTLAEKAQLLAEDLVKH |
| Ga0209527_11199531 | 3300027583 | Forest Soil | VQQQDRVGQVRNYLVGARSALQEGDLRRAHTLALKAHLLSDDLIKH |
| Ga0209733_10171901 | 3300027591 | Forest Soil | TVGQIRNYMEGVRSALKEGDVRRANTLAQKAHLLSEDLVKH |
| Ga0208324_11835882 | 3300027604 | Peatlands Soil | NYMGGARSALQEGDLWRANTLAQKAHLLADDLVKH |
| Ga0209106_11033223 | 3300027616 | Forest Soil | RTLDAKQQETVGQIRNYMEGARSALKEGDVRRANTLAQKAHLLSEDLVRH |
| Ga0209448_102482331 | 3300027783 | Bog Forest Soil | AGQIRNYMDGARSALKEGDVRRANTLAEKAHLLADDLVKH |
| Ga0209910_100289622 | 3300027803 | Thawing Permafrost | LGQIRNYMEGARGALQEGDVRRASTLAEKAHLLADDLLKH |
| Ga0209656_101590924 | 3300027812 | Bog Forest Soil | VRNYMEGARSALKEGDVQRASTLAEKAHLLADDLVKH |
| Ga0209068_102734961 | 3300027894 | Watersheds | ETVGQIRNYMEGARSALKEGDVLRANTLAVKAHLLSEDLVKH |
| Ga0209006_104233881 | 3300027908 | Forest Soil | IHNYMDGARAALKEGDVRRASTLSEKAYLLAEDLAKH |
| Ga0209698_102073453 | 3300027911 | Watersheds | VGQIRNYMDHARLALKEGDLRRANTLAEKAHLLSDDLVKR |
| Ga0247271_1286523 | 3300029903 | Soil | LDVSQQQAMSQIHNYVDGARSALQEGDVRRASTLAEKAHLLAEDLLSH |
| Ga0302280_10511344 | 3300029985 | Fen | SQIHNYVDGARSALQEGDVRRASTLAEKAHLLAEDLLSH |
| Ga0302210_100942851 | 3300029995 | Fen | YMNGARSALKENDLSRAWTLASKASLLGDDLEQHQPSAQQ |
| Ga0311348_108570591 | 3300030019 | Fen | ARTLDGRQQETVGQIRNYVVGARSALKEGDVRRAGTLAEKAHLLVEDLVKH |
| Ga0302191_100997011 | 3300030049 | Bog | STDEQLKQLAGKKLDVSQQQAMSQIHNYVDGARSALQEGDVRRASTLAEKAHLLAEDLLS |
| Ga0302179_100170094 | 3300030058 | Palsa | ETVGQIRNYMDGARSALKEGDVRRASTLAQKAHLLSEDLLKH |
| Ga0311370_115583551 | 3300030503 | Palsa | SRSLDAERQETFDQIRNYMDGSRSALKEGDVQRANTLAEKAHLLAEDLAKH |
| Ga0311372_125971232 | 3300030520 | Palsa | QVKQLSGRTLDAQQQETVGQIRKYMEGARAALKEGDVQRASTLAEKAHLLAEDLVKH |
| Ga0316363_101654752 | 3300030659 | Peatlands Soil | DAREQETAGQVRNYMVGARSALKEGDLRRASTLAEKAHLLAEDIVKR |
| Ga0316363_103227901 | 3300030659 | Peatlands Soil | LDARQQETVAQIHNYMGGALSALKEGDVRRANTLAQKAHLLAEDLVKH |
| Ga0307478_115080771 | 3300031823 | Hardwood Forest Soil | VLPNVHQQETVVQIRNYMDGARSALKEGDVRRARTLAEKAHLLAQDLLKR |
| Ga0307470_110417541 | 3300032174 | Hardwood Forest Soil | DAGQQEVVGQIRNYMVGARSALKEGDVRRANTLAQKAHLLVEDLAKH |
| Ga0335078_114261261 | 3300032805 | Soil | RQLAGRTLDTRQLDTVGQIHSYMEGARSALKEGDVGRANTLAQKAHLLAEDLAKH |
| Ga0335070_108448671 | 3300032829 | Soil | RQQETVSQIHNYMDGARSALKEGDIPRAHTLAQKASLLADDLVKH |
| Ga0326728_100332961 | 3300033402 | Peat Soil | LNAQQQETVGQIRNYMNGAHSALQEGDVRRASTLAQKAHLLAEDLVKH |
| Ga0371488_0119073_3_170 | 3300033983 | Peat Soil | KQLAGRVLNAQQQETAAQARNYMEGARAALQEGDLRRASTLAEKAHLLVDDLAKH |
| ⦗Top⦘ |